Press Alt + R to read the document text or Alt + P to download or print.

No preview available

The URL can be used to link to this page

Home My WebLink AboutLUA02-040 4 of 5 &li to /a /PZ S iCNQFILMEG ✓ G LuN000 LEGEND 5<Vl n�iOD wARU AXL,S R.VNDAIED <T•aTsa- I-, -•=d. _r_ F _ Qr:irs- �rf ' •mom^..>...."a. 'z;1;,,,,—,;W„ SPECIAL FLOOD HAZARD AREAS INUNDATE ZONE X ---:<i•lTS2- R`�?`_-NtY::. WCT T E. ••,T.TN�T MAR. / cj t1 Ir7.dl ,k,,.,,„ ,.:. rs,r;�,. BY 10()—YEAR FLOOD ><A•• ITITTAN8801" 015CRITTlo„of Eoc ATIaN 31 ov v." V�i:tr:," .HTTP ,:.,, bolt •>, .,, _°r` o �� f il SON". „te e • 1..M� ZONE A No base flood elevations determined. n •ndI _::� / /'i' 1/11 I _,,,,- ZONE AE Base Rood elevations determined. O` w,•^4°'°••� `a : " CITY OF biL•RCER ISLAND I \L"Dn0" N/ .�a 1g4rOtt..T � `,1pik rt /G/yy� °jlf� •. '• W`R 4Rt! ' To�.v "^"' °°�^^Z^'^'^Z •ZONE AH Flooddepthsof 1to 3 feetlusuallyls" ,s.,T im: ' eI ,>ET I. ZONE%/ OO © 0O .: ."_u H.,a.E,„, arey� �,On O ONE AE g ZONE% "" Po CI; baseBnodelevatiol/��f."�/ I _ ,„: ""n.e :a S':e:.::E'. ".o:e ) / TowRT A.< ..,...e: of ndin�` °" - determined. "ri " wiIcons i; ,� _ .^1.000WAT AREAS IN zoNE AE fA �� li `Wk •r,.. \� G „'Sj. I }� OTNC0.HOOD ARFAS � �! •� • W ° •a °°•• rr • • �/ .ETRiTRETr nMzm�w3A l ZONE X z Ta.aa ZONE AO Flood depths of 1 to 3 feet (usually she, /y'I IJ .Ie.: . ,T� c� �`� s 2 0 �':'-� • :.. d"w flow on sloping terrain); average deptl T y T , eu:'° 'd: �� °1� P t ¢ , F Ha. determined.For-areas of alluvial fan Bnodin y�rp• ��° ••.""'°' •Li....r TI„ �° 5 u° * m` velocities also determined. ®®®'io `o f m. O1,/R WAS ".; /". I ZONE A99 To be rotected from 100-year flood b L. I:ING COUNTY II u " •,w+ p® ,,CC�� `� UNINCORPORATED AREAS / 'MIN.T:„sTRTET j I TOWT o 4ta . .,.,, .w ",w„, .. Federal flood protection system undc �� 530U71 // MI. ' 1 construction;no base elevations determines i MT,0410MD COASTAL BARRIERS /(:...... AM„ .. f; \ ZONE V Coastal flood with velocity i 3 .`•;� e ty hazard (was s' f I w▪ \I action);no base flood elevations determines F n II S 2 1 yR' `" "'"'" ..T. �.� ' ZONE VE Coastal flood with velocity< >oR-v TCI„_ 1 3 [......1 v>ra hazard wavE / m'" ,:mol rcT„STREET R u 32 "`r`"STREET ______ Am.., .. „ "`E action); base flood elevations determined I� KING COUNTY _— eO ' ' ct" FLOODWAY AREAS IN ZONE AE\ 1 4'. • " ,wrT„ar„nRru, 1 UNINCORPORATED AREAS + '"E?-.a''T w"' °""°.,;a';,,;"., o `�T� s3oo�1 '' , _::: :.; ; OTHER FLOOD AREAS • Y�2 WADI YD,STREET i `6't �" 5"ca,•``rma Wrw° �� E.!. �, 0 ER.a, `5• ZONE X Areas of S00-year flood;areas of 100-yea I / ( r ----s13----- . E..T..r<n w<.; flood with average depths of less that ' O CU dfa °""n� "� q o^k ° 1 foot or with drainage areas less that Ri} ZONE X A !EL ERrIu.denn 1 square mile; and areas protected bl sTPETr ZONE X CITY OF RENTON tuna o"^� • 'R' RI.TT•, ©7 co 530088 x �"'�'��^>�,••• levees from 100-year flood. a ,sTUTT 1/ .52 ,:n..v. / F 0,_u . n'aRT„ E�ND SIRE-ET n('��`�NE X 9rgT'30".St•3T'l0' msm Daun"w OM"'P �I OTHER AREAS • / P. © ZONE X �3TES ,,,-- -,...,......, „O,o I I ZONE X Areas determined to be outside 500-year TloRni .<nI snrtET MIMIC., flM211F ` m.�'..."`"'mw wnnme wm nweas �{ ZONE A . floodplain. • ; :m T . B oa VI) .=o,.e.,p�.•:<a .o. ZONE D 3 , „F�, ZONE% a{ o �° :;' ^�,••^�•, <� o,.'tom. Areas in which flood hazards are / a �' Q �:°"".'E"sy ant ol_ Ism,„„°>,i.,.y,,,.a.,..,,;�,",t,„w undetermined. \\` ru.I„ 4 TM SIRE:, Ai c 5? v.`o'eo ..>,".,,..°•.>,.:..E°mw ,.,„..^.a".>,tit a P•:.a m 0 p`" UNDEVELOPED COASTAL BARRIERS fl y + \ „aui„Tit„oArr .E 6I",R.ET HORTiewn MN ' <-"^`.' +w". \ �` �\ S I s AAST TMq]T -TT:, I F+.ry...woman.ue \ \\ ((ldf>Oq NE iCM NWT"FAST ZONE• x �' a.�` Identified Identified P i \ , \� Ra COURT ppeo, 1983 Otherwise s \•\R Ew. y 4 �� —"a• � p °" w ,.—„. artier are normal 1990 Protected Area Coastal b as are ly located within or adjacent to Special �� _/,:n. um; g 'm Flood Hazard Areas. \ \.\„ Q G Flood Boundary \ MAP naLaTor,T \ s........\\ 2 0 en i °O0.1°"'0"' "" °" '.°"" Floodway Boundary \ a RET EL Ruwll OF — — VfOM. v ,:aRC„cSYF Tan,STREET Z 00,11TAIDE ELMO INSUEANCE nalE.S<AP,ia y Zone D Boundary 4 5 L f EFFEcnvE PAT[S1OF R^ASID,RSITO n4i PwFy. 3 2: 1 \ r 3 0 "° """ ms"4y ri Boundary Dividing Special Flood F � � Hazard Zones, and Boundary q ,Fnw s;R_T 'v3`i�T,:k =i,- ,.T`. Dividing Areas of Different ` x Coastal Base Flood Elevations \ - TsEASTnF _/� W Within Special Flood Hazard (� �n Zones. APPROOLWr SCALE IN FEET Base Flood Elevation Line: Lake Washington 1 < NORnRASf SIKET =� y 513 Elevation in Feet. See Map Index ' . for Elevation Datum. \9 " �� O O Cross Section Line d 5 RATE IfIMi 11h NA71=ROOD INSURANCE PROGRAM I (EL 987) Base Flood Elevation in Feet _ 4111dd�100�^ Where Uniform Within Zone. NOTE:MAP AREA SHOWN ON THIS PANEL IS _ % R J j I� R^^7 See Map Index for Elevation Datum. LOCATED WITHIN TOWNSHIPRa NO(mRANGE �! �I�� 1 I X Elevation Reference Mark ,.i,TM E 5 wu O M2 River Mile \\I,k .‘ — ti j FLOOR INSURANCE RATE MAP i.E < KIR MEET s i'I�i y KING COUNTY, o o Horizontal Coordinates Based on North WASHINGTON AND 97 07'30",32 22'30" American Datum of 1927 (NAD 27) /� } < s j ail INCORPORATED AREAS Projection. :// a 2 € PANEL 664 OF ti25 4 II!: .. N...awT ton,A:r A W M .E uIn IREEr • ss ton P 4r�h.I./ $ Yam•' c`' r I iI II �-� "k, s: u , I caeomn _MIR VS. y • Q< 2 • .xmE.. - 1 St i,olm,c:.T °,RETT 1 .T...R<..r T,..: m., . _ Wopir-44 ill.,1 RD1TO" CEDAR m 6 Axrcnr R(wER .." CORPORATE LIMITS .,./ y T a ta•- s MAP NUMBER , i ZONE AE ',ioN6,+E+: ,''' - 7 ,�II`I 53033CO6fi4 f •=3(:: -1,.y`- 'µ IS:t ZONE X r'� 0 <T•3a•P- ' •t"-- .. .. '� �;yr+�. MAP REVISED: arD•oT- .a--S MEL a:Ti <T•xm MAY 16,1995 23>v5" y LL. • _ W1 1+ „xei-o.,oz/rm.:.i,..__,.vsaicvmmwzw�oxcv.unco_�o+c 'PRs , $ h I- ,111�. r 13 dyq�le�7MM 1 uyw�y. i a rI _ dI' t� 1� •. i . `i f fl �y ' H O R i Nall .i!_ iiiiiieligg _ i SS $.1 . E L A ° �� x6M 'N ��i•II� N Jy` LS N LSIf L N_ d .. r�.o • o x a Ap•x : t If 10 11 Il 11 rrI.1 I ICI1} IN WNWUW W I!If ziElilig��Z Icy i y`° �'° t ` a ', �I �'�!",^ E9 0555 �'a JC�]pC��I S'F�N N , 1 6-4 a` a° ' IMAM r 3 r 4ee �O L—■lI` -p.oElf °a 9 b 5d,. a t I.{'�1it4-, 1� a d7 ti,' � F I7 �7 R!I M r `4` r4 '�° a zs - x• l�il ■fd ��i : :..1 i .(1 A N a°' °• A <I: 11. f 77 �]Er� rr a�rr FF Y rr�■[C n �u I a cite .a °`' '��m 1� ' IJ�Cle�tiQ:'��9��C>;�IsiaaW©@��Ces Ii414e�J 47 itmoti,thl�:I{}�w1��2 n n�a ; —�f rMrl! . 11 II •u Isar ;SS .e' ''„f • i .,,,i ili AH,Elogit -4MMINILItiMIMIONYME:iiNIT9e •:'4; . - P'_GL'a li �EQ h ° t E�gr ' I,i�..f! "�E�;?>egi'i!�:�I ll nrJL]I::if!!AgliigI3,AIR�i; ,:, i �,� m ilQ ,��!(l�I pap �j �r1..•lr�wp1`,{��ry rii v=N 'a !�� '1' munci 1� , SB i ip 1"F ,']i el�C7-.`gpS�LI�+s��Jx,�3i�Y.i�rju N t'[A" � i ° .O �.d o''�^ ® y,jt, 1 '' .r A I till y k-i ,y 1:1..w4�lak:i�[S.�J �:'JL:� ikL' .1 i y !� J2� `.Ip. it • :t 1 INN r5 �F.� yyy ,� a{;ur'r aP^ . n+:,`�i�41�� 02�� __—'"an.- `1 I. i ��z �' ��jii7tJt9i��IpFi�`IL�Fi[i� ■{¢,wuilu..r I � ` �°�I P.TF . P }� 4 I[� ,� Ls Nl9f N I illitangitoilMalliglEir /a�q �I atl SI01 ' .4 ii • tl �yl� ll t r ■�® r ��ryl llMll�p 1qK1`F.1�L1 ,{'fl` ��u��ry'��y �, ...... a bi ' �~ .•• ♦44 "'^"' :1 LS Nl9[ 'It 141 �HL9 N� li{iiVO IEIVIIMEISY�Ppl3lOP'i tii •701 7 no0 L J yyoi` J71 jL _!��.y''�y °fig . - t if z kia ',.,`.4 ' u I WAN _ ' * �15 NLLf�qII N rfl /a/I�,ly✓- Iy � �s�x12��x :Lu .e �7 � �1h,�eiix��4'i��'s��,i,:!1C��NlirlS�.�4',��d �„b Ill z_ •,,�. ��Nii Zrv�l�r'j��} r�l �•gC N�I..Vl 7�1yr m.•r,��-� r ZJfl� .. iii I .lier ,i,_3,ir,,1 : 1 ETLIII , 1 MIL111 i IPA' \\ 3adatl OOZE n .0 , ..,, _ .„,_ • .:. Ac, ,,,,,,, Y+ rri �®'19NIH Vmi . !Ii.. NV '{�7 �iiM"\ •�,,, ,,, � �, ��' D t1 rn . › If/ kw n s•N' l IH •a 3- — I Z t11L le op MEM t \\ i 100 I mom fb-.3N.-.�..� ,.-._. SN194 N47 /. 1 N �1L1��''11 9D uoy l'iy 'gy�pp = i`�lY \, ��) � sRW°LbZ �Ie'. �.,+f'° � ", D ""� I--1--I [+] (,I y- iyy-�a] .,r 1}ii f �� ;%�Q • hip t, Al EBI ci 1 aP' ` „, 1 -• O O o Z I-- 0 1 r T�v p �m L91 r ,��®�i/S\•, `."m..\ `'�> L.J ' Z p tli HL9L s 3S • .. i�P ;- ' �'_ 1—] y ® _., _1 t ` E1 4pa MI,.^n6b 14."3...V..!.I. T ' ? .---' I e' 17 ill,...,„.,...4., .S.i " p. 9 1 itp,t, ,,mQ,/,. ///�Q a Nam, '-d it, * • 4 '''''1=,'4%-,.': _ 6. 6- thht, 4 1 ppc_______, 0 N f+-_- _ —d---- q T Permit Review "a,.. ' r : 1 Not for Construction a a x T, BARBEE MILL PRELIMINARY PLAT OWNER. 'Oa'2 r b NEIGHBORHOOD DETAIL MAP R'>RRBEE 6f11101.WI ,ffi,ra'CO. „ 1)- ,. 83—i_ Rot ala33013 PoREHiON,1A 9000iN oEP1 8 > M.aRl-lxd-s000 +' 3..:• KEB mm, MICROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. BARBEE MILL PRELIMINARY PLAT OVERALL PLAT PLAN /#' ;` 0D,'DS '2DD w�, 2 o /✓ D� OB < jNG fON G O z/i o f { s I ' ;//' 77.-10 ic--' 001 I j; fi- sg <2 �//,/,,,,......-.--0---. _ /).,,z7.- 04111- J COIL-2—I. '•`At � °, I 19 � TONG,afi•J % ,I :...1 I,:E--•11-•I�. I._"..I�.I Ic..J�.41-..Ja..II.-."��.,I�.J�.�I-'f-•_�.1y- I Ic".Y--- / All �_�'i 1 " I I i„14"i„fry y, 1' 1 •11°I' 11• 1' 1�' 'iI�•/' ', a-'/ / �LJL `JL_I JL_JL _JL• I / `etPI I I • IIr JLz1 JL_ JL__J, ' ',/ _ n/� LAKE I 1 --. ° / - ,,.--.__T .• _e ;.e'CREp A ,-, / \� ) Y ,� • ¢ N`Cw .'. ¢ WASHINGTON r =" _ (' _"� I r _-1 r i- / /1, / p .M - 5 1 r-- \\\.'r \``''/ II ' TY /// J/,/ ,,..... �LS:IlIC�•uilSf .• o 1og tr) I cz n — 1 r_",A // -/ "-/% •ij 0 SOT' O. 500' laoo' o ,41..i .m. .. <i\� . °i „/„.,_:-.....,,,,_ a. /_J//f I SCALE IN FEET _. J U I ce ,..' '-\ q ,�• :--. % ./ ,/f/i \ \- ^l '' / _ ,__ _ VICINITY_MAP _� QIVpe mm - N\ gyp� a. I =_= 1....‘'.,-• -•:,Nt 1�/ i, LEGAL DESCRIPTION: THE LHID COWRY O THD3 COL sITOAT®IN THE ears OP :> \ /i WASHINGTON.couxrr OP KING AND IS DESCRIBED AS Pouo�s: ,'� I -J • �•� `.. . /ij/ / �', / I ALL THAT PORTION OP GOVERNMENT LOT 1. INGTON 32.TOWNSHIP24 NORTH. ''' • <` \ ' / ' / \ RANGE A 8/3f,OIN IN GINS COUNTY,i1.ffiT RTH AND OP SECOND OLD Fy r;Y „ �- , - .,' /�°'- / / / S00REIATIDS ADJOINING LYING IIQTERLY OP NORTHERN PACIFIC RAILROAD RIGHT '• _I_ _ <__ `\ `,' • �/---l/ / / OP RAY,EECER'YTHAT PoRRON,IP ANY,OP SAD) SAID NI12 GOVERNMENT NORTH OP '� o.• I-1 ° \ Z•> ..' / / °• / I SHE lIEWERI.Y PRODUCTION OF THE NORTH LDIE OF SAID GOVERNMENT LOT 1. w�V L/- -J (,�.\\' .'2,40,';/ .. • r' / SITUATE IN THE COUNTY OP KING,STATE OP WASHINGTON. Mj r_.: l ib /, / / a z ---- 1- -./: / ! _.c- ` i / ' Q' FLOOD HAZARD a I, •.L-.:-t '-- 11 >I0 / / Ai THE 100 TEAR FLOOD HAZARD IS CONTAINED WITHIN TEE MAY CO BANES. S _� 1 r a z _ ' :aez%%� so- / / // 3.0 W R °�% C may ,' ./ !/,.. r ,._,:.e .. \-0-1,� ;f,.. i,: j o a / ium, / •o,.•-7`� / r a n.P " 620 DrtleeJ fey poo �nELrG A /^•`'✓ - / .1,0 4 4-, ILrAtmd.To 62033 /.r• 4- _1/.7.s '1,. �, RI" (fzsl:Tilt . •� �,��' - �"C,`�' /- - _ PAL i2 RTlt ' £ iV i' /f+ Z mewet/ '/.7, ' <';J`-�;/• ° 30209.7..007 $ L__ -..- p/.�.i '/ I Project No ----_R-R_ZONE____-- L All,'-' �// . , ,•-^,I N 40TH ST. a 07/oz 'sheet No. TALL BEFORE TOO DIG 1-800-/24-555$sheet 1 of 1 • . 1\41.C PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. BARBEE MILL PRELIMINARY PLAT APPROVAL APPLICATION . — I SITE INFORMATION: ( --- °/ LAKE 00812.1 EXISTING TAXING: COR-2 WA9w1G(oN ° 0 '/,/ - • ' FLOOD HAZARD GROSS SITE AREA: 2227 AC w DAIL AUGUST 27.2002 THE 100 YEAR FLOOD HAZDD TS HARBOR EXEMPTION: 0.64 AC ._..,. _ ,•�g,,,-- CONTAINED WITHIN THE RAY CREEK TOTAL GROSS SHE AREA: 22.01 AC ,. -- a a NET __ =o,- r. (GROSS-SENSITIVE IVE AREA: 17.60 AC NIAI-11 o I' Ilg d€ (moss-seRlme ARRAS.WATER&EXEMPTIMI ON) L_y' o/,� �. ' FSMrATED ROADS COVERAGE) FOOTPRINT'S: 65%IMPERVIOUS • \ (MOLDING AND ROADS COVERAGE) ,IR /` / PROPOSED DENSITY: MIN.0.67 DU/AC NET(116 DU) Pill. I ,0 0 PERMITTED DEHITY: 6 DR/AC NET 1wf.(OO DU) U J .� `b \ h _ . ! HOLDING 9EIRACE9 SEQUINED: REQUIRED PROPOSED MIN. alC I` • //// , I I (COL-2 ZONES 6� � RI ice , ��yl OM1 (COMMON ROT SINE) . .. ' -._ .'L..'` ma la V., I,i',•./, ,./(_ SIB YARD0' 6' -7 ��g 0 rF. FRONT RORT YARD lA �' '• p (, 1' e � ' / �- RMACK YARD 0' lo• '' NL2•iMA'�^`A•}TAuY.'-':w' -,. Yk 7 . 81 Cm-2 TONS / %�/� '\ CRITICAL AREA CIICOIAT[ON3 S00' 1000' '� $8 1 _ "//, AREA•�N LASS WA.&BITON&HUFFER: 1.A6 ACBES SCALE M FEET W� k, / AREA OF MAY CREEK k HUFPE& 9.10 ACRES gZ - n I'. i i / AILEA of rERATm A BUFFER: oPz ACRES VICINITY MAP '=m _LJ_LL ll„1�I_L.1e11 L. 8TRE6[♦ -L 1 _L '�.�;,i/ / f TOTAL: a.T/ACRES 0014R. • \ /n - '- '�/rr/ ROAD SPACE:RIGHT-OF-WAY(ON-RITE): 9.79 ACRES [� _J A y 1 roi r m l I /// _l� OPBN SPICE: 2.38 ACRES it A I n/.I//// GOP AREA IN STREETS AND OPEN SPACE: DOS CONSTRUCTION MITIGATION DESCRIPTION: 11-1 / , / •/ d i / ' • ANTICIPATEDUCO IN SPRING OF IS '" wum•a 1 , 1 m s `y g\ /./ ILL BE IN ACCORDANCE WITH STANDARD PRACTICES.BETWEEN THE �" 3 1 \ M„ / 1/ ,10'. NOTES: HOURS OF 7:00 AM TO 6:00 PM,UIEsS UNUSUAL CIRCUMSTANCES dl a �� I - \ . \a // / / . , § DICTATE OTHERWISE.IN THE EVENT ADDITIONAL HOURS ARE REQUIRED. Z ® ss\d n\ /I// / / - NOTIFICATION WILL BE GIVEN TO THE CITY OF REITTON. R \ \).',E �,\�• \ .//�/ / /,Z. 1. ALL EDEMI STRUCTURES TO BE REMOVED TOR ME EXCEPTION OF THE EXISTING V \e: \ �9 /09 MUEDING-r. AL.INRTONMATERLITS WDL HE HAIRED TO THE s-AE FROM THE SOUTH VIA TAKE WASHI NGTON BLVD..NE PARK DRIVE AND I-A05.FLAGMEN WILL BE \\�'�\ /,- / V 2. Au Easm+c RAILROAD TRACES ON SITE TO BE REMOVED. O DIRECT WITHIN TRAFFICr Memc u�URGER TRUCKS eED W /y;G_'= "' •/,% / S. PHASING:THE PROJECT ITL INCLUDE TWO PHASES. p,', . / FOR HOER TO BE DONE WITHIN THE TAKE WASHINGTON MD.RIGHT OF _ I /� / '� PLAN MAY AN INCCLUDDAPPROVED iI CLOSSUUREC of ONE CONTROL AND MITE FLAGMEN ETE UTILIZED.MIS a � r�'\ /9 it,,A.N' %:j/ LEGAL DESCRIPTION: eCCoRDANCErs1CHTH�CRY TEMPORARY NN N .TAte MARKINGS IN ►� --_-- P L.I/i �A\ j.�� LIPACIR FROM RUST SHAI1.MS LID®BY WATERING CONSTRUCTION 1/ ® t $ WASHINGTON.THE LAND REFERRED OF TRIG AND TO TESS RE IS EQUATED 1MIO1�ATE OF AREAS A9 NECESSARY.EROSION AND MUD CONTROL SHALL BE HAND= Ill ��` / /. °°`Y i% USING AN INPROVTD EROSION CONTROL PLAN,INCLUDING TOLE PRACTICES. g �. L /q /"/ AHD STREET SWEEPING IN ACCORDANCE WM STANDARD PRACTICES. \.a > /.. „�, i ALL THAT PORTION or GOVERNMENT DOT 1.SECTION 32.TOWNSHIP 24 NORTH. WASHES a W N o \ / Y RANGE 6 EAST.VAL.IN KING COUNTY.WAffiNGTON AND 01 SECOND CTASS O \\ \\/ �� 'a V ' / / OF WAY,,EXCEPT THAT ETANDS GPORTION MFG Y OF SAD OF SHOREI/NDS LY PACIFIC YMGRNORTH OAD F AGIIVRM4 SHAM ALL HEAVY BE RIOTED TO NORMAL WORKI OPERATIONS AND OTHER NG HOURS PRODUCING IMPACTS �•4. E < \'' ;// d\p /% THE iFSTEIG.Y PRODUCTION OF THE NORTH LOIN 0/SAD)GOVERNMENT LOT 1. (..) FROM THIS ACTIVITY AREA AT A MINIMUM.NO SPECIAL NIX W d %/Po\ e\\ ATTENUATION MEASURES ARE PUNTED AT THIS TINE • Z O Al.._ // ✓ �i 9ITIIATE IN THE COUNTY OF TRIG.STATE OF WAffiNCTON. / '/:/X • 0 i-1 W U Q, %� )/ /�i/x SHEET INDEX: (xi r,1,�1/ i'/ PLO COVER man ...i O x 0a / ,: P2_1 PBEIDINAR1r PLAT _..._. .„.„., 5r U R P2_2 PBvIMNARY PLAT P2-9 PRELiCIMAwr PLAT "0°."'4 41° N _•' ii Incorporated Ps..1 PYRETHRUM GRADING AND DRAINAGE PLAN c "w�) a 4' 620 036004 Vey noo P92 PBAImDR GRADING AND DRAINAGE PLAN $ /� NJ UrklooA We BB033 OVERALL PLAT PLAN NOT TO SCALE m O Phone. (M25) 82;-.8 P9-9 PRELIMINARY GRADING AND DEA/NAGE PLAN 0i. FAL NTT) e27-9577 mten,eL VEF.Owc1OM P4-.1 PRELIMINARY WHITE PUN `----•.---»..�.. 30209.001 001 P4-2 PRELIMINARY PINEY PLAN 0 7Di Project No. P1_0 P4-9 PREIDIVAR'T UTILITY PLAN Sheet No. ` ICAN.BEFORE YO0 DIG 1-800-424-55551 sheet 1 or 10 • • PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MICROFILMED 1e _,� :_ ® ® moos MAT — S ITT P2 3 FN> / N - _ 1 __NBBYB'S8•W 1085.47 'x as' .o m- .o w' wm' .o m' woo' u' TRACf•A• OPEN SPACE g .o oa .000 .om wm .o od I .om /; /'e Isms r °m' wop wm wed wm em em 'r I I r I r , ///- 23 �- Jr l r , r .o m , 1 - III 9.8 weem s / /.° wii _- m -I- g mlao I8 21 �mv 370010 Sr s Iig "°4m'.1aM°O40simm s '`amnoo s mnm v im.m s s i "x°°° I� v ....SF.14M.xamv -- / > I$I mans I 22 IaM.me.as I, $ .m °o se ^' N• 18 17 gl sgI aLanm @ $I annm I mmm s eoao s r s$ 18 .M>enm 91 s $ C �\ 19I M924 i 8 20 w "I a ml 14 PI G' 12 al 81 I' 7 5 € r4 8 3 s ' ENT L - I -- L___,,,, I 16 15 13 i 11 10 9 i 8 I i 1 6 I of m .`en.12 SF / ° i • '155'WATER f-- -1 - °, ,cv�oz3 -_-J L _1 J L J L _J .ow II II I I I I < 8I -oa,25_ ' 4as ooe o� mJ �w` __ w w .om .o J L wea woo J L.o __ J L I J I L I JO L ��./ nay. `' rem s - .om J bo-' a)'°° d' TRACT I , °^ 4- sm Vs9, a 0000 e.,i w woo' wm 40 __ w • m• I °° / /`x'" e'k r OPEH SPACE w m r� em �¢n . o 00�—._m__t0o I ,2$m _ tJ m ar 3 / • I o 26 ,,° � STREET A 8 s 15100 t • • =t "e ^`� M t �; :I nos 1 —ao,: „� „> -- elm STREET A r---'rr'— . / 72 C/ 755 sr 7 � m r '$I �2s ��' '� / ems ' s ma7Th // ç '° 8 N < `/ /' '� / 74 /76 enav //�',.\ 77 ,I^'a. I mnm Si rnnm s Q�An s, m s nrn.w v i 'SI GI �o I burns ' 10,\`, '• v/ I am.m I$ I I 67 3t N. I I 28I // // //�✓`\/ i' e I 70 I+ 69 68 66 65/ •9� N. L JJ i•e°8 ` �d' //' :L 78m sj`1 Bj -Lwoo I .00v J L__-1 I / � IpM1 -- " -- e o .m 1_.ew I .e J L -- o+w. t 4 r .a,am ' r-- nov -- oI Al:Cf55 @ I '� iR �1E9L> �sbs— ' x $I ,... .� TRACT•C 81 ^ -_ wzr., -- I m s ^ /wMetm s /.w,v s// �+7 U q ml OPEN SPACE S�' `\�. /'/ e®.ee s �ti� l g I '.....;-.1.--", \62 / // 63 .d 64/L/ °9 F 51 m'" TRACT•7 M o/ /o .Yw q SANITARY SEWER TT WATER QUALITY A.4.4.,` Mmm 66 \ 80 /g 61 ' /// / /e �� W�oRN "CAT:!': OCATION 8 ENT !/' // / 1 T�- / M1 jr.... / _� W�o YAV VAR�J - Iw /� ✓"/8,\_9� \, m2 61 � \ ° / �. 1 /r`nu\ /?^•/- z`Y s/ ✓/-� ez\$� a h 4 10 / Mom. G ST> sas, I w^.8 g `te 1 ems' 9 83 - \\>�,e h�• / CR. ` • s�N s8 85 ��e .. �,re "`� g j:. P" • /' \ / `- / \ \''"'aloe ° N 42'I R.O.w ` Sao. ae6�y \\`\ Po• , fit r- ,. __ ,„,....d,„ ------ • . . ,,,,.. Am —rn�s—______I_ s� 87 \ ..',°° rm /-\ C.o/ ms,o\\�t.ees 'go� 68 `\`' a�eeIT: — • 29 II"- I • 8ffi�\n`m.s �,� \�>\ ;a• ��n��\ \\�\.ste \\' 56 \\�\ 57 / Il 'anus\ \ \ \ \ Q a `�°e6 \ 55 I5.100 SF lk 1.;i' BB\ �\,v`• fP M1�� `\\\.`mraas g 54\\ \ 1\ \\\\'�'`¢ - ,� a' d P �' •' ml means s8 /' r/a .`r�s\\&\ 53 \\\ 4 Ev zaxe/ BCD' o I Is I e I 90- / .atu s '1` \ \ _ -- .. "• ~" Z I 31 I 2, `�:ooQ w I-- i u I / / °U`r32 I v - • ' ,,.� / 0 1 :Jt s I P 8 • I., '� /Am,uQ • c / ' SeTBA.'E I •enan v 33 ,a�j1 / \ / - c\ �r7- Q- • �`4,0 il •a. V O a • sr --r, y3a •°I w,. a7\ • I s.1 51A. I / LAND AUGUST 27, 20020 0 moor ee00 __ 8 s \`awo 9``\\ ,t,P?• ♦ . i _ pores g. a 5 6 MATCHLINE — SEE SHEET P2_2 Z m fAi c 302wt ;001 Iwa 09. .001 s P,e;e2_1 Sheet No. 1CAll BEFORE YOU DIG 1-800-424-5M Sheet 2 of 10 •,x[x9 03/M/02 6 0S# -->x\PPo.E[i\3o16°\3°z°9\9wc\PPH61\Pz_0O6G I K r `% L I § \ / a 4 m fq ( Ca0 \ 1 S\ q a ,\ \ .(0g II ,4 \ O\S \� 8 a Ti \ �/ °`�6° 2 I \\ _y,, °w6i ��' ,'t yti M°/�f s° 36 oa .pie ..a. / , \ -'' 6/ / .., tr.. .'°95/'g;/ \\ 1 III _ 1 \ \ ` 'ip .. -ya g n\ `/I lil 1 ; 1 I &i $ ',\ g t 1 , w . \ \ \ !O z6'h'� a q i 1 I P. 4 I I ¢ aq II \I g ■ i pep�S�`�\ - \ ��I s\ 9•`o\ $/ 1 i 1 I I III I w II III N II I � k. 6° ° \qi`O\ @ °° J`\y '°'°.\•.' . re I I a III N I I w \ k \\y,,, °i ' °�° q \\g 1 4°` 'p \ BOO �\ CT ,e \ I pgig 1 I a m I III I;I J 1 `•vl ` p)6 \i .n qi r`s� 7IN.,4. se<<T \ a ,// "pe.; II II R I• q `' \Ii1lII11L1 IL I _F .,,y ,4+./°//' a;a. �`O \ -7 \J}�� / y IIy I\ y I\ II -c0-<"' °.n-his __- 6i sc O $`� 4 ` o - -rz6. N. O 5.00 £ Wy�tlix�z°O°n _ Iy y�.,\. 'r`O,° ♦"a, ,\\y, \ 2>Po 1 3'p0 '- w, L /r • •�� o °c aPo �,'/kip \\ 1 �i.`tk,\ / x iiS' �'- /'/,\\:'1 di'. • • 1/ 'b gS.\ S \ , \v q z.4 e\\ gmi y,\ , .t, (�`J,,•$•�. C tt . N '� a ^i t.' Dy d� 4a pot <\ /o< /, b..6.6 i Z �1,' 'is ' \ v< o a ;\`\' may R'a • '//' ; J� tt 9 w �� . "N''". S gg m. aa� O �, 6; b4 CP '" 1 •3 _ ,sue. is tt e c ti sF °a\ n a; a ,;, S x0,. Is, 2 1 ds V, ��-''.- J \ 03 £l i RFFT V s° a,i \ . ,./ ' +140.4 ' • :70 /N f' ''''''' .. '\, if/ E 68g.\ \ 2 N� V.''' • 1 y cT°N eo �� e Js• \\ 1 t. i N::, • \ a or,2_7.(tai. —171 F C o N 1 _ g rn J Sg N Y O g. N t Permit Review g Not for Construction s s 9 gig 05 BARBEE MILL PRELIMINARY PLAT OWNER. o-0eN� . C)r0 "" 2. 1 og—§a. 1 PRELIMINARY PLAT BARBEE BOX e MILL +ONBL•w.N " o fV RENTON,Its 93057 \w> 6%>cox Ee 0 m,6e .� v EGO 00 �P o 4 SHEET 2 PH.{Y6-22B-3900 q y i ga. Am �a...,66� AICR•• F0L . E,D PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. / ' w 1 0 • ' /� '' // / / NOTE: / .9 \6, "/:.-. STREET T TO BE LOCATED AT D snNG ^„o RAILROAD CROSSING ////// [ V e�'b ~/ a= / / ,:f /��/ (I / . ,,q, , ,c,,,.,,,,,=,, 1 / „iP2 loam z / 81 sa. /7 , 1z $8 ' eq T O i' / 4 /' / / ,/ m3m NM\ /, / / • I r w.8 � E ' /\/'.•/! / /' A !' ; ,,` 1 / %/ / - ,_ " ' / j / a • / / / / a / / , • a g / -- /;' a„?0.,,. ---,1,---_. --f co'fs p 7 (n s _,Ir 1 i . 7//• 0 ep 0 i r `per g r---"' --- ,/ aver • os 6 � I amens s o a / �� ,/ )f % J / I'i lv I2 . ., / / ` \ - O Evn',,. (tau) 0-sus 1 �j Internet. ( m01ekWY • I I ' �'' ' // l 8/2'/jOt. F� 30209.001001 II I L I I I,,.., ' / -I I L'--ems I -i,� m� eta s®-`4:_n vim', // // ' Project No MATCHLINE — SEE SHEET P2_1 snee P2_3 AUGUST 27, 2002 BEFORE Y0U DIG 1-800-424-5555I sheet a of to MICROFiLMED PORTION OF GOVERNMENT LOT 1ii , SEC. 32, T24N, R5E, W.M. BARBEE MILL PRELIMINARY PLAT ' _, ' TOPOGRAPHY MAP --�� q. /, 0' 50' 100' 200' 4 ,'(re' A ,, L,,,, P , ,/, iio,c,-,.. .. ,,,,, ,,,g 0 ,,,,,/ , . -_-__ _... °tea°� — % /4-_-,,,,v/, y�� %= /� ,„ ; I - '''-- ri /I). - /) s" , LAKE I I _ / ..e ,,'„j/ r / / \ WASHINGTON / % / ., ox / /- / %% %%A/ I F 18 �l— _ _ , %/;;!��%%% !, VERTICAL DATUM, J /, / /%/ / / ASSUMED,BASED ON BENCHMARKS SHOWN ON PLAN • — - • . �— J.. % / 4t1 +�BENCHMARK ",4 .. iJ —_ .• / yti e.. I /Y S TSlsti IX c / /i' `' ' -ff, •S' I:4 na°y Lxx,,,,,,DA o 1- V •/.- 1^S 4I,,1�II f1';\ 1�r r/ Q!'J G. • :..6,...,i.. , !ill!.1 //7/ cv / - :/� /% �'.•,'i�4 // u�� =" TMS MAP WAS CREATED BY ME OR UNDER �_ O //y i\,'\ •,/� �y C.4TBe AIY OIRECnON.PtAMME1NIC FEATURES AND O a • • j/A,,/% I ; // 'A" COMOURS WERE LED-FROM THE AR. a \� "3,,;,!. % / ,' � PACRC 64.EL FAND OEVEL SURVEY OF B50Y. •UTH i E U L - „ �i _ ,/ r, A,, BUSH,ROED A HRCHINGS,INL. tr= -(: r ' a %Y- DATED B 22 96 AND A FIELD SURVEY BY. 77 ^' ti �. •- i! TED �-i- ' �r_ � \' OTPJ(,INC.IN MARCH,2002. �I/ _�i�� •,� •`. \ %`/ rj',;./` TMS MAP DOES NOT REPRESENT A BOUNDARY ., Ct Incorporated �_--� ' ,�I SURVEY.BOUNDARY 11NE5 AS SHOWN ON THIS i V� MAY CREEK Z / t 1\ _ _. MAP ARE RECORD FROM SA•D A.LTA,MAP, A 62D McLeod Tey MOO DELTA / E-------•----� • 4J IGrtlmd.T 98039 1 0 PEc a (495) 922-4440 .,en r!-� ,u.qp,. 0 FAx (42s) 6Yl-95TT l r / � i .:/�f�' , 8 wiz_ OZ I 30209.001.007 G, ^J ''//rr / WILI AM C.LAWRENCE.PLS DATE Protect No r �i /( � CO i .-a, N 40TH ST. sheet No. .ti :,i'., k: ,4K ICAII.BEFORE YOU DIG 1-BOP-424-5555i Sheet 1 or 1 .t 6 (C RopiLmED MATCHLINE — SEE SHEET L1.01 --1L :41, ��✓ \/ so G If 33 �'�' \ ,/ .ems __it 01 1 1/ °V/�ee< `�. as `> L i} ,,'`� �" !, �. ��a::11:(1/f/0111//:"P":///./ / ��sr. > ^ P 11 34 a7 w 1 / // aFS r t I / v�` =ii ?' ;:i '/ r eta �:v w 1B os EYe EXLSTIF6 a =-r- '��1 ` /. l 1_� ,� , 1 ^,ysmeiT:FxiEvnTneo•mraan FYffIIi l �' Ii--- 35/ ti oi1 `\\" / y . ,// ��` xr , ,E�i16' /i / 'ieiii 5 &zyr /1!I/If � , ` y ; `E� R /1' / / MAY CREEK BUFFER RESTORATION SCHEMATIC ' NOT ro�eIF �- i✓ 36 i/" 1 $ r' l f// P."}a A 1 \11, ,/ ; // .I. �C _ _!O` 3.x 45 ':-1/ /,!' / \ \ 113 ` /, /A,/ ^wI -f- iL. t I 11 .� \w • a\� * // / / r -"{ / 37 i" v : I 11 - i ! a`\2 /'fie: a � i # / Wil *.,,;{;�q,Q• I / � 11.;/ /// • / � ware aits i �� ( 1! A /m / n.as 1\\,,.� � /' l// / ON REGISTEREDD CT ,11 - \ V38 -��enpma m (/ II rs gn/ qP'-170 /e �;1;/. / / ,'4� j CERTIFI'\ -\ n _ 5---eNV I s '' Ij if( '.-Y§' / / /^, /�/•V /�/ / . / z ' I, /' \ `�1 All/ 39 r �1 F +i�4 'F° l.,V, // 1%ile1t � C \108 ,e !�'" N e• �/ / / �0� 8z i '''•N,v9;,f ,z'z s\ j 04111i, /eV i.. _:',8/ / / e. ,. / /4r / 4/1110:: 77,'','" .1''''' ,..,,, ' .r / ,,, / , cn /� \ 42 ,\ 1 \\\\"/ /i/P/:--7. �I d064 sT-•M1/�;,OS" /i ��' / v 1 'wiw ii , \\\\ // „;„ ^,t,\ '� �, p , 6.c�,•s ��.'�'4 fir/ >9 j / 91 �� ) A Id .��:n':r� �� f�9 �.(/ 0' 20 40 80' r� 92 ' �P CONMON NAME/ SUS a .l \, A \ #(� 'z. �:I1 ¢ srnma, sc�ximc NAME. SPAcmn_ a Q aq 's. �_— j. va!"n $� � :� 9� Asp a o al Z /, ER6�ION LOttlk� / `� o ,\� 'o'• ,if��°• . �'$/ r Cy tDA,TREE roe_ nu_89 .0 A.. 3.O ! , ,,,., 4 ,.>\411.1&;‘,,,,,:‘,‘ /„...,^}211rA,„.4^,/ .^-, ,,,,, ri .., oa/ eto ' ''. 95 i ► 0- 7/' 1-1. 1 , am,rice // j �e s� `//ny '17/ .�.•/ A:m.. r...,y� ^""`�,e, awi°Imr�e 1-I 14 ` 97 , /�,o. / / n w/ U 0 Incorporated �O '� \ ! '� �� i •'I:j /��\ e Imrem aFem a.l rn�r,ur rim rise ca.MEM DFIFFER W�) &0 GYJm4 fey COO ® / I @� xr'," ✓ !/L7// -,•C. b.,. .L.I araeoa re eao� C • �S-�: t'• °4 .ire . \ � �� /�/ -/ \ I I Ar+mee+nre TOTAL sn e>P woeexe, Pnoer. (�zs) ezz-uea Ili • '1/ ? 4 40/ y � m nel m.mek.me o f \ - -_ ` 'r ;toe / Z Prox 09 001.001 .. •ASiS OF BEARI 69.36'( L1.02 .. � _ d I .I M1r�, -;' s BB'49'09'E Sheet No. �' r.ALI BEFORE YOU DIG 1-806-424-55551 MICROFILMED , ,.....__, /4-,,,,,,„..., ,.1 tel / ��,� \ //;': // / 7- t / rtiv r , �,I/� , p I , • 2,: so 4 /// ` . ��c lr / ,I "/ ♦/ / / /� K4' ./ /4 I I yy 1 C CI / CERAD PAIL EISER TIFICATE 1,7 7 c, , �/ -- 8. • /14111/ .; 4/ ///7 // I I\ \----------- claf^Fa /:4 .17 // / , 7/ \I ' -' H ♦ //JI1 ///liVf/ 7/ /// It I''/ - - --------- / y ---- o' zo ao eo' z/ '-------'------.,,,_ CI- i / / / O �� e 'COMMON NAME/ ER6 n- //// /� �.�� / , \\ \ an.,aw. SCIENTIFIC NNaE• SPACING a 0 ♦ 7, — (�tTI a o a z m g I 1.-,47, t--77 / if Zo.'' -NN \ \ MLR,. PGAL . . 1 , / \ \ IS °—LIELZEZDTZLZLE/£59 WOGS. AS NZ. 5 ' N\ ••••1 //// / .., -. �� oG z w .oii MAk A.,/ ii ,/ . . I swam se. yam/ i // / �34ow. O Incorporated 4 P 3 3// / / / _ cm nTeEOCON1�aaA 9Be.,Wirers'W OR' W 4-� MO KirFJma Toy POO Alb / I� J� ,cmma, eeros 10 �2g .✓� / /�v1ATC L E SEE SHEET"L1.01 I �A Fie. rtiom: �,2s; 822-4sae O. -� / 1 F. 125 821-95'R T; _ /_ ael _ _ _ _ : I Z m302 tAGWCWR �`, .• / / 1 I F g 2e 20 L1.03 41,' o_ u SCALE IN FEET Sheet No LL BEFORE YOU DIG 1-800-424-55551 .MI ' FILMED ._ _ 23 �� Ioo eee eee7, r e eee oeo eee L r 1 / ./ . __. dthy ,,.,,y, , — r I I r---_-.:.--- °� eel ee ee ee e o't I r ,I t �� ', 23 i r lIr i < r.e r00 al J. / --4,- - 1 x 21 is JI i s •/ o n 22 I$ J Ig 18 81 17 81 8 1 / I $I 6L 81 �1 e , VI n ^ / /J o 24 T I, =i /8' 20 :8 PI a 16 8, 15 ;I 14 13 is' 12 I 81 11 u' tU PI/ 9 ' 8 - 7 - 6 0l 5 4 8 3 \ s F / 0 8dy 1 4/ II of /// /� ♦ ag ---si - , zo o, II I \ 1i2� 4 ♦♦ J L.000 a '�, zs �I0 ��;;; °��,e /1��1i�. :eoo I�ooTa boo .oeo �ieee �j ♦ / I ,Y;II 'ass' 7 —I � �' � ve I-,- i %a 3 / 26 /// i q 11 o1,/ \� 721— adElhs .< <F,— —=eee,e I / \ / // wu J4rx�s -. ... ' r—73 x", 4\s__,:y:// 75'--/ n .ol/ , /4/ /if / //7./ r conmiNnnoN ( 76 -- ,o.oo -- � 8 E 18 ♦ N/ -- ,�� 28 I a !�"j�`� ' sss766/ !I //J I/ o I I - \ . rI 78 I .( . 65/ / i aESN Tixeo L a,; I `� in ° y -- °• p e r . -- ss/ • / c HAD EIDER ^'* �+r'.. " I I / rya ,p'/ / ♦ / exec care No y -�:��.�,�� ,31a - ., z'•R ,� Qv 'e,., •il r�(c7�� ,m/ . �. / Uz v/// .�. t�r._..s+l t iR..' i "`p�oi� �: / / /62 /r�/ 63 ry q 64 i / F ♦/. / w 0 1 l,r rx : .: ,T `.! _ ..•r'•�,'r�y! \\ < ire // �' l / / �''� /:3/ /� i 3J ml ::: ao I <��I i _ - awl _ M..*:r" ,0,. < et `\'' � /.'�_o;- % ./�/ / w z� i _. -- - .*r� a eA�ti \ \ `° /\` \ ' _ ..# / �♦ / / te, /. it i/ ' 85 °\ z e p"""��1 '\\\ °e��\/ ,' i f' %4.i // ii I Qe CI- e+OSKON co �` jj � / •\.\ 59 ' / /.�a ♦/ / Z °" • 6s\\ /%' ram/ / o, g EL ,ke - , # \ \ \\ 56 A 57----____"*, '8,i,r3' 7.44" ',A' / fat / 6 • ' -- 1ti e*�� \ �� 88 /� < \ \\\';4 ) ,i 16.4N,„„...4.,,r// \•''', ‘,.;;;;;;;04..--°' ......44- _'2 18.fr--f \'s , .,,,i-y, / •''/ 45 /'' 7.1..:"..1 z . a s5 \ \ \ ''' �'��d�//' ,t/ y/+,J / iga. z 1 '�� 89 \�'� `l \ 54 \\\ \ ?‘.. ,/ , r� yl'd / snmo-. COMMON SCIENTIFIC l . SPACING. S ,R —\ 1 1 /\u\ \ \ p we,a'rttN meuaw I�w----icy .I 4.6 //' / \ \ \ \ \ �_ /; ,/ ,,,,,I,:,/ 1 YYY,,,/// \ 'J j (orst L mu g py j — 5 r. ; / 0 �A § 31 __ I / \\'vim\ Y °a /�/��/ t / ,� /y wvdwi ro eEtttsx .rl V W U 32 v r:'r� ,, � I d�p` / ♦/ / 69 GINN 4) dU to III / 50\ r „1 _—�- A, 1 / i./ 5 )- '.�3/ j / CO o- LPNPI o o a 1 I.Ij7 33 I , \`c\ ', tl° ' ( r p 'kif':,x �(�d // ai n�"a' �e4 a-9 M.oe 6.1 N J ---—O®— /1 Incorporated MATCHLINE — SEE SHEET L1.02 I s ems„« h+i � � Im O We' (125) BT2-N48 ,,: �c ,•� PAY: f25 8:72:I'P �•+—'1 a sa ewe IMAPISILATA 'w� mwae 09.00 m1.001oetmu IN%rater r—i 302 Project Na. °..m"�oreu'or°c e°ca.�'r''.�, sneer No. l' acrz=e s.� &,tnE 8.6 I ,-600-424-555511 M 1 CROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. ...-- , 7_, __ _________ , --- ..________ -------__----_ - -----------__----N138•48'SVII/__ 1_1385,47. / ., • / / i 7/ , .,---=-- ' I . 20 .' , Z• 2 1 • i g ,,.. . .• 18 ,,, 17 :$$ $ ' $ 12 16 15,/ 14 13 I 11 10 8 6 11 . , :, . :,, ; ._$//•$:2,,,,,,,,,i. :$.1.: /•$ E.E A 2 STR,E T A / §' $ 23 ‘•$.$$'' F-: -.• 5. . • / 75 /i',69 / 70 71 '-$-- 73- / 68 67 ; 66 65 ; 64 : 63 // / ••'''77 ,' $11•$' , \ / .' -: --7 76 , / 1 / ///, / /. ' g .0:1 0 Z I I 1 U 0 nISRtIII- •:I----'-1II I <tu0Cr-i.nI1-\ .i1J• • $ ,‘ K/-1,,/'' 8 5 ,,,„.4./,841 K od'ee8,3\ 1•5;,„(s r‘.a,-T,t.R.8,,E 1E-Sc TOC 3B,E.,.....8„_›0T„j.,....1 1._ . ...., 58 // /-'---•-/..'.e.6.,•$.1., '. .••.2 6 ..$$ ••.•.,R •$,C-4•4"../.,.,.'.-R-'-•49,' 4 - 27 , /y\ 86 54 52 : _ „28 z 50/\ 51 '...'&. 0$ C'•b0•S i'ti-i'• '4r9 • , Cri_0z00Z-Cda-ZaV$•42_.- ,2 iR$- -- --'',-' /" / , _----- " '. 18R.&Eg2.YD.:L$. $ 29 8.,04 88 4/6\ -.'.-..-.c.:--$-f,$.•---$--,---,------.,'..--'..''"'---—:,g!:v-,-..$;- .•- -'-,.I-,---,,--,_,..,•-••••"?'-..:-.'.-°,-$:±;.:!,.:C.C'• -,' , /-•,1.•-''Y'-,...' ' i..j'• , . ' .." 0' 200' 40' 80 .2 30 I / // t . ° oa 31 FuDEEX1-J.I..E1 'L- -)'1 /\ $,1 I . 'g' , I •1; / • , t L., .,'..... ? , •,.. • 0.2 Incorporated lazi I 620 Beldame Vey/100 MATCHLINE - SEE SHEET T1_2 LEGEND: , 4-.. Kirkland,We 06033 J!. • 23 PROPOSED CONTOUR 0 fr 0?Irall , — .snNG CCNTOUR z m",togrit;vm 11, Project No. ..,:i 0 TREES TO BE OJT T1 1 Sheet No. t!' ——— CLEARING LDIIT ICALL BEFORE YOU DIG I-800-424-55551 sheet 1 or 3 e • • MCP0FILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE - SEE SHEET T1_1 ..,:. 1 . ..,, I I ,, e, \ /- . 30 / ---4-14---7 ._.: - '.'''' Ke-`• 48 .- 1,1,-. , / / / '. ,---1- •--/-: --/':;,;:-.-:--' r] --/ / o no 47 ,/ / ,-----7' ---"'„---cre1 i 1,,,i 1, ____ _, /, • ') ;/ ''''.'-< -_?---.'' .--,5-___<..__' L:t :,.0 , ------- I 1. / 131... ' 46 / .--'2-%_... 7-11----/-----:•-•--/-,•••,, ' • • 4, /-.' i.g. 6 8 L------ I 11,. ,I 32 /. / , ,/ \ 45 /‘,),,,/)/ ,4,,,:,';/ ,:.2; 7',:1-.-`,-.Z---c-'------ -:_ - 8 1 44 '/ /' / /'''' ? ' / '''.-••%::""-'e/ 1 2, \\ '11'17 '' S g •/ , ------ /..,------7;;',Y-17,-;•-r -- /44/ \,, .N. ,1 ' , , 40 '/ • IX /: X /1/ 11/1- r ,., ,, :.: ,, , , .3,/ , 1 / f ; ' \ . -il // / . / 4/1 43 , \ X • ji VI/ / i/ \ . 4.-- .;',..•••• / ,,,,,.: 113 . I „i4-A,,, , i //, / tifl/, / 0! .,.A., LEGEND:/ \ ; / , ' i ///,,/,/ ,i e/"-// 7 35 -- li ec .. / 1//,// '4' 4r/r/ ,,, ,v, L 23 PROPOSED CONTOUR 0 I cam 4/2/o3 I 1 /,';' / Ali// 1 ill ' . ..e', /' DaS11NG CONTOUR Z 1 . , ii / //7 ibf .z.-1-11 0 TREES TO BE CUT .—— CLEARING IT 0 Z ',110 "/ /..."..---„, ----------7--- i i 4.(/ .9 -- / , - /71 iiii/) //II 1 L. // / j.. ,/j 1,":/ .09 c,,Ck- (,-1.?'' , /i; / , , ..., 37 .. lT' . '\--. / • ,i/Q"I -=. / / 1CCL• 38 Allt," . '' -.'R'- - 1 C 1 Irl 451?7'8:ii I / \ • / I ' 441b,-411,11 '/•ii)._ ---- — // / ,,„,,, ' ' . ; oJ 1 , !, 05- _ ,, „ a 407 e,, , , • -<q- . / , ,„‘, ,//./..... Nt,„,-, - , *,104 C5 P4 5 '16,14 Cl- - ' - —7---- - ,/, / 4' j4iti 410. ,•__ ,,,, c, z / , \ 42 \ ,,.• / -1; //i,, i-1.•-4/1 , ..1.N -•••-- •5 / .-4 n /, , zk , ,,,e6;7; ,c5\___E,.., \ 89 X ; ::;', ' ',If;•- /4 \ 03 ' .41'1 '.. / - ' \• ;,-N • .• ,' /...,-./;- •,, A, I.P.,,, ks:, ,/,4 ---.. , ,,,,/• •s- ---- „...- is. • ii •.;'s„_,;•X ' '' 4 Z INV-"IP. o / ‘ = z ' ‘ ,-, w — 01 / ,, . ' -- --- . ---- .---- ---,----'114`..'...?1",-.N\ , Irdir ,s•,"' ,7.<.` / 40- , '`' PT;...., _ _ 0)— ,-, . o a4 (-3— ,;' ..1 ,_,, ,, 11.) 1-1 PI:1 Lckj lj 1 \N1 ';',,..:-1-•-__iirOWOr/- , . q--• `0111111,,,..S....".. - / x 7-' 1—0) ? 'NwAftwo Agr 'F". . / = / .. . / ; 93 _„_ \'4 , i'allP /• 09 --;',i0-8E -, ,: - llp . — Vr---1-;77 - ,. ,,,/.,/,,/'.,'r a , , o a / ,', . . ,--.. , ,, ....... -"./.--4,„•., . ;-.0 i-( ,-0600=113 0.2 Incorporated. r r..01,. ...*''..r ill• ?5--- lied ' / ,2,-,--,"•';', /,,/,'",,/. ,\y_,••••i-_-,:s •k-_:,. ., /196A .. /7/ ,,,' i'/'.'_, :.(/t 4" / 620 IGrktend Tay 1100 4-, &Aland,Ire 813033 0 .., , — ' /'#' ' •,/,': , ,"/ / .' ----'-'‘'- '>. , , Project No' Sa5'49'55-E -- ----' - • ..— A' //,/ / ,A,./M — 1 7:,-;: Ti_2 i t'/vj." -._,_ ., _..1....... ____ Sheet No. . --- -- IML 815,0RE YOU DIG 1-800-424-55551 sheet 2 of 3 MICROFILMEE • PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. / �` / , ,, L,.. I t21 TREESI1ES TO BE T OFF / / i lrif--3.47-41.1110,41,0/ LEGEND: 10� E 23 PROPOSED CONTOUR /• / , 1) c -__- — EXISTING CONTOUR /+ / / �� O 8�e oTREES TO BE CUT // llll... CLEARING UNIT / co/ i f //� I ' I C I a "48, 0 UD1W FOBE / / I' -r / / / � I/ ' /%/ - O S/ � _ e •/./44///.17,.:////,,,, ,/ ,i,,,, ,, 1.214. 4 ..„. ---../. _. g„..2 ir. % ii TRO BE . / , , il e i:/ _ s v/' �/ 1 / .' / I—cn 77 7-/- ,,. 0.,.<° ,,/ / 0 i ,-...-, .. 11 10 9 8 7 6 5 4, 3 ��h �/// /// / Gj�� j" ll - .�---_ ____ /� Incorporated III 4; / / / re (425� Aa-4H8 , 1 4'" �/ ` O FAZ (425 021-95T! o / / I�tercet: 1TF OtakCOY / 0' 20' 40• 80• F-t 30209.001.001 // / / n ^ Project No ea MATCHLINE -_�SEE_SHEE—1-1_1 mi/ / 5„eet N. Y ® om cRLL BEFORE YOU DIG 1-800-424-5555I sheet 3 or 3 MICROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET P4_3 NE.BWEE56'W 108.5.4? . 7 i , -- 23 II I I -- -- I 21 19 ' ' ' ' I -- `/ }\) w 22 18 1 17 I 24 I 20 1 16 15 14 1 13 1; 1 11 1 10 1 9 I 8 1 7 6 5 4 I 3 \J 25 1 o I STREET A I i i 2 // \ - I I I 1 1 � / = _ w,�, w O k I �\ —_ )—S—= wL" w—� = .74.-_- "�--+— _— —tee w—ter ��/ '� 6aY ji 27 I r/ 72 / / / / / s�� -g —�. / / W S I 71 // /' 73 //'74 / / / //,(\'\ 77 1_ � / Q __—__ 75 76 / �__• __ I I I / 28 + • /\ 69 68 67 66 / 1_______ I I , /\✓/ / 78 70 I- 65, ' i 1 / • 1, ,, I 79 / , Ipe�'.z �I / \\ 63 / 64 WM 47 R.O.W. / \` /\'‘ <- 80 4 61 // a m8 83i\ $g$g 14 N 84 i'n La 1 ...K \ • 5 - 55 59\ >/ , ..- f �O F4 u, �__� 97 ov I 56 0 C2 a,' 29 II '/ \ 1 56 57 67-• , / Z Z • 0 Q 89 d+ 0 54 0 I:4 30 • 3�� 53 Q Qy .., 4 I v ;'* 9p • $. 31 4' 51 0 Q ___ 32 .c�°" � 2 a mo zo 40 80. 49 ,6 10 IC 33 L. MATCHLINE — SEE SHEET P4_2 0 °'" i LEGEND: i yc. 1�O Incorporated • fib �' 6fi&Mond re)E100 e —5S— PROPOSED SANITARY SEWER LINE �-. . GhLvd.To 90033 • PROPOSED SANITARY SEWER YANNCCE ex'IA. PAL 42? 01-951t k.C • PROPOSED SANITARY SEWER LIFT STATION ' F444 mtu 30209.001.0•01.0 0 1 ———— PROPOSED SANITARY SEWER FORCE YAW /'-' Prole°No. 1 —w— PROPOSED WATER LINE ce.,7 y 13 PRCPOSED FIRE HYDRANT $/"' T' Sheet No. SAIL BEFORE OW DIG 1-800-424-5555r Sheet 6 of 10 • PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. _ MATCHLINE — SEE SHEET P4_1 11\\ // 1 �� m67 __ // i' 33 / ---_._- O o — "o Y '' 8 F 35 46 •' „--<\•\ �'/ 1 & �- / -1—- 36 \krill a1 ROW: . 115 / /' / / m. 45 1 ----t----- Vi\t\ -� ! 113 //i .� • Q 37 /,, ./..\\N., .",.. ,) i . ,„,„,„ , , 110 / JP - 2oNu.uf' ID • �__\-_\ 39 toe 1u74, A �� LEGEND: i %J fr —55— PROPOSED SANTARY SEWER IINELpi % GJ ROK', •'/ / /�° PROPOSED SANTARY SEVER NANNOLEVS / /O106'•107 j /N >.' !;'/!;'/ / �� • PROPoSID SANTARY sEwER lSr srnnoN W cA z4'3 \\ Ti?` 19 /° ,, r O COSTING SANITARY gYtR MANHOLE i 1 11 \ \ ` �� `�' / / ', ! //\ ———— PROPOSED SANITARY SEWER FORCE MAIN p RZq / * ` Q / / •.�/ ! ' VP,• —W— PROPOSED WATER LINE Igo.g 42 \ 41 \ 105 / / /' / / / ❑ PROPOSED ME HYDRANT ca gi$g3 . \43 ,, le\ a. rR 103 l�/ c! /// ' '•/ /' \ 91 \ ' ' -1•`:- — ' // . \.. ,............%j 92 \\ M ,r • 102 g \ \\.•F /✓" / 100 101 // �--' ) 99 ROw \I\I 0 / ' I FN 't'"�`,93 .,.._ '`I ) I '!i "'�,/ ' �. t J F+I Incorporated ' d w 920 Rutland Tay pOu e i 8 0 . 83. cr TO COSTING 1h ,: N. 0 $ q, >4 t -I Ic.woa re 9eav _-- — !r WATERIDIE .:r645f5 OF y _----- �• a � ;�• 6 9A+Gj_' �.ee SB n'E- �_ _ L eL . 01.0' T E/R ' . dS: _ 0 20 ao so �� 30209.001.001 1 a - — -- L. -``- - ' . . STREETMANHOLE AND B SMc SENFH. n �� /�7' ,( �_ .aeT / A Sheet No ICALL BEFORE YOU DIG 5 Sheet 9 of 1 O MICROFILMEE PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. %;�SFE A4/ //� , ., CONNECT TO EXISTING ti i u' ITMY -/h/ ' ST. / ® IE%ISTITA BA%TER .// `\``,, FF F A, 11R STATION FCENG'4 ,; ® j /. / I )) //7 .. ,- J',v i 4// Ap Si WLEGEND: ry� / � I _ /—SN— PROPOD SANRARY SEWER LINE / / � / i i SF ?• PROPOSED SANITARY SEWER MANHOLE e�enn/ i ' / / / I A 44/ i• PROPOSED SANITARY SEWER LIFT STATION //////,,,,,,,,,,,,,,,,,,,/ (''rr . // , ` 5 V— PROPOSED SANITARY SEWER FORCE S N / / 'f 4 L'F G. g —W— PROPOSED WATER LINE /// ` /''+�` 41 ' ,R Q PRE/POSED FIRE HYDRANT 8/�/' / / Qv V 'Ill / v/ / cz— Cr: ^8 E 1 it /7/ 6'AI i / / 1 ,:, 6.a,, / :,,,, : // 2'/„,'' / 47".,,,,‘,%/ / / ) " ,, ________. 4/ ' :, ,/ // / /,5, 1 r , a_ / '/�' /, ,, / '/ /� ''' / it/ , ..---i ,. :Zz cc g / \.. E1O ! _ 2 f '/ / '' /2° /iV \ c4 X , ii __ , „ , , § , , ,,,,,,_ , , 4 3 �3%� / i J / %/ / % / \.___.—.--.--'1 5t 2�40! 80' �'Ca✓/ '' �' Iszo ErElmd rey ltoo 2 /Ce i / / 77 2 Y Xutlm4 le(BB033 / il--7 . ,. 4, ungl i�^§ / / ( I Internet molaktou P43 x MATCHLINE — SEE SHEET P4_1 � Sheet No. PAIL BEFORE YOU DIG 1-800-424--5555 Sheet 10 of 10 • • MCROFLM ED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. i EXISTING SOUTH MERCER 14" FORCE MAIN EXISTING BAXTER LIFT STATION Ak'' _ 3 55 ,,:.,A LEGEND: ' _ 0 ('®t �55 'S5/I "'S ''.. .. -Ss SS- PROPOSED SANITARY SEWER LINE c 3,, I®'�I .' i+B"�y-gy/r �'S5� '.\ • PROPOSED SANITARY SEWER MANHOLE m 5 N _ o �I '/' IIIIIIIIIIIIIIIIII / �/� ,55'-�55f • PROPOSED SANITARY SEWER PUMP STATION m$ '' -EET „' /� ( 1` ® - - PROPOSED SANITARY SEWER FORCED MAIN a 8' 14-I_ \ / /� i ss , / PPr✓/�/� / 1 w w PROPOSED WATER LINE i� S5 \ Q PROPOSED FIRE HYDRANT - -SD SD- PROPOSED STORM WINE l : � /� ._- \ /1t0 !r\ PROPOSED STORM CATCH BASIN %axAt ' B 1,i1/01 t I I. '_..._ s ._, W '\ kt� \ N dooms rnrw z � " e 55' CEPjOR \\ wg,=4 5 �. �►L. _5��5s INjER E w�dg ill) 1 EAST \DE N ' ,5 RO 84 '-s 1 /� I .rts Dt a - ram/ ____ --------- fg R1P NE ' ' - d z •t. U 0 !.0 r.4 4..> 0• 10' 20' 40' Cr, = i',~ oa SY.®DI. OOAMON NAAE/ SDT=. U BCBNTFiD NAPE SPACNWI _ O �' °1"" meuau+ Incorporated - h+a 620 attend To,1160 g 4..1 Kudevl We RIOTS q Peony (SOS) en-nSI y/ O FAX (f25) 6Zt-05TN m y Iotemet: mard�coO �-1 30209.001.001 Project No U 1_1 Sheet No. IGAIL WORE YOU DIG 1-800-424-5555(sheet 1 or 8 K KENO 06/16/01 II,16pm--0 H\PROECT\00200\60]09\DWG\PPEOI\UI2 E.G MATCHLINE — SEE SHEET U1_3 ø2)' \ 1 i \\Ii .\\ \ \ E a D tth \ , • X ' \ 1 ' 1``\, �� f 8 E Bi gg gg gg gg gg gg g m Z i \ , B B B B B B B O \' 4 4 R i • l i gq q l - \` ,`\ 1\:\\ • \ .`\ \ , I \\ ,1Ilk �, g 0 \ \ ,„--. \ I ;8` H \' \ \ `i YAK , \ z \ -- \ \ 1 O \ \ tt 010)Irl 11�) POse�4 L'ost ..\\\ \ ,,, i Q z H t. \ \ , \,1\ t 01 11 0 \ \\ \„ A „, \-2', , \ \, \ \ \ .. i \\ 7-' '\ \ 1 ,i' l . . , 1\1:1 \ �) Bg .66. Bg .. p.1 1)1 \ \\� 'r tt - F F W \\, t •a \ , \,\ \ \ ‘t‘ ? ., , V__--- 'illi ,,, t ,a\\ tii 71) ' . "04. t‘II)V\ -‘'‘'• ------ ---. . y '\\\.1\ is \ r . v - + \ \ 9 --' \ ,ro ‘ 7., V ic\\ T\ t..,1 , a) e \ \'zra ", - F .w Y1 . ,-,„ r \\\\\ \ „ , \ L7.1-7.?I q • Ettr., 2^.sn C9saa S29➢R 6LRCR E91m1A .. CSo 0r..59 17�1... ` .c..y MATCHLINE — SEE SHEET U1_1 " ' r Permit Review .1 Not for Construction Ya .8Prls , BARBEE MILL PRELIMINARY PLAT E O �' -. • o C"P` 'o :,I BARBEE MILL CO. UTILITY PLAN og�&& � uo>>.�Tas�+cmx mow.x o S • PO BOX 6694,\'-'3. m N gp s a SHEET 2 PH.�6_W 6yy�-2 MIE r cn.c..e 0 Si0v5 R — bwowi I,0E02 00/20/02 9 0400-->H\020.001\30200\30209\005\000AT\02_3 DOG MATCHLINE — SEE SI-IEET U1_5 �-- !F I o�. MATCHLINE — SEE SHEET U1' 4 iij IL*1 II m I W /coV X, \ (Scb ill � 6 U \. e / g'\/ / Nikk\s\\ .. cb „--40,s• N _- Plant List , / 4� ------ - • A,\_„ \* 11: //:/ //%/ g 0 1 /. V,- 15) ••/ \°\+,,, iii 0) /7 e--'- PH //4,7 ,,,!„., ii \ \0 v` .// „, ‘r oa \'� . Qa .,/./ & ,,,.., 41i \ //1/ . o r \,, /48,//\ a �O� / :AR & \. O \ \ , ,4,/sy ,\ ♦ / s. o . Vc) \ *1 P:47 i y k . . , 2 '.,4 '' \'\ . `- \ /f/ /44 C5 \ CO • . / / w /ili \ \a . w \ ?, \ 1 4p, ,,,,,, . „..„4,1 \ ,4 , , \ ,\ CA V—,,. ',, \ 1 1 K , ,.., \ ,• \ 8 * 2 ., I • .C20' filli L, I1 ��)V /z 1 � ar 1f rn • \\ 33 0. in , . ''' .. \, ,0,1 % 1 10Mii i 6 6 0: ` 2 C q R E r--: '' \ 4rf0 , 9 ?, \. \ \ V 8 __,, R 6 S -, -, -( -c % c o $ 5 1 M z� �,:/,_:_ ! _-� .. a t Permit Review \ Gt MATCHLINE — SEE SHEET U1_2 Not for Construction s r n iqr Fn BARBEE MILL PRELIMINARY PLAT OWNER. °C �r .2 ) 9 0 BARGEE MILL CO. (0. - 1 53 e' m UTILITY PLAN 41101LnB d.ffi7GTON BMX (,a $ oS RENTON,WA 95057 a SHEET 3 PH.428-228-8000 DATE B. :e,I,Feel,REVISIONS IVI1CROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. I I i ; I I I i 9 I E7 Q 21 19 18 17 1 w w 20 14 12 Q 16 I 15 13 I 11 10 9 8 w W Ea8 STREET A Y cJ = II f W W W W w w W. w w � ._..�, .,. � —, ¢ m a SD SD SD � o - 1 12+0 t�00- w - w 1- w _ W to+oo Jw w w W15+00 W W W1 1� Q SS SS SS SS SS SS SS ——IN- - - --�—- ----�--- - - _ o 1.6400 11 / 3 72 j / j 3Y /i —.ro a' z Li j \ 74 j 77 m 1-1� 71 / ]3 / 75 / Lil "� Ltz / 76 � -0 V) � A.• i \ /' ♦2'ROW C ::: CO 78 ;�o E z1K / l / •l • �1 a p�] • \ \ / � ' 3 W ;ill `� `�� 0' 10 20 40 ag I I� I J z I I . �--e NA/MUNEm- SI E SHEET t_ W r4 a LEGEND: -ss Ss— PROPOSED SANITARY SEWER LINE i • PROPOSED SANITARY SEWER MANHOLE ' O W EL.d- rirl III PROPOSEDSANITARY SEVER PUMP L-L PIMP STATION U rg J Lal > r=- 't 15 2 - - PROPOSED SANITARY SEVER FORCED MAIN (1.).,...1P In �� A —W W— PROPOSED WATER LINE PROPOSED FIRE HYDRANT "�'o 0a Od'PpNO NA� �• —SD so— PROPOSED STORY LINE SYMBOL. SCFTIIFlYS SPAO CHU ._'oI= CO ASH L Li+o core 0 PROPOSED STORM CATCH BASIN meiroN K. Incorporated e _ C+ F� 62' auYeoa Yel MOO i.., IOrtleed Ve 980a3 n W ESoen 425 Ba-IHB eEffie m 0 FAz 14zs1 e2r-esn C mtune 30209 001.00 001.001 t S Project No. U1_4 Sneel No. rALL BEFORE O00 DIG 1-800-424-5555i Sheet 3 of 8 MICROFillE„...._ PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET U1_4 i w I I fI J i 9 � y.9 \ w w O �<5' 6 S STREET Bdi 8 I I 4 a A 1 ag .`�., w II r�� SD SD ' i I I Z S m I , J 1+00 W w `.w ��► ,-No = 55 SS SS _ 03'"'"------,-----=------------ • 6, \ \ ...��111''' �, 1111011 .�\M \ w�\ s I i F I 1 7 \\ Assc ,p4 W i I a^'` A7� W� S 1 / % 'titoilTS% ' I 0 g Li N A A s , I I • 4:%110\wIt' % iti , _ 68 9 O I S Igol .4001$4.IET .11uuI .!///T U I / k5s / / / 0 s+DO w�w � w:agm Q, �"- / / — 0a 1] E 10000 L5'y / * / IY 14 0' 10' 20' 40' / / S111 41.11.1.1 — / / 7-77 / / ; . MATCHLINE - SEE SHEETS U1_8 & U1_9 a a LEGEND: C W a_, �� —SS SS— PROPOSED SANITARY SEWER LINE ° ��+ S / • PROPOSED SANITARY SEWER MANHOLE W/`� 7 Ll_ • nO,- �i 7 co PROPOSED SANITARY SEWER PUMP STATION �N�// $ - - PROPOSED SANITARY SEWER FORCED MAIN GjI —W W— PROPOSED WATER LINE SYMBOL. COAOAOf/NAME/ tRi1Fi E r\ T O``-^ 9 CI PROPOSED FIRE HYDRANT {n S„ammas N ,sv„ r A O 6 r �_ 0 y cq tyx,yy.r= LNG. . Into posted —SD SD— PROPOSED STORY LINE F� 620 Kuklmd Te,E100 ❑ PROPOSED STORM CATCH BASIN i..f EOrklevd Ye 06033 r� Mow (l0S 622-1116 y/ \1. O Da (126) 627-OSTI tA '-7 In4meL mOWCCON ea d+uur !� 30209.001.001 Project No. U 1_5 Seel No. Y MIBEFORE YOU OW 1-BOO-424-5555i sheet a of B H KEHB 08/26/02 B 56,-->H\PROJECT\30200\30209\DWG\PPui\ui 50WC MATCHLINE — SEE SHEET U1_7 , t. 0_____________ \ .. . Li7 \ \ , 172 ' 3 a , ' \ \ �/ / . //4y4K-- -' .11,1,3 Z2 11 / 'F Jl, ; Lc' / phq> \ kklitit rdp., . 68 4 In bI 1 \2 , >,418.� m _—� O 88 z 6 E LIo a r \ II g O 1 m LB \ �� __ c 4 4 > E E N. .1111\i z g R O V . f , y 6' S IR f, d �/ I ' tw=J g w w— ' N f 1 IV pi, rn• IVQV I I I A CJ Imo, OS� _as________ s -� ,,I g I _ \ E II IIv I 111 — m j• g III \ / III m \ \ iI g BZ \I lL 0 .1111 i / eik .4 1 i _____ F 1 ill 11 - PI SI ER A /- 1 A . If. \ al R I' p i0-- q Ali Permit Review � ! 1 Not for Construction MATCHLINE — SEE SHEET U1_4 o a FV g` ri o BARBEE MILL PRELIMINARY PLAT OWNER: oC Pi „ ;O o 6.. e • :e BARBEE MILL CO. . 03 0," v Q) UTILITY PLAN PO 4101 L M �G0ON BLVD.N ' p . CD ggIr' SHEET 6 MINION,WA MOM „ y PH.l26-220-6900 .:�a &V27/m EGO on s,<a R sioHs EGO —'1NO WE 5 rou, i MI R FiL E PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. j L i 7.--„ �w \ \ ---ri El ', ii / / ; ' -7---.'-' I Pa \---\-11 '0( -P. / ctJ / I \ z ' w� \\ \\ i _ — _ I,1Q ma /' N / I -- --\-- - - Qg li \ \ / A ./ II "4y t \` V 'I \ 1 \ .��iz.,, kii\.:10 ? iLEGEND: /WN ESf' 'a/ I I �j Imam t/uv J \ \ 2 -SS SS— PROPOSED SANITARY SELLER LINE g CA O // 1 1 1 CP4 4, q • PROPOSED SANITARY SENER MANHOLE/ 'pO,q, / I CPI ICD • PROPOSED SANITARY SEWER PUMP STATION $g W 1 CA \ t I O °m q / CO 1 J 1 — — PROPOSED SANITARY SEWER FORCED MAIN W pp�k� • W q ., Ni, � ' Oh 1 —W W PROPOSED WATER LINE 6I mZi�I \� II QPROPOSED FIRE HYDRANT �Fj 1+2 6 SD SD PROPOSED STORY LINE lilla T �T ., � 5r0 —� ❑ PROPOSED STORY CATCH BASIN w %SS �x STREE F I \3i� _ " Q ig w\�M' e Y P. a �� • ` 0^. ,0' 20' 40 i a / na 3I� h \ -(1.1 g 44* r ` O I 8 �� 8' ro e oN NAME/ • o a ® f� BYYfI�. 8CQEETiC NAYS SPACMIL 7:U N MATCHLINE — SEE SHEET U1_8 N.leNN,LLW ERE.,45,, `< � »- ' ..3. ^ Incorporated `r 020 B3Yevd Tel 1100 ,.� 4_1 Kvklev0 We 08000 Phone 425 822-4418 �°LIo DA�a m Acon - T.f%. go ZIT A mUW C Nem 01 00 Y Project No U 1_7 Sheet No. Y M1 BEFORE YOU DIG 1-800-424-55551 weer 6 of 8 IVIICROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE - SEE SHEET U1_7 c-liti---- , xi \ .£ 111 42'ROW O It I I I JO (w � i 9 I 6, ___ II 9� 9qII 7,, ,_,,„ L., 0 \ 7 just 70 70 , 7 06 7 \8 \ � I 7 , , SD i ( L. W wa -------2+00—6 , s� A 9 a+oo °'\ -- • __ ,,......„ SS UZ 0f o SS�� 1 DIST.WATER LINE 1 �g � SD . _ . TAP ._- —�__ -I':- • —__—I_—__i�,--_ - saa 3 elli o< I W VI eo•,:�0® f ie�. + , IS'SANITARY SEWER- Wm dJ x a" 0 i _- a 1 1 O a t r z i_ _J - - 0' 10' 20' 40' i \ ^ ^ R w I u a -- I - - __ -_-_-__= N. LAKE WASHINGTON BLVD. z - C --- w a a d W J J g = 2 LEGEND: r B Sao ,A,o _. O 0 a SOEMFIO NAM/ SPACNO ``J fi' —SO 55— PROPOSED SANITARY SERER IINE —W W— PROPOSED WATER LINE CO e„pNgya aemtceeaeX WALING L ' - • PROPOSED SANITARY SEWER MANHOLE Tine ttYixu meu�uN f1 O ^Incorporated PROPOSED FIRE HYDRANT L:• g2p guN,A41eT 710p E Ka L RD BA le eey —SD SD— PROPOSED STORY LINE O PEone. U. lI)Ell E I� PROPOSED SANITARY SEWER PUMP STATION m& TA4 in -SSn 0 PROPOSED STORY CAINE BASIN E. Z la'r30209.001.001 S - - PROPOSED SANITARY SEWER FORCED MAIN Project No U 1_8 Sheet No. Oa BEFORE TOO DIG 1-BOO-424-55551 Sheet 7 of 8 1CROHLMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET U1_7 9 cola m 3 w 1— i 0\ LEGEND: Np • fi p /I�/ —ss ss— PROPOSED SANITARY SLIVER IDtE was' Ll.l I I I I I . I 1 I • PROPOSED SANITARY SEVER MANHOLE _ '' r1III • W3 _J I I I 77 I I PROPOSED SANITARY SEWER PUMP STATION It 1 U I J� I JJ I I — — PROPOSED SANITARY SEVER FORCED MAIN Q I i I " II , W W— PROPOSED WATER LINE I 1 I 7JJ J� 1177 r-� JJ I ).-,( PROPOSED FIRE HYDRANT 0 "~' S I g /0 7O I O I —SO SD— PROPOSED S(OLtY LINE � $"01 I q 18 I II PRCPOSED STORY CATCH BASIN Imp tn/d B 7Oj ET c ��. z S� W—W ]tl 0 I]+3]21 ce "ilk 6+00 ��W I Upz SS 6 6 i� A - - — - �� $$ so ni - -- !- i- w ggi� °' ss w g ,�/ / '" p ,-_ E. w'.as fg ---dk. _ _ w - - -- 0' 10' 20' 40' at 9 - - C j > G rn i ' U d' F- a„' gLVO N oa n -- N LAKE WASNWGTO .. oa --- - - - - - _ SYMBOL. 9CFRTi1C NAN6 !�O E U to 0 =eerm11 LW. 1.2 Incorporated R fi20 Eutteca Il=T III) i L S20 Ful fle 6eml SPACING m O PEaoe (/25) B2?-/Nfi m L AW 22 '7 mtemet' ( mo7:Y CS /-1 30209.001.001 i Project No U1_9 Sheet No ICAll BEFORE Y00 DIG 1-800-42/-55551 5neet a of a . . . • iviicRoFiLmED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET P3_3 ..— • \. ....,_ - .._ _---___2,- ________,._--- --__=__—,-i----_-_-_=____ _------,---==_—_--_-_-.:',..N8/3•48.56.19 19.015.47. / , ', . , r . / 1 23 \ .. . • . • , , // se.- 21 , •••-, ' 1.• 20 19 • , • . ,:,•:2 22 . 18 . 17 . • .• . . _' g;.•,,I', •, ' ,_2 s4_2 ____I‘P P2li2.7x•\7__1/j-- /.•.•.••••1•.•..,/ •1."1;.•. ....'.,\..2 ,.-S,°—..'..NN...-."7A.3`.,,.....1'•I• /1w60 1,5.n/ 13 1l1l11_12 _1•I• 11 ._.,710 / ,,- '_ 8.0.._ I.•„7 .,• 6 //S REET i 7/ —. — STR E,.I'• T 5 A—.• .:‘ 4., •, _ ,. -- /`-•- /2•'/ ,,/• ,.... e. /.•: •,:. •-....-...• .• ,•', .' '' I.'.4,'~.„.••-•1.v.0r;..-v)I..zk§ '••.v s,<t•O,,'-6.2,,,...,„ a 11,...........-------eg.,..,.... .,•;2"z 7 X / , •d ././ , ' ,.'„ ..-._-.--.•,.,.:.. /-•, .. . ..:1/ p= 1WMM1 ! „, + _ 00 0 , a4f2:111,31.4 2.r.1,.i.11.4laN.0.1.g _ _ - ,4 * . _ - i 69 68 67 66 65 60 6162 63 64 / .-:•••! - • - l'' • ,.• • 1 Z a. 1,1 a 111• ' 1 I ..,..0 ,,,,,_ . . ., . •-s, . cc • i .........16K , 5 ,Y.-4, .----- 59 . ^ . Q.., ,' ••t4 < • ul 86 , -- ....t, :,• .., •• • . Z I '...if' .. • 0 4 .7, „c.5 CC • / - . .:3 ° 29 8!2.,,EF222..-,-. - I:1.--------_2_—1 I• . I4 3 Ii_•'0 -- —2 - 'i 7;ss i•',.'i• Y".,i.'-<90-,/-3 1 88 .050 -'- •',.--'--.--1•--.-:-.• "". "'•..•.....5.,5.._•\•••.. -...- ... , ./. ,/, -',:.,,,:„—..// •./'?.,,'• ./,/,•,/'// / ;//I////•7 .. •, ,.,•, 89 - _' 11 ? . 51 / -, ..' - 200 ,- i 33 /, 0 ' 40' HO ' -\ , / . •,,„>0p-r6,-,,,.u.4.Q0r—C=CZ,..-.-.n)4• 0a2cCc Z9s(ZE•E)i<z.=LI0,ax•:.- - _TLi) • er,..wee cm 0....L12, Incorporated MATCHLINE — SEE SHEET P3_2 LEGEND: - — —0,','.,;„; "'k ED Ralend LI/100 4-.1 13781884 Va 98033 23 PROPOSED CONTOUR lca fr 0 ,1" gE? LIZ OCIS11NG CONTOUR r'.. #. `-`37,09.7°.`,°',`0;" !: A,,- -SD— PROPOSED STORM DRAIN Pro,ect No. L!" 0 PRCPOSED STORM CATCH BASIN i‘if, P3 1 . • BUFFER ZCNE Sheet No. ''''W--.',;-'—'1''' rAii BEFORE YOU DIG 1-800-424-5555i sheet 5 of 7 • ,,,„.. MICROFILm tu. PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE - SEE SHEET P3_1 ... .., e . •-c':' , • -77:-. . ,..., •• , ........ ••:,• . . , .... ,-----4-k 32 / ......, 5°//' // •.. ,-' ,,..,-; ------ 1. 1 . ,/ \ 49 ' -.-•'''------'' -----,,-----"..-2-2-":-..,:::::-4,-,>"'.- . AND SEED ..• 3= , c / l . l', 1 L___ (.'... ;i---'''' :;;;;;,.--:,---------2:'-::--a--- -:--:-":-f'.• .... 17- ----,\. H ....•//z, / ...„:„.. ..,;.... „,,,...... ...,.....,,..\:.,••;', , I /. • ... ,,, ,, ./27 ,.,,, ,.. -7-2-,.) 7.---, \---F-T.:.-.,---- . ,...... . I . F.-.., „!A ,I. / .. / ---,,.. 7/.::,::::::-,----' 1••• ,,,,,••••.- / ';''';'' ••• ...."' \1 , ' i ,' . , . .. . . . <1'2 ' ///)/ I I .'../ 1,;', , ,• . 1 J, , 36 cC. % • '., 1i5i i I, ' ,,,,, .-'• ' / \ 1--- 45 3:: 7 / ,P/ ..... „ .. 114 , I , -' ; u-, __I_ ; , / ./ /i i • .\ ii "3 , /I . .100-, ----- ,i, i / , ' • , -- / 37 i i/i il ,• ". 2 .......„I 44 . ,i, ._ ,..., ... . , LEGEND: 1•1„.*(tier,, . .. • i i // 4 4.:•-• , .••,/ • 23 PROPOSED CONTOUR ',Amoy FP 0 \ : •. / i -1/ i ott ."‘r---i‘i\ON\ , i„, ,. ;1 E051100 CONTOUR SD— PROPOSED STORM DRAIN 0 PROPOSED STORM CATCH BASIN I cows;4/4/44 I PA i-------- 38 i ,1.1 / 1//4 ,.f •' ---------._ __ 7 : , I / , , , , ,. 109 1 /7. -2 , • BUFFER ZONE 0../ /......... - \ i ' ' i i/ / ,/ Y e4 11 ._., : : 'i j 11/ ,' .' ( wo l.,"'„,' , •: / / / 0 / 0 , .' • ,K .• N , ' :" i .. '4‘ /'''i•j/ /7'' /i ///ii .,7'1; / I. los '-101- it .7// ,. .,. / / . •- ...1v.,/o/ ..,-- _ E-. , -,• 42 l4,1 ' 4/ ....P. 11411. ,7.---;' _.--105 i / , ,z/ .,- E 1 II 1/ ••••... „ .\\, / ....•'/ • ii;-..------ ----------- • /: / /re ' 04 / / <C) • .., / ,/./ A' NLrAPIIII'Mk..-.7.5fio3 ›-.a„ • .. ...., s - • ,'A //: ,, i")..*:1-• 'ii-,., 4, /---____ 7z /' <I ,/,' / ' •ik/ l'itS,4, '11* ' er , zi-- x----- -,. ' ',/ z ::.4 iv .n ' I ; 92 - ''' • / i ,, I , io• V ,- ,,Y• 4.1.7634 DOTING GRADE , _; f- -RAILROAD,CROSSING g fl. 0 /,,:!, ./ i''' A' • ' ' tw _..4 .9 Z •/\ - — ---__ 2 ,• =,, - „... , " ., 1 oi ,,,%'-'• '41111. - ..1, N.; ,'/ AN'• •'‘,9' ', •- 2"/"N,•t* ;'. / '4 E - - - [4 (y / ,.....- .. ',7' , - '11, -1" N irfolAgr\V '" '' '. a .>.. •,••0 0 t I:1:1 z" / , Allipi,„k NA Air/ 0 •;;;.... - . :',7 ./' ), e,• Q0 ,,, . m t• , / "94, AV, 16.,041.r6 li.... ,,/,:.;;: ,,2' /z /••e E , / .e.--. .c.,/.// 1 ,/ / Vrairjpior RUNOFF,.INTERCEPTOR; Z / 2 / .44,,i ..-• ° oa 1...r \ Ol /, ,...) L.k.„,... ,_ , .,_._ ‘.., ., •„..,...,„ . • /4, ,, r,-....„:,„..,„,,,i,,,,__ •r.r. / ‘ ' -X,' ••-,. ; 7 it-/ / I ,• I et$`•`4,!,y 0..„9 Incorporated , / , ',:.\:7-"" \ 198;4„,/,/ . • ,/,/;i / • / „ .? , ry4.-A . . .,, A, , 620 Erkleoul fe,1100 9 ' i __.-I--- e' ,-,-,-^ -1‘, • /'.• " • ---I ''" -y 0' 20' 40' BO' Plane 425 022-4446 , • Menet 11110141.6011 _ ./ --,-.:c =1 //4.'•L 1.40 ' Z 30209.001.001 '217.. I ', / ,±,‘: /7 / / Y.--' / Af-- 8 Z7 oz„ SI,. ..ALI.BEFORE YOU DIG 1-800-424-55551 Sheet 6 of 10 • MICRIFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. ;rye f '36,,, \ t�/ MATCH DUSTING GRADE - `J y /i/ AT RAILROADCROSSING =. LEGEND: / 7 /•o m Ilir, 23 PROPOSED CONTOUR / ))/ \3 --`—_- DUSTING CONTOUR o J"T 9� // / / /_-5p— PROPOSED STORM DRAIN __ / !4/;/,/ %4 /D PROPOSED STORK CATCH BASIN /� �� ,�m,�'µ ,,../ :1?/ ((,/,//,/ ,„,:,7.,, .. .....,/,./ ,. .§ (0 , lia 11 ------- J / . p 1 ,/, 1 //X///,'/ \ _ , A'Irl 1 '''\if , _.,—- 1 Z l' it,/ /// / 7filli\i',.! , . tr i /": , :- ,,/,,,,A -\:- , ,, ›_. */., //: ;//:,/,''' ,„/;:// i V,t_ 111,--;-_- ---i.ir______ _ ,,,_; I. .7C rX i`_/ i _ r a a53 a / / i \/ JI a' 0 /i( �� g / / C >- • ., ./i' / / JPj' \ \ ` I P g w w'9 / i / ` au'/ / ( / / \' j i II0/' / I 1 I O a�; i o�� 1 • i % 11 P /� i. r-"`- / '.a / I I 4500c.y� I� 0 Incorporated // / / ,L.—. M+ 820 Ruklnvd Tag 1I00 54 3 • !v /; ) ,' `�- none szs ea-a4e ` 2 „, /,' , / /y �• Ii , i`%'pp R Z 0209.001 01Internet ou I 1 I �'; • /// CI / ( i o�a.m� Pr°,eeP3 3 MATCHLINE — SEE SHEET P3_1 g/k.34,Z S°`e`"°. 1CALL BEFORE YOU DIG 1-800-424-5555I Sneer 7 of 10 R Mi FID PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. _� /% MSS mama WM= In.. / �.Fs, _ _ MATCHLINE SEE SHEET G1_3 /, ri lair; tea- � --_- __ 4'C __ - -� --__ N88'48'S8'W f 085.47 / / 23 } � / c� ' 1 w _ 21 19 FF..25.0 �-250FT ' FF.29.5 / / 111 I;FF-24.5 FF.24.5 18 17 FT'25.5 n FT'2S5 -• .S FF-26.5 FF-2].5 FF-2].5ri 20' 22 FF=24.5 20 I FF-25.5 I FF..25.5 :,/ 14 I FF-26.5 FF.2fi.51'FF-2].5 FF-27.5 FF-2SS FF-20.5 w 4� ✓./ o 24 16 15 /� 13 12 I 11 I 10 9 a 7 6 5 4 3 •/s WATER. e -- 1[4,5 YYY .� I 1 2� EASEMENT U�$ 25 `� ;, YYYYS `` / /:' FF-2L5 / ��`�\\\\\\\\\\\\\\\\\\ ��- TRACT O� FF..24r/ `-- �, /OPEN SPACE m -- / 00�--- It t 0 / e zs /I =r" 8 a m's FT,24.0 -- FF..24.5 2 ( 1 // . FF.2337 'FF..25.0 FF.25�'FF-, /- A 7, . - I _ % • / 74 _ n 2909.0 ze 71 / __- -a3--_-" J 75' FF7fi.s FF-26.51' FF- // `.i 28 iF-24.5 S\\\ • --__ __"_ _- __ �' FF�6� FF-28.5 FF-28.51FF-.29.0 ' // i sse 3 u -- _ 78 8 r'FF- .0 I 68 67 629.0 65 /// '` j1p7 ' FF.23_5 - i� / I L. _ / FF-26.5 FF-28.5 � 1 %/ / I.A.A.VLm Fr-26.5 ,�+_UTILITY ESM / / g \1l�'EN SP�� Jl -"Y" % `` , I ! \_, 62 /63 64 J .,,° $o ): 1` ( A 1 TRACT'B' FF-26.5 / ' P O -e.'S �e\\JJfJ EASE 1 / -1F WATER QUALITY I �__ .` FF-28.5 9O % FT-2781 • ,/ 'Q ��pm Z'I° �� ' in1 1' ilt i-i F FT-25.5 FF�25.6 81 •` /,/ Pt,„ / ? W'em � E. • "FF=27.S y d' FF-25.5 fF-2S5 83 60 ",/:'r_ ____ At I--1 a2'IRO 11 FF-25.5 ` I 1i S`RtG` I /' ,,/// o' Ia' 1 •)0(1, ,(/ 96 �, FF-275 59 / /%q __.__ J \z4s it III / / // • ^A�^_' eo, / 87, / ' ( FF-28.5 . 58 /, /' 88 I FF.28.5 FP5626.5•` / / Ct- w Z - A FF.26.5 ' - / 1 QI I __ FF.24.5` FF-25.5 55 \ / _ / V a . I 30 FF-23.5 __ _ _ .� CO FF-24.5 / FT 2S5 i .` 53 / _ �. BU ' 20NE / N L� r., , . so l s / y F a i- O tr 4.0 1 I ::: / � /_- •FF-24 5'PI so / '",^iic�:oo°,/ ./ ;;5, / /.'// / '"' 0 v) s' 1 --_ ... \ / , .. "; .j -'o '..�/ _ / / / r / Q� • 0' 20' 40' 80' C 25'ORDINARY NI FT-23.5 FT.24.5 49 / ��/ b . ` /;I y, v n o a WATER SETBA K I. 33 :`��"/ s / ICI M.a oEcsm mo® WAR. m*.312 I.sn9 Mr....., i2 Incorporated E. MATCHLINE - SEE SHEET G1_2 EARTHWORK TABLE: LEGEND: 620 Erklevd II,1100 L YvMend Fe E8619 PLave. I425 BT2-4N6 REI405 UNSUITABLE EXCAVATIONITSHALL BE IXCAVATION: 32000 CY(50,000 TONS) 23 PROPOSED CONTOUR 0 Tqg IF2R 1121_BSXI REMOVED FROM THE SITE TO A LOCAL �y Internet LA.OIe01 FILL SITE AND SHALL BE IN FILL 38,000 CY(60.000 TONS) ---"-" - EXISTING G CONTOUR /� 30209.001.001 61. ACCORDANCE WITH THE CITY Cr RENTON Project No. STANDARDS ADDITIONAL FILL MATERIAL ---- CLEARING l➢IR lec TO BE PROVIDED FROM A LOCAL SOURCE �"1 "I AND SHALL BE IN ACCORDANCE WITH BUFFER ZONE Y CITY DF RENTON STANDARDS Sheet No EAIL BEFORE YOU DIG 1-800-424-55551 Sheet 1 of 3 micRoFiLmED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE - SEE SHEET G1_1 •., _ ... . [ . ..... . . _ . ,.. I ‘ 3iFT-218 ,,,7/E•, • \ 51 ji /,' ,- •• ''T---4--I \ ;—32 ,- ,„ t, OPEN SPACtk.X.,: ...............1 111, \ ,..,r.,.....•?/' 'L''•3' 25'ORDINARY HI -- , i I I' ,- FV"/75 1_0_ lit \- - ---- WATER SETBA K '',1 1. /33 •7 / .•• .7; ,, -,:,-,,,,,-- •a--"..,--,'•,,•,,,l't;•,.- - . 11'g • -'•,:. rio",--74,•--'• •T:2----,--.----'''\ ,• I' I' Er:2.5.5 I 1, /t.'; .;,"'Z'z'T'''-'::../--'--:---,•,'e'-, ./ ; L, ;,1 I ____-4.-----— li / \ /t.• -'7 '; '':''',''-z-----/-'1'/ - - .• 1---- ----\:, 7,•e 25*ORDINARY HIGH FT 24.5 1 — WATER SETBACK , 34 /\.• .z% .',cl,; z- ,,../,';-.-7,::::•r:!__:,- -_-2, ,:•.-/t..• I • .• 11 t 1 .' . , , \ / •• 7'/ C ‘// •O,' /','7' •••//' \•‘•• ••;'I ; I ,,, ,, • . 13 II 35,7 • .• / .• ,/,,/,/,' /%'e • ,"/ •• /,,,,,,, 2;90\ \ \1 ; FFm 24.0,• \i N FT..24'46 f •••• ,///1-'7(7f,-//,:%•7/''' .t••;;/1:•: ;// I,., \N, •; I , ';•/,/ ./,‘•, '• I , \ , % : / lq / 1/7 i f---- ...,;..--7 FF,29.5 „1 •• ••••r • 4'9/ / •<I 8 A '. / /I/ /• •// , / ; \\ 1181 i I,N ' /,' •••. 36/ ' LAKE WASHINGTON '—'------- ,\ X FF:324.9...........); / // \ •FTI 28•5‘;' 114) 's..? ?',-/4? FT..24.0/ , ..., tr,i'd 1 4/, , 4 \ : /4-.T ./ ' . \ X .,:--- v e . .:.:--— / 1 ii 1 . 112 ,-----7-7---, ,‘ 1.•'/C pc•••• . ,// // • 1 i ij."•= F,3i.. ....../ if/4" i e .. ' LEGEND: ] isttfiter, x / / - 1 i , ,1, / .4',I,1 1 I Te/ / ' 'Y ,-'1 111 t'''' ' ' •,/ / 23- - PROPOSED CONTOUR :=EZMIll FT 24.5 ,// / '/// 1 4 Frm 31.0 7 Alp, . „,,,/ ' / : ' // 'gA/ • ,f / EXISTING CONTOUR / / , i "'--110 •" / :--- CLEARING LIMIT \[, t . ; ;;/ ;'/// / ,Ir FF.31.0 • -Se ; ,‘,/ / g • //,r / r //r. / . 'Go, BUFFER ZONE .. -- • , 0 Z i C.) .V / ug -- ' • / p i 108 ... , "3925.° "?' I •••• °PE''"P'')FE/ /11// .//1// • ,CZ- .t/ t .6,, , C., ' '.. ' '/ 1 2// '•97 31. '' .././/f4=f54015., 25 ORDINARY HIGH N.N, '' ..,.•*/ , FF..25.0 ''0 '.•.'N ''. ' I i / / ii'''z - 107/- • ? ',345.35' •CZ- ro,„..t g i it: WATER SETBACK .•''S.-'--\. r' //' /// /PT' 4°E,„2-'5-' / 1/,/ ,/,'.,,, , --\.R. • .-. ',/.4,6&... . /,/,/,;',, 5-1 FT_,.3i.5-, 1/ ' /' ,./' CO;rit go• / s "/ / ,7 • E. / ', • \\o> 42 Fr-'2,5y:i' ° &r'' '..." yawr.....-: ,/ 1:•_--- _- ; / ,,,,4, - pt.. -,. &,,•ew,\N///,‘" -.----- -,/ / ,, fi,39., , q° / . , FF..25.0 `.6,•''' . ' /'....7.'.:.-NN'' N'i' -----i-o-i------- ///' / .4'j:ifq- 0 A" ,•/' ../ 43 / '48kt•1,4,,, • /.13 Vz-,-79'7is''• ''' ,c+..k7 •.1 ,/)//,/ ...4.27,%70•,.'",,,.r: V.,,K;..,----103,-----:---- ''V/ / //i;',./,, ,69.',' /''' FF..TAO • N 1:4 '' / .. i s s /4\ ...' ////• / ' ''N'/,/ /0 N•t,_,;••> __1-;-•/-------.;';;/'4';', ,/ `Z' • "Ir.° ' z / /,//,// / ',- /../.4•N / 44. , -/______ ,,,/,, , , N,... z 23,"...*/ \ W z ;FT Z4.5\. :„•8''' ; °' N/t''\-\\../,',/,/,'////4'''" ii/7; /4 FT 3:51 33.5.- r4 ., ,,,,, 4C-.%'11 .„' ‘7--. .. / = IN ‘ ,. ,, /\ • /8. to ..---* --=7----7,-.--2,----- ' „4r / lg. ' ,._ z,• / ' --- ' --,-- ' ..... _. --PROPOSED. ief' 4111r - ‘•:41, .:•••••....,, ..... /--- ... , _- . . - , z, .....-1:--• 'n,\.1,.. .:',N ' /41) _ ,,,,, ..,,,„k,..:N.,:ze .4•11„.,......, „. • J- -' . 41 . / -• / 1114e,,,,7' F7 •'\.. zOtitgr,/<\ ,r,c, , ..,k-: _Ifitiirti,•-,. ,,'../:>' > e) ,i. // ",,,.‘-',. '---- ,er' " ....."'/' Q' -,...//' /// •,,ee,.. ,,' ''.4 —L 1 , e ''' _-7- /\w_, ,,,, ,',:)i,_,22.,,,,,96,:_.r:.._:92,4:...',• '4„c)-:;':--,''---.!'°,::/:\---,.:,;x,,,,,--,,, :,':,iy,J, ': ; ,2° / 44,._-•---/-,- /,,,, / / 0 a A .,. ,...,,. Incorporated . . , i 620 IOrklaml Vey MOO : ‘•.7/ . ',;;;.• >;; \,„---.,411 i /// ".; :-' .i.,:7/ / . 4." / , . J-J 10rkleed,Ye 88033 . ,. / \ i C. `,,,,/ 0' 20' 40' I BO' ° I'Flr 0 8435"4 Z• ,/ N''' /.3.*, /////// ••i ,r -‘. i.,..',, , / '' _,,...,,,-.' . A, i / i„, ,./,,,i...*:,,, - //,/ - r' / Z '70'209 C771°.V" 2 / 03849ErE ...,-1/ '; 2.4'7 A •/'/ //'r / / ';'S' 1%71 1 Project No. -- 1 G1 2 ../FI.--.---1.., ,..',/ , ,0',34 5.,' `,,/ '' •17/ /;;F--/G''On.- Sheet No ICALL BEFORE YOU DIG 1-800-424-5555/sheet z of 3 • • ki it R 0 ILM ' PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. L.--..,,& , ; � J P /, .''N ., 4 1 0 's ;7. LEGEND: j Q= H— PROPOSED CONTOUR -—--,-- - EXISTING CONTOUR elti‘ ———— CLEARING LIMIT / �Oo , • . BUFTER ZONE - / / I �� / /i / hsiF� p1 :/4, ; .A/4.Q. ,' , / eq ''fss / li � ggi El r St/ri t o NI es§ 4i /2/4 / /1r/////i/;'1//,,,."/ //,',/,'/:, ' ' 7-- - q E.:Ali i/ %/I //i W Z ' / / / ' / . /j / g a. a J / % / _ z es. littJ- Y U 1_ f'pf / /% / / 12:1 (n '56'W 1095.47 ' 27 • _ M� i i/ ♦/ ,'/' I/ �G F�-'L r• ——zsa LA_oe�n seat: //;�' /: ;� / / U crs�a } � 1PFF 29.5 ,;•' •^ am. O a /v �� i �.� iF=28.5 FF..28.5 _ -- // / / , // / A / 0 /� 0 Incorporated FF.26.5 i FFm 27.5 FF�27.5 FF�27.5 FF-27.5 FF.2&5 FF 2&5 Y/J^\ /' / �`/ ( _.___ F`1 620 BANDA INT 1100 11 10 19 ' 8 B g \\ EA WA / ' :. I,u� @i1H5'n6 ' 2� / EASEM / Ivtemeh 1,1,1 ma COY .) FF-29.5 //,,/ /,// / /// 0' 20' 40' 00' 30209.001.001 .p` TRACT / Project No. /OPEN SP / 7.1E77 ' G1 3 , po MATCHLINE -..SEE_SH i`G1_1 of ' .mi/ / // L Sheet No. °x1 CALL BEFORE YOU DIG 1-800-424-5555i Sheet 3 or 3 KilicROFILMED PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET E1_3 tm® ® ® M� ®- _I L=®_____.__ fM E3 ,Y`� -- \NBBYB'S61Y_ lOB5.4Y + ;/ �' - .� ? � — '-o TRACT"A" OPEN SPACE //. fl' 23 21 19 I /, } \, `\ 'I `-1 s 22 • 19 , 17 � / 11 ,/, `�\ 20' 20 ' �/ 14 1 w - 24 - Ili w 16 15 / 13 12 11 10 / Is 8 7 6 5 R 4• 3 p • 15'WATER: 2 EASEMENT,' Y '; 25 f / I /. ' ,•\ o`n' 7. I` II i 0 OPEN SPACE/ ' o�� o =',TREET_4—.J .0 —-V—- , _�J_ , 0._ _ f m / 26 / / i '' P S .. , LL, :,,,,, -- 27 - / A .�Y,� 71 '3 74\J /7s 76 77 I . . . 1 . / F "'..,' ro - 28 ,! _ --7- _______ 69 68 87 ' 66 , ____ zi .q Y w78 I e___ t' DT..... . J -- 7ACCESS k , ' // E3O�� v ( - _- UTILITY ESM - • 79 r _ j w ee / �/ / ,• 62 63 64 ,,,,,:',3? • r 1 1w C� ARY SE� TRACT j % O wF.msei fie\EAS ;�' WATER QUALITY _`— 80 /' 1 61 �'2P Rig MZ j_.___..:/:::_i____r 2• • E. QI— 84 _it � " ; /SjREE142Ro4\ 2 i ' < 86 ‹ t / ---, / 7 , _ _ 29 ' '• i , \_ 56 30 _ I 89 a•S' -'i�., i:. l cO O53 - _ Q ` Ct ___.„---._I 90 f5 / .0 w Ld Ii� I 31 aQo 51 y //// / ..ram 0 ar C.)! L413:1 _Z Y .�— - .... 'TRACT'D" '/.�GR J hi: 32 ��/ • ;OPEN SPACE �+ / r. 7`; • y>� r4.4 m Q w 50 / N..I 8 IIII .if: Fv „.17,-,,, ..��/ ��jj�(/i C- CY V; C7 U3 25'ORDINARY NI I, 11 I __!— 49 I L • - � • ...4 ' ' ,/ •/•. �//'/ /N� � 0' 2I0' 40�80' ^^ O WATER SETBa K 1 33 / .. �'�� _ /SJ / / '' v I M�V I I .m\ •• jam%�/' - �• )/ 25'BU // / Incorporated MATCHLINE — SEE SHEET E1_2 EARTHWORK TABLE: LEGEND: a"O 620 tErAeod Way 6160 +-+ Ph,,, We 96033 Phone Isz6)024-450 UNSUITABLE EXCAVATION SHALL BE EXCAVATION: 32.000 CY(50,000 TONS) PROPOSED CONTOUR T� (�5) �_�.n REMOVED FR011 THE SITE TO A LOCAL Intereet 001.001 FILL SITE AND SHALL BE IN FILL 38,000 CY(80,000 TONS) `- COSTING CONTOUR 7 30209.001.001 ACCORDANCE WITH THE CITY OF RENTON BUFFER ZONE STANDARDS.ADDITIONAL FILL MATERIAL Projecf No El 1 TO BE PROVIDED FROM A LOCAL SOURCE x AND SMALL BE IN ACCORDANCE WITH CITY OF RENTCN STANDARDS. Sheet Na [CALL BEFORE YOU DIG 1-800-424-5555)sheet I of 3 ,.9i IC Fi 0 7-1 L MI..E.7 D PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE - SEE SHEET El_l .... ... ,, I 1 , ..... .. .• . / 0/, /, .____-.--i--:- ,---------- A/ '' .` ' , ..'. ,'''''''•....-,,.,..,TRACT'D. '1 .--' ,.., , , • '11 ' .-- •.. .. Y 25 ORDINARY HI - I 7---------7-- . 49 ''' ..1_0_ WATER SET-BA.K - /33 \ ) ,, , 25'ORDINARY HIGH I -----1------ / / .• . WATER SETBACK , ..\ '.'',2 4, ' ',"<'',.'''' 1 1‘ 11 ; 34 ,li .1-/--'- ''---;;::„;:',L-11-l'„ ' ... , - , ,--,', ••‘%1%..4: - :.-'-'i-'''''',-'''':' 'c: • , , . 1 _ . -• ...... /-:;,;/,' ,-„4.,-,<: -- i.-:.--.. .,,---7'\ ',, ,,.\,, \, ' . . ,-,, • ,/. -- .,z ----- ..1 ,, . \ s 6 • I \ .. / ' ir.-1..".<2' .• I.),A. <'12 * - . , • ,.,• : I II 1/ /7 I r •i/..?" , • 115i I i! • • - " LAKE WASHINGTON L----------- \' \ 7 ...........3; /// 1 .:• of' 'Z ' 1 \ .. / li 1 i .. / 113 4 ,0.4,, 47 .1 . .- --• . , ' / i / •.' .\ ' &4,f1'.4, ..4,,' . , .) , , :.,:,,.. • 112 / 37 : i / ,/i / i 1 .."Y., \ •• ••• / if / 45' ,''.' LEGEND: : 50,au, . a/ / 1 ...,_ : ' // i ill / / .1 iii ) f , °' - / . 23 PROPOSED CONTOUR love.OM I 1------- : 1 i / fi / .11 : . ,,'- .' . COSTING CONTOUR ,1 : /i i'ii i 1 J. ,e-110 • BUFFER ZONE --------------11114. 38 -- ' /''i 7.' 7--------___ : i // • I 109 ,-----.... ------------- , .....• .: ///://iii://,i), 1 ili''/111 :TRACT'0,/ ,/ f / g , & 81 ,,,,.,.,..-"--...."-----.-.... 4, 39 .. OPEN SPACE i / I 1 i 108 -- _- ..RI...a 25' ORDINARY HICH / 1 i .' //,." /// / 11• 106 1,107 • .1. WATER SETBACK ) ' ' . ••\'r CIO tlfi ! rS-, ' / ' ' --' 9, ,, •-.147.,:',./,',/ / / / /,,,'P 4/ • c:3-' -- E-. ,' ), \`'‘''• /z"'•••,.. tir,..40:01z , / ---,:_--- 0 --- 42 41 / ,ilre.,' ,\ f 77,c, 4----:,----Hli4 /S e 43 a 4./ ! -,i-<./ • /' ,%/ - \/4402i,',.:-.-.;63,----- Y / ;;;/,'44- ', ,.?• , ,////\ •6.7 s .' N •• ,/ k.,. . -/ 4 / .:,,e / / /., ., ,.. /. 4 .. _ ..::. / , 4" • c-3' -.4 • • Z. j //,/'/'' '' ,''' if ...;:..,i / . ,•..a, / - ,\92 7 ;.,,--,•,•i•-i/ ' /\r./•y,/—/--.._N•R'\A,- z . N. a•-•-.... / i • .,, „:.,....." ./P • , . ...... w d - .'.) r4 •-,.- '41/4 Zip& , .. ,/,, f s t,,,‘ / 0..J i ,,' ' Ita.., ,.., vf 4,I..• ' ,,,„' / i •,-, C.) z / > = 6 L 0 ;, / ‘' '` +., .9. / / 95 krAilli " ':'// 1 / 4-0 I,------/r / ' r•-,,f• „ z -• f.',/'44' '.-:•--,6W-, / EU rem-- ..., ' c,,,• ,Y • ' --- / / = / (Q----r v P, s .;\ 98, .. ., ,/, ,,„ . , . ,. . icily A/ y ' i / P...c ., 6 Mcorporated ln. Nc, . 4 / ,,, • c ..---•\/ / , 620 Ealcland Pay i100 .4-J Eutland,.98033 --- - ,----• • .`2 1 V O. 20' 40' 80' 0 RI" 0?rail ,•'N '-, i yr ,..„/, ‘.9 --• ..-. ,-7 terve. 1111,0takCOM / ' ,4/ - /74y‘- //f/' :e 7 /.---.7f., / r1.1.M71 4-1 '''30209.001.001 Project No. SBEP49.55.1 -,--hs-f:' .,,,./ / i — /,',//./ ' 4,'' , -/ ,,/.. ,84.5..5 0, BE-IF/NG / Ii Fr---1.... i !, / ,. .Y.v/- Air,--"5, ., 7,'- 5 Sa-'-'9,,,"E. 1------ Sheet No. u - ICALL BEFORE YOU BIG 1-800-424-5555!Sheet 2 of 3 K KEK9 08/25/02 10,1p.o-->x\PROJECT V0200\mos\o2G\PPu,\E1_3 D. MATCHLINE — SEE SHEET El_1 S•P r� 4 / 1 1. Rol 0 4 \ \ \ (if ., -..„, A f � \ r\; `\ '‘,,‘‘c.:,,,„,‘ ,.\ ^, . - ,, \ 3 A '' S/ \ V\to \-..\ \ \\ aQti—�( `` .. \ 1 . \ /� \, b 0 \ 1 �'\\, \t 1 ,N V \ Z o r \''-- '' `1,,\12\iN1:-''\,\:- ,\\''. o S • try, A.® 03 c :(.\\ ;\ ,\' \\'‘ , \\,V* "4 , \,, ,,„, \.,,,,, , \\0\7\\\ t, \ '' ‘*, .'82,:t4y;', ', V'' :',P. ivw , , ::\ \ \ \ \---‘ \ \`� ), ` z • ! tf r71 / ,7' C \i . \'''' \--lff4,\ 1 ,,,....:3 '''' \‘.,,, \\ ,‘ ' ...., ,\.. . ,,,,,,,,i,st.,,,, ) j (<\ 7,d 'iitIOP4N . \ ,. �: . :/ . t Permit Review I Not for {ryConstruction Y. Y. v rPg m S' g , O BARBEE MILL PRELIMINARY PLAT OWNER ;, o o$ .� BARBEE MILL o3& e Q) GRADING ELEVATIONS 4101 o Q CO.CN BLVD.N Z PO ' u W pIn ' SHEET 3 AMON,NA eeoas [L'/o/oo EGO K,= „• EGO a H i 8 C PA.{26-22E-9Y00 - .4, \ ?E' w, , :!,: REMS1085 MICROFILmEt PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. ® MATCHLINE — SEE SHEET D1_1 Y 61 --25'ORDINARY HIGH ��-- % ; - WATER SETBACK I ,// ' // - —- VVV• �'°f 351 46 i/fie/ J 5/ t1\ '' 'I' ..I, LAKE WASHINGTON `��-- 1 - - 36/ ,C I 14 1 SI 1 - ��~ s2 %r, 45 / 113 ;}� _ 1. ' li ! 37 so/ ///R //I ' /� '1 112 ��1� / =rP, ;n,' LEGEND: I*11101 ti 1 / ////I// � �11 eK •_, 23 PROPOSED CONTWR l / •� r / .°•2` / l I lx l/ :'-110 �.. _'� / —SD— PROPOSD STORM DRAIN •�' llF /' r ❑ PROPOSm STORM CATCH BASIN` BUFFER 2WE39 / !I / // 2f _ R 2 65.00' Q G WFok$ 1 / 7 ' , 159=4B, 21.w25' ORDINARY HIGH �/ . 1D 4 j 3Rj.35' D'7 WATER SETBACK / 106 - Q' RI 42 4 /frA_4 \//- I. a. - °5 / / /''e' 1 • iI �Q /! //- 103�- / // uy= /' tip' Ix �/\ 92 / � ne ¢i' /; ; •" tea //� / �i � 0• n P. d a (4 1,,"://--.,\---.7.,-,/4t,,4p4',/;o:,i r/*,`/ / PROPOSED TRAIL i -% , ��„ `-` / / `' / / -!OVER EKIST:BRIDGE \ ;."= ,i0.•,,, ari:i s( �p/`7 L - _ - "-_ .., / ` �` ��/ // �V��% /'/ O w O _ ''ems` ,4 �" ''.:;f% ' , I- CC 2 % NP o �`� / / / 0 ______ Eu ..--- ' r- t.• 197 ��•` „ 'ss !ii/',i �O D�oFaled /' r{,��, / /J '/ P /; s4:•JP' 0.L Rrtlml Ye 96033Io5 0' 20• 40' 80' gr ,zs)) en-1 FdZ �125) 8'i-95'R ' 'j,,�c/ _\`\ • / / l!! /, /,/ J. // Internet enot�x.cou / l f• // ,,,- /\p 30209.001.001 11;'i/ . 7 Project No. �' 988149.55E ZB9 T83•A I '/.// f � %% 7. D1_2 • f /�' �.'�9+51�OF B£JP(hc,�' _e9.J8'(M1)[Ll�---' Sheet No. All.BEFORE YOU DIG 1400-424-55551 Sheet 2 or 3 iC n ME • PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. MATCHLINE — SEE SHEET D1_3MGM _ 1 / ,� - fi} '. 1 I 1 ,i ///i 23 , -ryh _- 21 I 7. \ zo' 20 '�14 I 1 \ \ w / \ o I 24 / 16 15 73 12 11 10 ' y ' 8 7 6 5 4', 3 /' w 5'WATER �� '' 2 / EASEMENT,' 4.___N____..„:". Ii / i ' Om - •"-E,rC rr • r :•0� /, OPEN SPACE' s __ 1 - _-1# � __ R1 00 r • t- Aye 26 tsiao, o 3 li r ,' - 77 \ / 7s i I' • 28 __ _ 69 68 67 66 <12 - . 0 3 78 // 70 J /: / , / / -_ _- o ACCESS E / / / 9- 6 � /'x, p ACCESS ESMT� -- / / "0h sT i' / 79 /1 ,, lm tiID't EN SPa E•� Y �// ♦ /62 63 64 `', . z :'S �7 TRACT•B - y / w �\A 1.. WATQt QUALITY 80 • / `61 ' V•z / ,,, . ';,',f, , , (81 \ ra. r1 8 1— .�" 84 --` /'� gym" ma♦' / g ' \uopialbh... ,/,,orK \\ --- i___----- 86 :000,00 so _ s a // zi 1-----r-' -------- \liT-.:7t .1 .,_7, 8_:____ _ ♦, j * 53 4__ ,:,_ . 1 90, , ,,, 1 . ii I_____-‘ _3_1 f / / Q- o :z. r.4 . .„ , g 5-r z $ IfI8 .. /' ✓OPEN SPACE ,N% �:�,/ / /,// C 0 I I - M 32 �/ 50 •/' j P�i. , .P / '% O W W __- ♦ % ',z o' 20' 40' 80' 4-4 W 0 25'ORDINARY NIG �( 49 - /� ',, // / U '1 Z WATER SETBA K �. 33 1 E, ., '/y1, _• ^ •� / I I s, .F /i"ii f�:-. -•f "—ri,rrzs'BuvPEk aI'� (CD Ct=n" n MATCHLINE — SEE SHEET D1_2 9 0 a a U LEGEND """• 23 PROPOSED CONTOUR 0 Incorporated -2) -- EXISTING CONTOUR P"b t�..l SD- PROPOSED SCORN DRAIN �.i 620 ClvEi.a0 pss • 20 1e 9B OU M3 O Phone (425? t>22-M18 0 PROPOSED STORM CATCH BASIN DO 425 B2!-BST! BUFFER ZONE mtemet. imr00/U0Y.CON 30209 001.001 Project No D1 1 Sheet No. ICAIL BEFORE YOU DIG 1—K0—424-55551 Sheet 1 of 3 K•KENO 0B/26/02 t0.29Pm-->H\PBWECT\80200\30209\OoG\PPu1\OI>0MG MATCHLINE — SEE SHEET D1_1 (i4111 II,, '' 1 0';'....",....„ •/ I 1 \ \\ ' '', \:\e,, s..\\ \ ,r \\ / Ii r \ 'ti` \A o • � 2 \ \ \, , ,.,.-'',.:‘ ,,, .,‘ NS \ \ ', .v , . , \ .\,‘ \ ! ' \ \'‘'\ ••‘. \:-\\ \ A ''‘i I 0 % \\\ 4-'.\\‘ \,\• '' i:-.3 . , \,, 7/ \ .., \,,, , '.4:''/'-, / (\ t Z .,, 0 -;-- \.. ',,,_ \\*N\ ' .--1 /' , \,,,\s, \ J--- \ . r.i \ / , , ,\s, \\VAtti O \ \\\ `\\ . -\''\3a\ O • �I \ %,, , `6' \ \\\.,,,,,\ \ . s \\\ \.,4,‘\:•p'ce, ' , , : , \\A \ (`',--, . iv i `` . /_, \\1 Z ' , ,,v,/n, \, ,,, ,ss „ CT • ''??,\\\\\X::‘\ 4 1'1 ''.3 %'\ s \ . \ ,,I.-` \cc\1 ' \;\..\ i. v N \---,____ 1 1 '\ '".' • A fi'.'))..'. ., \ �� ' ��\ : \ , , J \ I Permit Review INot for Construction x off ' ' BARBEE MILL PRELIMINARY PLAT OWNER: 0o s o 11 f BP,, BZ.. MILL CO. �. ''' -. m rvi DRAINAGE CONTROL PLAN Po 80 91.ffi�GTON BLVD.N ti 1r W o Iy� SHEET 3 RENTONN-W-°sego �9 B/:,/B EGO w. EGO ilic „\ NO O.1E B1 ape B swBB PORTION OF GOVERNMENT LOT 1, SEC. 32, T24N, R5E, W.M. • BARBEE MILL PRELIMINARY PLAT - ROADWAY SECTIONS 0 rb$ o, "d 60'ESMT. 8'PUE 42'R/W RNIROAD C S 21 ]tl' 0 b' 21' C - P m l'= ILO 18' 5' S' 2' S' __ ID' _ 16' S' zj SIDEWALK 0.. TRAFFIC LANE TRAFFIC TARE 0.5. SIDEWPII( �-Y -.SIDEWALK 05. TRAFFIC LANE r TRAFFIC LANE 05. 3 z �_ 1 �'1W 3 3� 0 ©: r <4'''z 2 �.. .T ,Uv�. ,�.�. ._3_ 2z 50, .. 11181DE5 r — o: 1—e/W 0 i OFFSITE ACCESS COLLECTOR STREET STREET"C" g NOT TO SCALE NOT TO SCALE Oy U§ z if, W aka 8'PUE 42'R/W a• eo CA�V Z� 8'PUE r 8'PUE 26'R/W 21' 0 21' __ 13. G 13' C9 i i 5' 16' • 16' S' 3• IS' •,• ID' 3'• E SIOEWA1.0 05. TRAFFIC LONE I TRAFFIC UNE 0.5. SIDEWALK TRAFFIC LANE TRAFFIC UNE ��21- l © 2 2 y_ a I Q e 1 O ��R z P" TW Li F ici:f L. a a ONSII E RESIDENTIAL ACCESS STREET PRIVATE ACCESS TRACT w NOT TO SCALE NOT TO SCALE PL. Z A7 I- I-4 0 V W C W .10 wa ROADWAY SECTION NOTES ; u oa o a i p.S.ASPHALT CONCRETE PAVEMENT,CLASS B F .> E PPTY F. ®2'ASPHALT CONCRETE PAVEMENT.CLASS B 4.-T 2.O O (ASPHALT TREATED 7 CRUSHED SURFACING TOP COURSE OVER C CRUSHED SURFACING BASE COURSE 3 O o a 4o CEMEM CONCRETE CURB k GUM GU l 7 ,E U C'.c' •-- a,O Incorporated 620 40042.a fey MO 4-, 10r1lev4•e 88033 OPhoee (485) 688-4446 FA% 485 821-85T1 mlauec mOIek.CUM 30209.001.001 cProject No. CO_4 Sheet No. 2 [CALL BE000E YOU DIG 1-800-424-55551 Sheet 1 of 1 • STATE ..�:x MICROFILMED /1`4 1889 t10 STATE OF WASHINGTON DEPARTMENT OF ECOLOGY Northwest Regional Office •3190 160th Avenue SE• Bellevue, Washington 98008-5452 • (425) 649-7000 December 14, 2006 I certify that I mailed a copy of this document to the persons and addresses listed herein, postage prepaid, in recAptacle for United States mail in -e tie✓L,f__� Steven Wood/Campbell Mathewson Washington, />// Century Pacific LP 1501 Fourth Ave., Suite#2140 signature / Seattle WA 98 101 (/ Dear Mr. Wood&Mathewson: Subject: City of Renton Permit#LUA-02-040—Approved Century Pacific LP-Applicant Revised Shoreline Substantial Development Permit#2005-NW-50011-1 Purpose: Notification of Receipt and Local Approval of Revised Substantial Development Permit(SDP) On December 4, 2006,the Department of Ecology received notice that the City of Renton approved your application for a revised SDP. Your permit is for a proposed 43,000 cubic yard increase (total 80,000 cubic yards of fill) as part of a 115-lot residential development within shoreline jurisdiction of May Creek/Lake Washington(Chapter 90.58 RCW). By law, local governments must review all SDPs for compliance with the following: • The Shoreline Management Act(Chapter 90.58 RCW) • Ecology's Substantial Development Permit approval criteria(Chapter 173-27-150 WAC) • The City of Renton Local Shoreline Master Program Local governments, after reviewing the SDP for compliance, are required to submit the SDPs to Ecology for filing. Your approved application for a revised SDP has been received and subsequently filed with Ecology. What Happens Next? Before you begin activities authorized by this permit,the law requires you to wait at least 21 days from the date we received the decision letter from City on December 4,2006. This waiting period allows anyone(including you)who disagrees with any aspect of this permit,to appeal the 19 a . a Century Pacific LP December 14, 2006 ) Page2of2 decision to the state Shorelines Hearings Board. You must wait for the conclusion of an appeal before you can begin the activities authorized by this permit. If no appeal is submitted you may begin activities any time after December 25, 2006. The Shorelines Hearings Board will notify you by letter if they receive an appeal. We recommend,however, you contact the Shorelines Hearings Board before you begin permit activities to ensure no appeal has been received. They can be reached at(360) 459-6327 or http://www.eho.wa.gov/Boards/SHB.asp. If you,want to appeal this decision,you can find appeal instructions (Chapter 461-08 WAC) at the Shorelines Hearings Board website above. They are also posted on the website of the Washington State Legislature at: http://apps.leg.wa.gov/wac. Other federal, state and local permits may be required in addition to this shoreline permit. • If you have any questions about this letter,please contact Joe Burcar at 425-649-7145. Sincerely, • 7t, CO,V Joe car, Shorelands Specialist Shorelands and Environmental Assistance Program JGB:ca cc: Elizabeth Higgq.s, City of Renton • • • J ` - • YA 02- L•k ) Co-V PREPARED FOR: CENTURY PACIFIC, L. P. fCROFLMED PRELIMINARY TRAFFIC IMPACT NA LYSIS DEVELOPMENT PLANNI CITY OF RENTON NG AUG 707 RECEIVED BARBEE MILL PROPERTY • RENTON9 WASHINGTON PREPARED BY: HDR ENGINEERS, INC. DULY 23, 2002 (V i Final Traffic Impact Analysis • BARBEE MILL PROPERTY Renton, Washington Prepared for: Century Pacific, L.P. . .BEN K. 1501 4th Avenue, Suite 2140 .,fig ev WASH '� Seattle, Washington 98101 coQ r' ' • (206) 689-7203 • ,3321211 0, -k'Grs- " fQNa "� I Prepared by: EXPIRES 10/23/0> I HDR Engineering, Inc. 500 — 108th Avenue NE, Suite 1200 Seattle, Washington 98004 (425) 453-1523 July 23, 2002 TABLE OF CONTENTS Introduction - 2 Existing Conditions 5 Intersection Channelization 5 Traffic Volumes 5 Transit Service 6 Accidents 6 Traffic Volume Forecasts 9 Trip Generation 9 Trip Assignment 10 2005 Forecasts 12 Traffic Impact Analysis 13 Level of Service Analysis 13 Mitigation 17 Summary 19 Appendix A—LOS Calculations 21 Appendix B—Existing Daily Traffic Counts 23 FIGURES Figure 1-Project Vicinity 3 Figure 2-Proposed Site Plan 4 Figure 3-Existing Intersection Channelization 7 Figure 4-Peak Hour Existing Traffic Volumes 8 Figure 5-Project Trip Assignment 11 Figure 6-2005 Peak Hour Traffic Volumes Without Project 14 �-I March 28, 2002 1 Barbee Mill Property Traffic Impact Analysis 'I , INTRODUCTION This report documents the preliminary traffic impact analysis performed for the proposed Barbee Mill Property Development to be located in north Renton, Washington, along the shore of Lake Washington. This report documents existing traffic volumes and intersection channelization in the vicinity of the proposed development, estimated trip generation for the proposed development, and a level of service analysis for traffic impacts created by the proposed development, as required by City of Renton Municipal Code 4-8-120D. This report also addresses Pre-application Review Comments received from Lesley Nishihira in an April 24,2002 memo. Specifically, the comments addressed are items 1 and 8 under the heading Street Improvements. The development will be located on the Barbee Mill Property on Lake Washington Boulevard,just west of the NE 44th Street/I-405 interchange. The location of the project site is illustrated in Figure 1. The proposed development will consist of 24 townhomes and 88 residential duplex units. The proposed site plan for the development is presented in Figure 2. One drivewayis proposed on Lake Washington Boulevard south of Ripley, which will p p g provide access to the 24 townhomes only. The 88 residential duplex units will have access via Ripley. The proposed development is expected to be completed, and fully occupied,by 2005. March 28, 2002 2 Barbee Mill Property Traffic Impact Analysis N eiAi vor 4S6 1. �� ' .e...SCI9 SE 76th St 15 co , i NE 44th a' , i if, ta, Project ...,,,.> 1.0 Site o �, v C • SI N 40th St 1 w. Lakedrat Washington - -..: N. 36th St `.1-,.,,r, 1.A. I > igeC LE .- i as cc) N30thSt 'Y' T 1"• a - C C'rek,Peif:rk,,, 1 1:rx ‘1 r—1:,_ ,,L,„ t.,,,, -\\:\74\4,. ; NE 27th St :, � a ,„..r, Barbee Mill Property Figure 1 FDR. Traffic Impact Analysis Project Vicinity 1 Y , . 1 �A 5o R.o.w. Nvr 1 ( 14.06E As-4,4tY(',oppose_ Goo.l Ft.o.w. I/ s ii ' 1 It 4 7 \ 7 • � "51 • 30 • a ,t�k11314. r 4o za �4 r,>Pt�X 51s ,-, . sa Iwl x qo' i mint*RIM za 42- , . • zi - .iir' .1.4. li•MIE.FP1ortt 14 43 'sS \ Nt---�'" \ ZS 4 f ,fr 1.14 „0010.05 .: . . .. : ..: .01 . t� , 14M-4NA SuFFSK Z z Z4 'it,Wniloya1P.:917*; T1 z%.f-r MC., wloTti 3 d, Z I -1... . 11.40,1 V. a burl Zi'Tomiet4E4 w legL3E ttZ -tov1 vnljy ea 4011aw eth , / ... H. K-r++ r.,...,..-......... t— So 0 14. Zo —I S I' Barbee Mill Property Figure 2Proposed - ID:I Traffic Impact Analysis Site Plan r-- EXISTING CONDITIONS INTERSECTION CHANNELIZATION Figure 3 presents an inventory of the existing intersection channelization around the proposed site. Four intersections were analyzed in this preliminary traffic impact analysis, because these intersections are expected to be the most impacted by the proposed development. The intersections are: { • Lake Washington Boulevard/N 36th Street/Burnett Avenue N • Lake Washington Boulevard/Ripley Lane • NE 44th Street/I-405 Southbound Ramps/Lake Washington Boulevard • NE 44th Street/I-405 Northbound Ramps/Lake Washington Boulevard All of the affected intersections are currently stop-controlled intersections. The speed limit along Lake Washington Boulevard and NE 44th Street is 25 mph. There are sidewalks on both sides of the road east of the I-405 interchange;however, there are no sidewalks on the west side of the I-405 interchange. There are marked bike lanes on both sides of the road on Lake Washington Boulevard west side of the I-405 interchange. Lake Washington Boulevard is a two-to three-lane, north/south collector arterial that connects N Park Drive with NE 44th Street in north Renton. The primary land uses along Lake Washington Boulevard are residential, recreational, and industrial development. NE 44th Street is a three-lane east/west collector arterial that connects Lincoln Avenue on the -` east side of I-405 with Lake Washington Boulevard on the west side of I-405. NE 44th Street provides access in all directions to I-405, and is primarily surrounded by commercial development. Burnett Avenue is a two-lane,north/south collector arterial south of N 30th Street and a residential access street north of N 30th Street. Burnett Avenue begins/ends at Lake Washington Boulevard at both of its termini, and is primarily surrounded by residential development. Burnett Avenue could be used as a shortcut from Lake Washington Boulevard to access the N 30th Street interchange at I-405. The speed limit on Burnett Avenue is 25 — mph. TRAFFIC VOLUMES Existing a.m. and p.m. peak hour traffic counts were obtained at the four study intersections on Thursday, March 28, 2002. Existing peak hour traffic counts are illustrated in Figure 4. Traffic volumes on NE 44th Street between the two I-405 ramps are just under 1,100 and 600 vehicles per hour(vph) in the a.m. and p.m.peak hours, respectively. March 28, 2002 5 Barbee Mill Property Traffic Impact Analysis TRANSIT SERVICE Transit service is currently not present in vicinity of the proposed development. There is no transit service on Lake Washington Blvd. or NE. 44th Street in the vicinity of the project or the I-405 interchange. The closest major transit stop is at the NE 30th Street interchange with I-405. This location is served by Metro Transit routes 111, 167,247, 342, and Sound Transit route 560 on weekdays. Metro Transit route 909 also stops at this location on weekends. ACCIDENTS A review of accident data was conducted in the vicinity of the proposed project. Accident data was available from 1994 to 1996,however a limited amount of data was available within . the study area. From 1994 to 1996,nine accidents occurred at the NE 44th Street interchange. The majority of accidents involved"entering at angle"vehicles. This type of accident is likely caused by vehicles attempting to make left turns at the unsignalized ramp intersections. This accident occurrence is not unusual for this type of intersection. No other significant accident trends were noted. March 28, 2002 6 Barbee Mill Property Traffic Impact Analysis N 0/11 ) re, Q,, 4111 co ". .. . ... . � roc s'� " SE 76th St �- i L ' E 44th •�441 4,,, 'Q ' 400.'- /2 3 �: CO e 7 ± \A4 /4--- .."-- ....a> 0 ,project; c Site o qw N 40th St ?? 60 Lake: ' �cF Washington ' ` N. 36th St 1 ) ��, /� wTr I � 0 � 1 j i 1 i0p N30thSt 1, T `'" May`Creek:P�a1'rk l'Y i:..,,r�: Y h, Legend Cr- , s�' . Stop-Controlled Intersection 1• N• ky Z. y-' Stop-Controlled Approach "� 1 it I `-- Figure 3 Barbee Mill Property Existing Intersection FD Traffic Impact Im act Analysis Channelizationi 3 N \\ 160 5 165 (65) �5) 4 �--((35 280 1 � 55)15 r- 125 (670)-4. 0 14 2 15 (10) IV \a i (Q �5 5 20 \�S\oti55 ' pC (5)( f/ '° `m :°i SE 76th St ,,,,,ir 4- MI %' , ` 4 07 - `;; / �* 180 25 45 ,�(65)30 Nti0 i v (295)(20)(10) �_(120)115 `y (1 ) 2 3ifi0(360)J 1 11200 65 10 f !r co 185(90)� (10)(100)(6 6) Tr �J (110)(15)(0)/(/ / s (5)5 ..;J• a " 45(265)---- 10 230 160 �(5)5 Q + Project r (0)(165)(5) .Site. f G 0 �1 �'ti0 35 5 (420)(5)(5) .. . s 40 • N 40th St jr.... ..... �� Ion 4 Lake. _ cr Washington 0 °� N. 36th St y j� r ( �_. L t 4 a a. ,r.,. r: m N30thSt ' kJ T 7,.d4rI` a il?lay.Creek';Pa 1" r., i Legend k, 1 'kgs�J (X X) A.M. peak hour volumes r 4 X X P.M.peak hour volumes 1-"-. Figure 4 Barbee Mill Property 2002 Peak Hour Existing till Traffic Impact Analysis `r Traffic Volumes - TRAFFIC VOLUME FORECASTS TRIP GENERATION The proposed residential development will generate some new traffic in the area. The a.m. and p.m. peak hours, and daily number of vehicles that will be generated by the development were estimated using rates/equations provided in the Institute of Transportation Engineers' 1997 Trip Generation manual, 6th Edition. The Trip Generation manual is a nationally recognized document providing trip generation estimates for more than 100 different land uses. It provides trip generation estimates based on average rates or equations that simulate data points,which consist of trip generation studies conducted all around the nation for various land uses. There are no land uses in the Trip Generation manual which are specific to duplexes; however,townhouses are included in the manual. The definition for a townhouse in the Trip Generation manual is: ...single family ownership units that have at least one other single-family owned unit within the same building structure. Because a duplex could fall within the definition of a townhouse,based on the Trip Generation manual, the trip generation rates/equations for the townhouse land use code were ^; used for both the duplex and townhouse units. The estimated a.m. and p.m. peak hours and daily trip generation for the proposed development is summarized in Table 1. Table 1 Trip Generation ( No. of Trip Rates2 Vehicle Trips Period of Time Units LUC1 In Out Total In Out Total A.M. Peak Hour 112 230 0.08 0.42 0.50 9 47 56 1 i P.M. Peak Hour 112 230 0.40 0.20 0.60 45 22 67 Weekday Daily Total 112 230 3.20 3.20 6.40 358 359 717 Notes: 1. LUC = Land Use Code from ITE Trip Generation manual 2. Trip rates are measured in vehicles per unit. March 28, 2002 9 Barbee Mill Property Traffic Impact Analysis r t The proposed residential development is expected to generate approximately 56 and 67 trips during the a.m. and p.m. peak hours, respectively. On a weekday, the development will generate approximately 717 vehicle trips daily. TRIP ASSIGNMENT The vehicle trip assignment for the proposed residential development was based on existing travel patterns and access to the major arterials and freeways. Figure 5 depicts the a.m. and p.m. peak hour trip assignment of the project-generated trips at the four study intersections ' and one driveway on Lake Washington Boulevard. The Lake Washington Boulevard/Ripley Lane intersection experiences the most project trips. , -- March 28, 2002 10 Barbee Mill Property Traffic Impact Analysis r N — . 022 �--♦f (4)16 I 42 16—► CO 4i (34)14 (6)30 IEth CO tb 23 b 4\ (21)3 2 I ? ((5)10_4. 1 16)3 Project ° C Site ... 2 a (1� 5 :i tV N 40th St‘,-.-, �' \p '' J Lake I a, 1 titashington `�� '� /` N. 36th St 1 1 1 J 3 j� z Ate.b I � i > c 0' m N 30 th St --c .,` - YT , " N j ` Tr. r Td. l''T T r r .'',,.; -May Creek Pak .i.,.--fir 1'�( i L. o j"Z .. r r'..,r ""7 .. 3 ...1.) 11, Legend 0- as (X X) A.M. peak hour volumes NI c X X P.M.peak hour volumes 'I_1 Barbee Mill Property Figure 5 IDR. Traffic Impact Analysis Project Trip Assignment r 2005 FORECASTS To account for future growth in the City of Renton until the development is completed and expected to be fully occupied, an annual growth rate of two percent per year was applied to existing traffic counts, and pipeline traffic from recently and previously-approved development were added to the existing traffic counts. Forecasts were estimated for 2005. r- This methodology is consistent with the methodology previously approved by the City of Renton and the Washington State Department of Transportation (WSDOT) for the I-405/NE 44th Street Interchange Project Transportation Discipline Report(June 2001). The projects included in the pipeline development traffic were: • Labrador Subdivision • The Bluffs • Tamaron Point • Southport Estimated traffic volumes for both the a.m. and p.m. peak hours in 2005 are illustrated in Figure 6. March 28, 2002 12 Barbee Mill Property Traffic Impact Analysis TRAFFIC IMPACT ANALYSIS LEVEL OF SERVICE ANALYSIS A level of service (LOS) analysis was performed at the four study intersections and the proposed driveway on Lake Washington Boulevard in 2005,with and without the proposed development trips, and for both the a.m. and p.m. peak hours. The LOS Analysis was conducted using the principles of the Highway Capacity Manual through a computer software package,known as Synchro. The concept of LOS is to rate intersections { operationally based on the average control delay per vehicle traveling through the intersection. The LOS of an intersection is ranked from "A" (low delay) to "F" (delay exceeding 80 seconds per vehicle at signalized intersections and 50 seconds per vehicle at unsignalized intersections). By 2005, the City of Renton is expecting to install traffic signals at the intersections of NE 44th Street and the I-405 ramps. Therefore, these intersections were analyzed as signalized intersections; however,no changes to the existing channelization were assumed. Results of the LOS analysis are summarized in Table 2 and Table 3, for the a.m. and p.m. peak hours, respectively. The LOS calculations are provided in Appendix A. I � March 28, 2002 13 Barbee Mill Property Traffic Impact Analysis { N 3 190 6 176 I `► 4----(377)197 1 155 (732))-0. CO 21 (14) b. qt.,. 6 22 ,`L'1�1'� VI o� (6)(54) T/ .1ti SE 76th St .( .% ` 4.......' `6 �► 4 CO �, ti\ .k 199 27 48 L(69)32 156\69 f (315)(22)(i1) —(129)126 > ",./ IF(112)69 < E 44th 11, 3 s 66(388) 41r1 1 ' gii c" J 243 69 11 202(96)� (11)(10 (gg �,, (122) (16)(0) (6)6 `. :• ._.W 63(297)--4, 11 245 170 Project ect c Site o / (469)(6)(6) ' p J N 40th St ^v Lake #i Washington sv /' N. 36th St �.., d N 30 th St t "'' -"I1ay:Creek.: 'a* ..r. .1:...."t,• % r Legend : (X X) 2005 A.M.peak hour volumes ,p ) ., " a1 XX 2005 P.M. peak hour volumes ..,- r:..N. I Barbee Mill Property Figure 6 Ii1I Traffic Impact Analysis 2005 Peak Hour Traffic Volumes without Project Table 2 2005 LOS Analysis Summary A.M. Peak Hour Without Project With Project Control Control Control Delay/ Delay/ Intersection Type Vehicle LOS3 Vehicle LOS3 Lk Washington Blvd/N 36th St/Burnett Ave N AWSC 16.0 C 16.1 C Lk Washington Blvd/Ripley Lane TWSC 2.0 A 4.2 A '._ NE 44th SUI-405 SB Ramps/Lk Washington Signal 37.1 D 43.4 D Blvd { NE 44th SUI-405 NB Ramps/Lk Washington Signal 18.3 B 18.1 B Blvd Lk Washington Blvd/Proposed Driveway TWSC n/a n/a 0.2 A Notes: 1. TWSC =Two-way stop controlled intersection, AWSC =All-way stop controlled intersection, Signal =Signalized intersection. 2. Control delay, measured in seconds per vehicle, is a measure of all the delay contributable to traffic control measures, such as signals or stop signs. At signalized intersections, the reported delay is the average of all the control delay experienced for all movements. At unsignalized intersections, the reported delay is for only one movement,the movement experiencing the worst control delay, which is typically one of the stop-controlled side street approaches. The control delay reported at unsignalized intersections is not a valid indication of the operations of the entire intersection. 3. LOS is the level of service, a concept based on the 2000 Highway Capacity Manual, rated from "A"(low delay)to"F" (delay in excess of 80 seconds per vehicle at signalized intersections, and 50 seconds per vehicle at unsignalized intersections). II March 28, 2002 15 Barbee Mill Property Traffic Impact Analysis Table 3 2005 LOS Analysis Summary P.M. Peak Hour Without Project With Project Control Control Control Delay/ Delay/ Intersection Type' Vehicle LOS3 Vehicle LOS3 2 2 Lk Washington Blvd/N 36th St/Burnett Ave N AWSC 9.6 A 9.7 A Lk Washington Blvd/Ripley Lane TWSC 1.0 A 1.6 A NE 44th St/I-405 SB Ramps/Lk Washington Signal 14.2 B 14.2 B Blvd NE 44th St/I-405 NB Ramps/Lk Washington Signal 29.4 C 31.1 C Blvd Lk Washington Blvd/Proposed Driveway TWSC n/a n/a 9.3 A Notes: r 1. TWSC =Two-way stop controlled intersection, AWSC =All-way stop controlled intersection, Signal = Signalized intersection. 2. Control delay, measured in secondsper vehicle, is a measure of all the delay contributable to traffic control measures, such as signals or stop signs. At signalized intersections, the reported delay is the average of all the control delay experienced for all movements. At unsignalized intersections, the reported delay is for only one movement, the movement experiencing the worst control delay, which is typically one of the stop-controlled side street approaches. The control delay reported at unsignalized intersections is not a valid indication of the operations of the entire intersection. 3. LOS is the level of service, a concept based on the 2000 Highway Capacity Manual, rated from "A" (low delay)to"F"(delay in excess of 80 seconds per vehicle at signalized intersections, and 50 seconds per vehicle at unsignalized intersections). During the 2005 a.m. peak hour, the LOS ranges between LOS A and D at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS, and all but one of the intersections experiences a small increase in delay(6.3 seconds per vehicle or less). The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the a.m. peak hour. March 28, 2002 16 Barbee Mill Property Traffic Impact Analysis L_ 1 1 During the 2005 p.m. peak hour, the LOS ranges between LOS A and C at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS, and all but one of the intersections experiences a small increase in delay(1.7 seconds per vehicle or less). The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the p.m. peak hour. MITIGATION The City of Renton does not have a LOS standard at intersections; however, in urban areas, many jurisdictions implement a LOS D standard. Because there is no change in LOS at any of the intersections after project trips are added to the traffic volumes, and because none of the intersections operate at an unacceptable LOS, no project specific mitigation is proposed. The City of Renton does require a general transportation mitigation fee for developments within the City limits. These fees are calculated based on the number of new daily trips generated by a project. Currently, the fee is $75.00 per average daily trip. The total number of new daily trips generated by the proposed project is 596. Based on ITE Trip Generation rates, the total number of daily trips generated by the proposed project is 732. However,the existing land use generates 136 average daily trips, so the number of new trips is 596. Tables 4 and 5 show the existing and proposed average daily trip numbers. The existing trip counts are included in Appendix B. Table 4 Existing Site Daily Trip Generation Date Trips 07/09/02 209 07/10/02 196 07/11/02 209 07/12/02 109 07/13/02 17 07/14/02 20 07/15/02 194 it Daily Average 136 - March 28, 2002 17 Barbee Mill Property Traffic Impact Analysis Table 5 Proposed Project -- Daily Trip Generation Vehicle Vehicle Trip Trips Generation Rate Generated No. of ITE Land Use Units Units LUC2 Daily Daily RESIDENTIAL (Duplexes and Townhomes) Weekday Trip Generation 112 DU 230 6.40 717 Saturday Trip Generation 112 DU 230 7.44 833 Sunday Trip Generation 112 DU 230 6.32 708 Average Daily Trip Generation 732 (1) DU = Dwelling Unit. (2) Institute of Transportation Engineers (ITE),Trip Generation Manual, 6th Edition, 1997 Land Use Code (LUC). Based on the 596 new weekday trips (732 minus 136),the transportation mitigation fee for the Barbee Mill Property Development would be $44,700. , March 28, 2002 18 Barbee Mill Property Traffic Impact Analysis SUMMARY This report documents the preliminary traffic impact analysis performed for the proposed Barbee Mill Property Development to be located in north Renton, Washington, along the shore of Lake Washington. This report documents existing traffic volumes and intersection channelization in the vicinity of the proposed development, estimated trip generation for the proposed development, and a level of service analysis for traffic impacts created by the proposed development. The development will be located on the Barbee Mill Property on Lake Washington Boulevard,just west of the NE 44th Street/I-405 interchange. The proposed development will consist of 24 townhomes and 88 residential duplex units. Existing a.m. and p.m.peak hour traffic counts were obtained at the four study intersections on Thursday, March 28, 2002. Traffic volumes on NE 44th Street between the two I-405 ramps are just under 1,100 and 600 vehicles per hour(vph) in the a.m. and p.m. peak hours, respectively. On Lake Washington Boulevard, traffic volumes are just over,800 and 400 vph in the a.m. and p.m. peak hours,respectively. The proposed residential development is expected to generate approximately 56 and 67 trips during the a.m. and p.m. peak hours, respectively. On a weekday, the development will generate approximately 717 vehicle weekday trips daily. To account for future growth in the City of Renton until the development is completed and expected to be fully occupied, an annual growth rate of two percent per year was applied to existing traffic counts, and pipeline traffic from recently and previously-approved development were added to the existing traffic counts. Forecasts were estimated for 2005. A level of service(LOS) analysis was performed at the four study intersections and the proposed driveway on Lake Washington Boulevard in 2005,with and without the proposed development trips, and for both the a.m. and p.m. peak hours. During the 2005 a.m.peak hour,the LOS ranges between LOS A and D at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system,none of the intersections change LOS. The proposed driveway on _ Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the a.m.peak hour. During the 2005 p.m. peak hour, the LOS ranges between LOS A and C at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS. The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the p.m. peak hour. Imo_ March 28, 2002 19 Barbee Mill Property Traffic Impact Analysis The City of Renton does not have a LOS standard at intersections; however, in urban areas, many jurisdictions implement a LOS D standard. Because there is no change in LOS at any of the intersections after project trips are added to the traffic volumes, and because none of the intersections operate at an unacceptable LOS,no project specific mitigation is proposed. A total of 596 new daily project trips will be generated by the proposed project. These trips would be subject to the City of Renton general traffic mitigation fees of$75.00 per trip. r- March 28, 2002 20 Barbee Mill Property Traffic Impact Analysis APPENDIX A-LOS CALCULATIONS li March 28, 2002 21 Barbee Mill Property Traffic Impact Analysis ; 1 13 2005 A. M . Peak Hour LOS Calculations 1--- Without Project • LT) LL:j r 1: N 36th St& Lake Washington Blvd 2005 No Action i,n Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak -► i' 4..- '\ t t `► j d fl ".,xa x,.,.r';+sc _ :t+j; t'r �"'"k.. - ,•�`,, - • _'=e;a. -ci:z.. .T„�,,� - �t', .y s r. r_, lane. ro . . .�w {, . s�;0 T h t3G�! ;L1 a, ;/ 41i11 A. :4" :: 4. f>" ,a. 1 5 :3' e, . 6;. Lane Configurations 4. - :x^ "`,G'::9,'l�u�'"t�`Y»^'"', .'.'�f.k.• _ ^^:,=Ny;" „,..„.„.„.„..,,,...L.,,,.,,,...,,.,..,,„„„„ '-rg'F'�.:pi•.c-.-,ims-,.s••. ..y�..j,....,. .....}:�;z-„nqr=r-�;�, I tl l"gri�,yT��, �/►�7n+»[7.� `t.•::�:°•3�r:n 9QUE< .1 00146190Q. .4 90r., a 0(�_'F�s. : 9U0•.2: 4 �..,:, Q n fQt l(� �w- ><•e. •ra i-.7.��v,l.ar"'i'L.'� ^ 3-Is.N+3.T�3,n•F..:,+ $�:c�}4+'.,�'�.sr,.,.�df:L.eA:. '4�< ,r. �!'+.�' ib J.+L�.4, �� Nt.+�FO•-! ti'}}�.O��Y;:,.7�g� • Turning Speed(mph) 15 9 15 9 15 9 15 9 �;urnin iz7"':.,ed ,•.;G,^ ',zrnRS'=§M,d' >5;5, -,•,.;�.:.,�.,,. jxr,W.•+x i,,,, ,,,,tv* •.a,.,,� ler.w„ 4 ref €{ : ;,` +.der, ;,�,. ,a '', �.. i,�T �:..� y:. .r l, L, �ile�:.l`I^tif a; „--. .,�: „ h;.dK,,.•, (..;:.,.., ,�,i`s .,t,..dp, : ,,t, 5, t,,,.„ T. ,,,,,,.„Wit �., t4 ..',<:,. .�..�+�.,a,. �r...._._ 1.,t.��.�..t..��,k�_ ....� �Aa�,,.�._��:f�:�:u�.�.� �� .Q��s_R��r t�� ' .� J � �s„�: ��.�_.,N:��z,��:�.:f�,u� ��t�.. �- a Frt 0.955 0.870 0.998 .„3..,c..-,^,rpc^.,nyt.,_ ;v,,,e'.e':'".,,,r`/� '`?n ;a Pi<; ::l^`'sw7:l'."" ;:i:' YkVk ""�.'w:-.p'+ •L;.'r,.s.,..r•»..v..aM1 ;�;'i�,�^,,. .y-... i l; �(�/.F%`i wtt)tie,. S''{"igapr/�y x 4�i:,? r•r,ra4!;p' _ i ,j'zi''"'R'-"�"`r'r•' ,,tv r, `r`-iI�- f )g:,l ':te `''�,F' 4.a.x 4,1 2144 1 ft> r61 eU),s,0-4Slt.'i L.us �.4;4: i.V e�F2,di-,::YN13 +:.ti<�} c k+'�r"4': - ...4,,: ✓"R? v' �.;.1"i"a.e. -• 4"'t,,,,,gr,,...7}n, +; /,Q .'yak' 1 { �W - +�i,'`r:,hjtc•r:4.•..,,��._T� ::n:;V.�..1J1,-is3i.=';s:.rahcc�'�:G.supu...,.�s�.-�,)f.=,'��t:,_:.erf`,ure7ef.:itxu,..st�'3�s.w,t`'G'<cv:Ztdtu.....r".7.�i�w� s Satd. Flow(prot) 0 1750 0 0 1621 0 0 1839 0 0 1852 0 » ::��- :N•t�ra.z -i.:rr S. »er.r- t` ma. ^'•r ;;;ram rr :r, SIN f. 03,`� `r'a{" .. „_' •e:/�..9QA-:?r 'rf .k '^•r,: t�r�".s,s,*t"t•r-7„a„0.0s ta;:, 41)...1 .4. `r'`i.'"Nau`J 3''ri '<`r-.t ,.:4 '' h.��st..�,�hx-.:...r.�+._..�.FiL�"�S a, ..,,._•�„�-�,:.G;,.'X��...e+,.�.,.«•?t.:6._;,r�� '�C.xi�.sa�>w�-.r��ads.��,s�:.:rhsg?C�.,��tiits-� s�.•^.x��r,`�t'crs..�.-lt�.��,��s.�ohfiG.�.;'� Satd. Flow(perm) 0 1750 0 0 1621 0 _0 1839 0 0 1852 0 -, r•jn•raj,x•r., �ipn;r. �Fsi4f.. �.. q .,a. �y5 t`9e%'�',.E'"-�`` ».�y:��tt y�/.�'e,T-y�y.�,�•_� �e,�,.. ,�:. t la. 'kR. �} r if ;+61. tir '.b_, �lt.:;..�M.,,`V l/r`.,'.+, ry(�� k �{�(�i-x I" 1. ;b �}+^� i *�....a: z 14?: '�r. x ;S•,`ii.4t,*' K.^<141',-,....,..,. ttiA.u.....4,,., ' .,atYolY.. . t..vT+..@ II +s.c.o.tit zrr � ,un..:.,r rcn,:�•r-'•' i' 1Y^ 7 "1rtfY...j.... }l.Y�f� � �9��'r�.�" �l1 L Z+t� �.[a 'RS ,r� R t u �nr' ��}.�Orj M � Q� !7. ,�nt D:•:e r 4ii � t i K �� Link Speed(mph) 30 30L, 25 25 {s•x' '�•i^v.'+.;+i=.: S .! 'S'�r ��„c 2 '.'t+4.' ,g" ;;x s<n,�t'.; �a�' +s 1 _.._..,. _.,.F: ic� , +<i...c•n+, s �p,..v.,ny,�g••4,*y �111 ..r i$Ca- 4,! k ' 3. . '-""'',-;a+m-v' it'''I '�P-1732S it°'s''.�"" ':i'° `y(;"`''k",a Q? •;r't'rrx""'f iT ,'W l/Ni 1 'Y anti L...h.; a4atje.-.t,;;o-:.u{.�1•., ,K,s�afc....s a,:.LSz, ,_.:r a ,�4,.t `� >v� ..v: 3•� +f �_ .. ..t., � ;v ,s�'�.�i^'� .�: .Lw. »t,..Sr�c,'ur..azxL>.:xs3.�:.; .+rz ,r.�.w.at,:.u.�.;f$i Travel Time(s)iigil30.0 30,0 36.0 36.0 L-, ,� , i�r :J7a "r r;• 3r� '; :iy 4T,�LM'`�'"ry {`; .2t�.,,,,,,•,,,E.w.?rf, -,.. ,,R,-_,, , ^,7,..., '"'�t . "T.'"mot"",4-ir r 's: ,+71.. `re`s".. -3 x .�r'��..T!.S� S.�y'ifi:7R,�.�swr '>.::��'tf.�;`da.:.,�.1.�..-,:.•.44•.,.�1"rr:.sr�'��5;„�,.�,�'�'"...,ic`�•,:n��r:•".,r ,£':8�c�1�ivsa„�f,.dr�wz��ts'��`�u�K,'�t�'ihn , Peak Hour Factor 0.40 0.40 0.40 0.87 0.87 0.87 0.88 0.88 0.88 0.69 0.69 0.69 R•xr,a ..v�.. °.Y;'�'.4^R .n, f.S „r,:a ^'t.„„,x,�tn f rF. ---=-s40.js mF. rmr*,: j,;� ,f`'i 1., �,''/?f"-�,�,.-.1 0-,-,. �_'`,o., 4. 0 w.r"X;5'.'f0,r+,u-•,fit',.,oj'7G^''+a`,, •.O' '•';, O':rya •,;,..' 9 :. iv p : =i?; jP, ^ .." .w,s...,:..' �;t°,`: •v,4., gyp-- �h4�a7yJ,.eitafe, "'�t.4^!l.:`rc;"tt sil,:�.,.24: firt;,i'i�.fj�4i; P',24 4 ,07 .r,_, .- '+w1., :9 N ,k,,Or t 'f'i��0.�';i:`�4,-, fj..�.--,-.. 43/4 S w 7.,w. ::.�, x x:�,aar".Y.;;,X! :i�:Y.dr-, ..,,:1> �,.„ $i s.., w'-�%. � �4i b�,a sS..F�as.-.;.� ._.� YS)a��.•�£+=s��zS�:.$: ."r�.._..en Adj. Flow(vph) 15 15 15 0 7 202 7 533 7 23 177 0 wdj.;;cFl x, ..•{q�.-li. ,,i�..r:. :r•,.r•;;a r""•:,,, "iY p, =•,,,„:•;.,.x».i.F .,.f;rFfi's, m:C,. - „--,'f• i-,:, ..�+tn =,<R ''i; ^,4-efax,,7 r.rr'x.A ;L?ss;t,� _y a, .,rt?»:' ;x. w:z,�t.�?:' ix,.,,,=r.%s l -'t. a lf3,i 'c. , 'r ioi . r ,{^ •f:...,,.;, ,v-.i .m..r': 'i �e,>3.�?Cq�u.P,��o�l.<(?�?t�:?�::�C��t�:fls:.,.., �,��"'�5.. �_7... Qom.., r; �r,209a>�'.��' 0.� �A.�•,. _54:�s n ' �(��:ru;�:�r�z0:,v.;�.-b. 0 i'�%a:�fa�w:s`•. .,...`::,.a`. '4��: ;z.� �.;ni, � g.�'3. s::.3,;a.x..0 ' "z,,.;,cii' an•f.�� :�..5 U �a<v. � �' Sign Control Stop Stop Stop Stop tip -m.. r.;'�;:' �;'e'.eu mom.+:,;* ,,. " a;,,,,.. ."J,. '•,„', „ , ',,w,.,n';szv"tc ' ' •,,,,,n wrepr':Aoyy,-- ag,4±'=�<` ;jam>y..>, :740: ,�-'1w:u- ., lQ,.+itJIJPa TIWW.wW4, r�F.,J;y:a,-,0 q.,,',*4,1.te r'; g,:,1 v,...{Frrrs.es#•iz'm': ;o:k,-Ag 1*.k-,,,eakc,,. 4£::'•, ...., ..` '�.' ,��..•'ti''Aw''u�� ' _ Area Type: Other ,. x •:r' ;>tz ±6ti,,,fi;�:t �v.:4,: -snY{ egx' n;„•,ewrn7;xr;' r „xr„�Acy "smy,.. S7v,�.2�� .t,' t t�"-;y , 4� '. K4 r«,�`'�: .v •r:� �da? . 4k�� p.E<xa , Twa:aL 1znh�,3ntC0.l•"� ,. YP<, .-a, !,5. �,:4l,.,.,..:u-z-.r.' x>.,�:? ..:}x�nw0..b.• ;.;xiaaY , rI.. X.n ,7'.-+.3a:�6 , F Intersection Capacity Utilization 53.3% ICU Level of Service A Z. 1' I lib 1 l • I .� U LI 11 Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/20021, BVL Page 1 4==>> HDRENGLVL7-FF51 ' 1: N 36th St & Lake Washington Blvd 2005 No Action •, Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak ,s:rrxc,m,.. - ;c+� ,;�.z;,;_ -rn.:n:: sml '" ,t t- •etc',;r•� in.� :''-t. 7'" .--}:.a'a--." "'-t- e4��i [klovrt�t1 � :� BLr:- >.I BT; :>:fr$R 11fi1r_ 18 :,.>:,1N,6R;. . TBCn >Tu,..,;-.NB._ >��'_.&�,;�lT,rcS - Lane Configurations < _ 4. .,•;_'�: •,<�•,, ,_t_...,� •---.` '::�,a. r-u,•�:K t n.:t^-r, v,r.; <'•€+'C :t>;7,aFvt^ ar.-, ..: f.' r.Fr•`1' xar" -:jai:.;y r=yr'�,,giri,-;.��T,(.�.;ve^v. ;R._�^, crt . f .u - :2- r. ".•°4: y+',.y.,-. r1.4.:,o.°`'J r.," }' -.:.z;,; ,"?t.„}.,a, .k- =,..r. •&i. },jihr3•<.:r,:=K. {1 .d."PM.•.f„, .rs'r 'rsr 'r•^ .0,tu 'I r3^-,ss tx�t^.+�r vp.Rt�;'o.�r iR�p. �'.,t�� ,h..4��,'F ^,,rwe1';%7 :,S"�YO .�1 fi,�.v�,•.ttdr: l:.0+, r<>�F''St7t0 F.,`Y .,?t,- ;.'�:,' `'-'t L' f�',+4w „�.+•:,t. SIg11:�.Eofltr;Artr3vx �"� � �,��: ,:;�� ,rl?.,. ;�:.q<`�, ,.,a�• Fx.`�..��.._:rr:.�� :rr�m,...�c;•,r.,,L•.>rr_.;�3:�.. 1?~?;�',r,F�,,s�„�3�s�.r.�.s a�c�,'xx4'�,,.,.P.�:�>,a�..x.�., ut� »_7t:.•.°L-)il'S �:3•.. # ��v':yS4,,••'lY. p�� Volume(veh/h) 6 r 6 6 0 6 176 6 469 6 16 122 0 -"'l,YN:.. ;x,+A�"'F�-r ";'f3t•`P.'7•R.: _ >••rt7•lp.:. .1`. +,2,a +.,7.m xy�.,_ .,,n•, _ -.,t,,...,�.`�{ro%-r,.. v{+,t`• k:AM "'[j."• ,RY,` :a�^4{"•�t�;"r.'y:";T.-.�... ".4..y.,:aw.<. �'i^,<'..:V :�' V:•1+. V:' Oot- •=.O•,..;• ±Z'1e:{: �• �.,a;'^ OrIJR1X,2 v 1 I i P,eak; jo�r_�>ua�tor. = ,,;�'u::�d0a�$� d ,� �� `�... ,�:D��,rt��,Q:87;�� vQ:E3$ b8$-� t M(,��i�Q pr�g..r.�,w=0,�9: d 'o� u 7::.�I'.Pa=F.e, :x a u-ri3 .l_.f.,�. :,:s:aa>.F.,. �•d,.s"S. ...:--�: J.e 't<e'$v3r..,...r d:;e•,�.L�.:>.a,•sn:..ra8<at•...,..,w��..�.ls..�a,.sw�,^.i..:'1� ki:�k�a:,.u:.4� Hourly flow rate(veh/h) 15 15 15 0 7 202 7 533 7 23 177 0 ,.,w..,,�,,,�,..,-..—..-,•;..a;•>r �.,n ;,•r.;rj':^•n, a--r.-^p< •xr*-" .,?;ip`%' � ;.�,*t +t;r"i'rx;.b1 gi,air .0 Y�''S:E;b P:' E "p,@;',^:''s- p +��OT .W. �y �"q'-,v;,Da?tr`'(�. r k,?�r,•�F,"�;A' ',v�; _ a�� '•" ''.•"�.tv �y, Tom' 1 4LIA:5i4b1,��1':tet,.:�a�„�s. }yes,'y.{}':{SE:""At.;:�V?,�I;!;c',%7,�D,�F",�f,7�t',5�.';4dIV,.�.�?�.'''°�iA ?;�isw3?it9,...Y...."I:t,:�:'�`ifi,,h_:t,G�;;"� t#x.."� n9.°.�'i'+.t� �°h`�.c><.:5:'ab:;s�tvk�.'`3+,,�r�•'.,i 'Yr*ru`� Volume Total(vph) 45 209 547 200!VO - ;�,EF - ,'�. [ ros2 l F1r .v�....�cr;..Ntip� iUr ry�.4 23x �.m �iW 1 �ii~ "� i#'4F✓,.;.G,.,f.. � wee(J4afz:.-F.' .)4• ::;77."i`s5,0 ri-� 74 z, ..,,,b ..,. ,5-' :ivScr,-,1c4Y=_ ..,. n vE,ii ;,,...a1.•.,maa. ?�J;.:�m.:r _..:{n.�c�fa,,ut ..,1a.,n„ ,,.....ra.s : r •Y;^,t r"a:.4. r<i::.r &.;:t'Sr ` i,a Volume Right(vph) 15 202 7 0 fi1 �t 6121`A-7—Z l0 Q R T a0 N LE w :F R gil, IN eER Er : Departure Headway(s) 5.9 5.2 4.9 5.3 .d e-.a,^ .,,r;.,r,,;FJ .+n. rr,nax.. -�r:ai _•.g,r�•;y-..S-.._r,,,., ^.:�x'ti•.-,..?r;z}-• :`t-,._7 n � ��,.-�yy,m;:::.,;i.,.a-,,Y'(,1=i;.:�'s...,;,i,.bF'. Yx`'�'6'�^..=: "% ,.5�'.:•�'', C;. .•� .J 4 r-s 3+ -°`'kq..�,Y��x`r.3::,cr.;..f,�:VY. cs>n.: �vg.r, y:( rsr- 'ry• ,{U:P:'r<v r!>. . {'S.� t s..a!'-n,"-Y'.'"•z,,.. :1"'.t.. -:,t „p,ER ME- xta,,b'*a':a -a„' �egree;'kl�i�ato� ,x T.,,•,� r�pr�,"7� �p�4, b�`��'r �=�� ':� �.a.,._fr'; ��_' ��f��:��; �.•��.J.(, - 1; ✓Sari #.a1:FL�1::,,Y.'s"/. wi.�,4�:S�:.a.,u t:2.ti ',fir" �...3u:1£ma's.y'.C�J)itr.`:' ':4.. i'IJ. s Ll:�r Fsr�`.»,at'j o-w•v......11'eb...ti-hA'i::...t�+�'L:+xea.�[�.,t44 .Y Capacity(veh/h) 526 627 717 638 s'n+a,,,-r: ••� s�irr- ..t.» -'=,u„ :r^,.,m'.. ?.,--a..x::^"-3::,•y•,^,;r;";ATM .'�"a>s:m-' ^:'?;�,,rr•-.r,..�,,,.•'.z,*,r, n�...'�+"t;c':nr.�t.F.rrf,ii °f r+i�=`x'.+vaa r?-u<�.j•'�r:'.P' .r!, ..r.,':c'.""t+'4O7 v.'3,•f"•• < <'�"iYR�.;ri?...'�'c;.-?:a t 5,,. ''.m,l':5`r" ,o: �Y'•?r. •.:F.e+'..3 , L;a:ssi:i aYf'?`:..f a+', ri§'5K ...,3 may.. ",� r. 1 • ,..`n,,,. ,: q-',.'p;,_/,� 7: /� _Y�:;s:n�'?.•'... c ..,+,ry.� ,! .,,Y. ��1.'�+:'P-`;,...tl..y' v-A....' r,,,,..;ur . , .a• ..a:•.Y . I'llr�l� °r�y/a,�t'+i�"Ya�,`,};,.-.r:.,3,a•. ,/�::i',>Y .,�U�.�..`7`rt;'GO:'Y��:_'ki?�.�Se �.'%i.!:'Y:'Y:�'"�"�{d'�f,;�:.�'efn':4"i3 "?r..'ti.v",w -4.� S J 'F'�''�i �.� _: .: u�a' `"t ,...,,,.a.,e7.��ev.�.+n,><......•e.,%„�_.s .,. ..,, ea.,t,.c5 ui..+..�.,+rr.n.. �-w+.i' .. ,», �' �, ?.fiC.:,��;,x.,.,,L:r�•c.�.,nw.hr?.. }.N:��A',a, -.r„+f:' ,..,dx�.v '+5.iat... Approach Delay(s) 9.4 10.4 20.6 10.5 $._x m...rare. :4ic ^r„s .,:ar,' °ucr•'+'3tlrr" s:r'^"fray' r'.�,,a�Es'tioi',�,-,;1..,;z�«+c'T,';�,'�;",t:;i�if&Sr.'r,N.;e'tF;;�.F.}'y9:.. .;r�. .h, '.2,,;�0 1 r' .t` ?"eY -.s. 'CSF:..- Y:y:yr .`.`-st i.L. ;'%•:!,i::.n ..S•%�r-,f.,-.�•., :?:,. ? .,,{;. ;Ft°: Y: �y. �y .t.e •1�-�:�,.q a,. ..z;.,_5:•, �y.,�}�,_r.,;k` rt-. a 3;• ,�,�f�, ��+ ✓. 5^b t�=£^i, `a�M'! '.'.t:Y.,. aYi'-.<3+• . : .7?";.._ ;.,b. ;Y,?'•, ..L =d�7i'..p. j „17.rs�..A�d A raac �5:.;;-' ::_.�,��:.�., ��!�,: ..�>w .::�C;�r. �n:.'::� ,i �.,-. . .,,.,, a 2 ;� �":';�' .� •° �„y +,� [."��w....x��_.._ :....... :t:.tr. ..t:' ti:u �i.'L� �;.'Fd:.i>,:�:F- FtS:.`-'ti: t:4L::•.,»...:it.'.Y'i.t•.>y)ixE7/SJu., 0"n�.'ii:..3.�!,::.Ws.•L:v..ucV:X,...ss....t....n.,<�:..,.t...G.V..N. �� '^Te ;','p.;i'l:+- ^.'S. ,t ,"_Y"VJt L.l!:R•i,'...... .•=�+,,��n,;'M':;C:l"cir•�i`�"•#•SF:'a4 a'"'X.w"••. w��•7'.'".•. :�• ^��.` \Qi`;':Y' .T "Ft. "-yr'�.,.lY�:nw-'-"%''x,Ss, ...fir:'{K..F=::a, i� i.•.5,."'A'•F,i;« . ,:;y"" M%•.. }S{. ;37,T, ,i >;5;:s+"*•&X.,;?.x.�'{ [°�i £ 1.. L' 7, _y ;,,- ,. %.:s. jEf f l. k B;- w,'� ,_ �, : : 'rAl "k e.:�.i �� t,ort � `a,,ku'.., x,+,.=,✓J,,�•s;irq;�.�i'raf:.f;.•u..^.-""'=:.:c;Tr.S: "<i�„=.. 'gn,?Y,"^�"xl°n�,e�'=;:.,:�:k:a-r r�r;:rs:�;:'�k°xe,+"�... ,S?iz:#4FE'.,t�.f, -fix`Lt: x,.' .:r:" -*eg -aa rg. t..7,.c _3' ,nr `%'.". ..iv`r :.t 7.r�`h�;.::.'. ^'�Lv ;ji"i ,-F' `vr.Y r K3;'1't r< ".'•i'-!' .,,a ,y"k'cr•'C'-LSk..�.c..'�vA:3,".n >,. ro ,.fir- :�': ,,�,�i. `., ..�,. w a 'I` ra?.::r-.-r'.iQ ,.•J�'` rA,-:s': �<i''�`�'.�D X "^av,...,asr,.-.> `='=,t_xearf.a�ly.,,,,,a-Ma<:a,,,,,, ,.-? : .,,,r�'i .4%: ,,,�,:a":..<4 .`"�?cz ..,U,A�:ailari"' ,....r ., k:.: rz:t, .,.^,ar .•``Ll.•�,, tn,��i.�Cly:.,,i�'"'�r�.�t't�"Ttv'.�.�sr#:�r:7<8�:;�0'�:'•:eeE"�t.:>+u��;r'�fri.,y.?+Xz.�i..��e�:tiaw^"rT`da�zu.o�:?`j:ECa''9��`:...'"`�if,�.- T�'::`¢�:u",•,�..�-h.�"xFM>1 �uaio' .M,^e....,_�,4.�:�..,,:a::7".d�:.k+�"4',s:ito?r3t..,�. .:...«,.:r.°�..f15...rv.la�k.Cre_..3m„ HCM Level of Service C �."-'lv •r2xtx!..V'M r^ - i"'�1:.1..:,,_.�.,..-r Y.:�Y.::'m".i;; .C,:.I:rvj�-.Y:i'� %S;:'.ST+fin...•- ...1?'-afr�e�:y�..':Y`;L..t£.�=fi'i if;yi."'..,^ii�:ti t`-� _1 Y 'i`r�"En�ry �'C•vt SYF-'1"` _ .�^-r "..cv,.+ rr:h. ",'it.; :�y:�-' 'Fr' �Mrnu:gf�;rN -.1.• rrid:=j:.�:°5. 1 r; ;{�' ,;:�s'.a- `^t.N:,wy;i`y �•,l», s.F�:.,�;:.y4i;`ram,.Yv;;_°;,:,,1L-: ,f. ^*i ion'. a a'i :titiiiz 4i'xn>•t,az=" 5 $Ia.a e< G;(7..Lev ;of$erv'ice=....,.,. Ae, .::• .< .,._,:.. z:, Ih�tersec�.�>,.,,-.�.,.�:,�.�.��!.:..�,.�,.��.4.:.,v._.,....,...r-�'r.�:�� ,,.�.."._,..�::�:.:._�h._s�..=...,...p>t.,.._<...�,W,..,_,.,.,�.��...,.':�;..,,..w•....•>_:,......��...s...<s�::,��.... „_.,,.�„ ,a • if )1 i't11 t' >l 0 del . ,' " I l ! r � `w._.r Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 .- BVL Page 2 HDRENGLVL7-FF51 'u.D 2: Lake Washington Blvd & Ripley Lane 2005 No ActionLI Barbee Mill Property#11735-001-002 Timing Plan:AM Peak _ ~ 4.. \* e' �r:rt%a�y` 7;" ,!" :rrs.4:,': ^s.'»c'"LC^` D '.�F""F; .i�,q' -".Ftx^'�e;<:. •'n"�^Y nsi>=r4. i,o.:,. ,"sv^,^. J�'.'"P .J.T`� ,:�:++'•�;� �. 7 K,,,. :pv'2't; ya' f'=:i!F: �+p c.'-€'` p:.F,:T !, m" Z'-ro:ti>;. ,i� .xt T'1E ? r f rn 7: '/f h �{�' ',+'�' ;-.,�'r�,'.�*_.�{. r..d'� 17T.1„4 �:,aS°6's>.v,�t�,'�.A�kaa7>4�:re. °� l 4"rnsf"�"d`"'$�,�� :ie!#,�'•'" ,,��r� .w,;"�'t�'' �4.'.�,,,•,:,;'>.�'�,•',�a�u..?�?•'Say' ;,„*e�s;:;� ri+.e ��."*�.'Mt'+. ri.�.�r�i�5�1�.F..,+t. ..F.,let., :":u7 O•,�,� �.ii..•n",,r} rS..��,i�,r t: ,a '1n+.�`" :[:S�,iw,,,'. }e5s.' r-i' c: z's:,' Lane Configurations "i 4 y.,pY •:.ris»�sl„•+v..< ::t<;,•, xc*':t.,. .ter, - - '.�. �.'S:r•�tr•. _y,- �^�fi�;.>y:,•rt.�,1,.r.F,..�r.-,,,��.�. ,K.r.4 y,�i � 4�{�,• ;�,e,.,.::tryri,. .�*m'. s, s,=: ..sr.,a I e "c N N s'^ '§ t , W y" Al •': ;fit '{dgal'�:!';ut� �4�;.'�<�t,''rr:�:• 1•;�0`�;'1900. �`��Ob' .�''1K9Q0��-��11;9i�0��. 1�9,00,.'��,;.k.�t-�'�a-t;�+r-�' �6,,r.:>v; ?s.'-•� tir��.e.�:��'':, , E�v7,�ac��..F.�7.w,r'��a.�'u�,...S.R.r.S,._. �'�"is�i'.'_ �..t ,..,....+.a,.n.. e.., .'� .v .,tifn..:(n .. +1.+.,.3.a2.,... ..:..x:;'.._ �$,.S!:..>� :>;w�. '37....5�;,,sv' &,"'. �71, Storage Length(ft) 200 �0 0 0 p..n,,.. �14':}WSC, ,S .x�'-n:•;t.A,Kv,"c. ,,..r v`M s��".":T':r •yat'i'f"`. '>.Y.7•`.HA,�;.,,:�it;P.t' S..; ,::Y•4^r<n, r_'it.'•ta"eft; °?N.Y`>`�'a =i:r% ..R;•"tifxrr7:?iAi .�?" .s�y�.�..,..s. 7��"L�'• >t, ��,:�'+7+: vi;"'� £i�"a:'SF?, :i �F� :'i;, �vry� ,,SJI "4; V;:e: ie �F.. Li�-F.�;.s,i.,, t. ?.L,;,jr, ...R. ifi .�'�7}'r"C",. ,¢,F R, �`4;'',7'��_r7f � f r.. ,i :�, , ,..Y x eq. �. '':Nr' 't�. Z'• <" �{{ T, x�^'•. "r�`7,,I' k. ,.,1 !^�i;�i.'�^^.�'.'4eP.�uF`i"il4`y, ;w:,�}��,5i:•:S`' `��i'.w,"'�,lie�,�:,.,}�,pp5�`„riS:<''i,�f,;C��31+r..t'O.af".i:.��i:{:�1'rs �n�C'Jy;""+. •i.yr, 'x,""�. ,07 YT�.�.b�e �y,�">.4, cS"mx�. .3 r, Sde.- >�. �'d+.�r4,�'..�sfa ro wi .��k ,: xF.i. k $" �'eb> :a,i,:%,fd`.: ti'<r>.'..:�Lr>• "�zs>+. 'nr?Y:'�..'i;hs .,'�`...�t Fi�,,3;,�', .I.d?.w.sN.,±r_ �..u7€�•C1 Turning Speed(mph) 15 9 15 9 �w.s'En. - •rarr .., :�.,; :1;,u -'>t�.j-^l:_ "�','7s.1._ "q.>. St" -a�'+`i.;';>'. ..trwdR' '82'?1S'.. `;di?rti ..^iSsu�7:,t%r:.'.�F, �.y^^4P1'." vF, :Hfi."',.�.. .�' =•..�:r; ;`fi'F=. ;..c: .t >e�a ,�r, ,.;�' ;f;:rr,.'��},`'"'::+�+ .h,rs��,• •=zT'•.,,.r.;-..,,�r'4� �'�r. 'd 5 �.. .s,r„c`)! nd;:#il".FERFASu= : �IAA. :-n0 , MIVEM s:z 1.�tl :? =.�F A , _N.� . • �t`� k ;� ,-fO �,t. s:M, :tr}, S:��_� ..u...•Yuji.�.„k..•.r,.+..w,.w„�i.�t.-aY-s.wl'.s.�` o. tLii:J.•4? 5.: Y.,,✓.^ x �n.,b.: S.r•,tf�• R Frt 0.976 0.986 Lj s".,A,,:.. .i � �+h-•'-.maCy,••.� '^.in?dt'" ...t+... .y>i:"t�Y•f .3%J� 'c'r4fi; �y:..•y:(a,f;�J,' :�rz�`>'r Y`i7' .?'.:.3.,;xe wxr^...,�r s,,.: t ��pr,� ;'�!, 3/xS:, {!, r, r `.>�'• t 'y>z. ��yy��9�1 �;', �'r 2`; ^r'i�' .t,:^a: "«�?^;r,fi:';�F"��::�•n'�>`" ,'gt• 'ma'��° > lilt:'S1.lt}'et•`i,4.rC t'� e�;, x+�.f r, ff .ti •^,drc.a.� ,a r'dra AsI S�, M'i';'t'"�it a F'Yi;,,^a ': F" .$.;a• (•.y irtyri� y'r.. Jos% �x,>.,; t�Yflmi2hs7>�a.,.�.s!!'rA•.rvs,est�xr7t,.�`fr�ik's?t,�.xt.,w.u�4�a^r„r, .>�,vx�'+T`7:twrr`sn`« �i��¢t r !�r.. .>'";a+;y�>J:�Fe�;�.Y..�,sn.:`� ��Fl�.',:».F�rs�.'�;,,� u' ,:3.e:��i�'�3.�irt�.^.�`a4.r� i��dartk Satd. Flow(prot) 1770 1863 1701 0 1615 0 rgge^^e�= : '� ^A3 R �� OR� 5a "Ii '" q MAN d Satd.Flow (perm) 1770 1863 1701 0 1615 0 L, �, � 4.0 9N•r1 ..;.:.. 5.* M M V� V T O V ", I PrRwE��.�amESSI R Y,fir ii.S Link—Speed (mph) 25 25 25 1.0k g ata O MA r ' M IM; -$ � :.d ` "1vltvSYn �ifr I . g , WO R „ Travel Time(s) 36.0 7.9 36.0 .y.m»,s �.•:.y5;,r..nu;?.yr;-�"` "'"`}.' .'==K" H,F "'a i:E< +F7 '�?r1 xi'rx.'rurx 'F;.,.7«"{. 'r, .r;:�r P,,�a•^^.,.�.n .�r�`:>5-rp.,1..,. �,+.�?P, G.7 �jy� 'y .�y��t�r s S"�.t�:�+ ..,tr +p ,�,r, t r�j� .'y. j .`�y r:."°r,`"' ;Z 4r.�,_..,r °'AF ::'"`„" ''l�', �t,��'fjrr:fati•.fct,'4{.ka" :' r'`'^Y�.��'# •° +`1� F`' �/O�UrF1 ��'ie se��'.i)c��y�j'Y�$��\,��",PU�e'1!!L!�,'x'j .�`�°:T" /6) r:�I,(��F u`}'AN�{y5 W-{J�e��rSv$kI'�:;,. �y�� }.4" �.. YJI�irc��`axn�:.✓sl?,cv.'.,rtb`1:�:�i..aC�9A,3...un: G.J. �.13�.:•aF}' l,U�:lJ.le",.'�iGU:.dt ry!!•i-kn�`�` 51:'� `�a.L�t"Pn...m.. .t�W4tSR.+r.s.Jt>"'4�>�1 «'�:,1J �`k.r'� ,:�'�a`�'' .�.� Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 #. c r J" :pr•- �"..�;:r.�-ca d•^(c'T,3:.:.x t ^j=�."„'.`a�atm""`ctr,,f"°r<�n x,.rc.^:.'.c_� r >r}�;` P•�,�-• °c.v�2:<N;'c,? :.;��,�"^ a r;,. o `-o', '��f; _•a�.��::` o` .�y? :'�i.�... ��'�"�r..`��p�p �/ fin''' E •.J. /. ''y'S �=.��^'.A :Si` r W,�$ p r�a{.(�9 x r. s M ^M' 's'' i. 'f5zlir:-•,e F a &',„:: {'rZa'�.J"�`',vKcf�,'h1�'(,�i�,/0�.. Nt.;f�:..; �NlY'_F�L� `1:��./O ,'t} ,�,_.7;� '�'.*tr n'j1Y17/9�..` ,�I�k•�O,o,., rsix,,: g � 1. 'Fy�'d•�':s >,.�c..,.:.. t ..:i; a sa„-. r x j •k%k3;:a,.nr fl. -rtg.'r?:w:. yh '1'..�,:�5 >�i.,stiM�,3":.r ;.-��:; � :.•�,.",:w':. ':,Jx.,r..z. «��SF.'Yi:.a'k,"�"r:^..�4,cr::;;l�:i;5.�,,.:,eo. ,v�.k{c f..�. 3`.rA L, Adj. Flow(vph) 7 814 182 40 79 9 " w¢,arc., >ti:c➢.. ..rt s ""c,' ",T v ;"4•r,,:mr'+4:,t."c j�;):r x.,,. le,rzrwx,'c!,`,�:N,,arq ""rp'>.;::',s :t�i.w s.�..-,,�.;�:..p v:.d . '.y "r;,;g;�,g "=�X�=.'a c.'" try ?" .cw.t": :w,r;r" >i.r; »..J�: .. •°v ->-r .� .., r ..re£„d? �,.. ;.. ,...>:s,�'_.�., ,l tl!` �t M"1• '.`1 ,s ,7= =}R ,T.S''° �A�• I%t o,_ ,r$ f' •�M's� /�(^� �i� y� l y±k^ _:t:Y:Q :4r1,1„r,>,., ,,y.{N�",k.:-.t�"�•' rr >�'j..�.-r �:,��,>c�Y,�i,.5'r5"m,P�',+S`;;.raS.;;7':-,...��y� w,,.,:(sya 's{g' �(��r. t�_ ;^s�•`„r YS?r=•.r.£,'S'> ut ��.S:L�^.r'"Uu��P �F.:`i��Y�/'r'�,'�+�i,�.?ii>r;`u^•� a;::�.�'.':!?;�.:,:,.m.�.,� ;:°a�L"S>e>.:d,,.:r��»rraaS:u.Y..iC..iS sa4r•..:.,o,..,.,:w�.,A,.,t.>`tii':sr`Y..�i.,..-.a,,,.,#�`An,.,,..,»a�s':.4,e�r43'dL;"•`d'S4.�z�x3 Sign Control Free Free Stop 1!N 1+a lOIYV YrU 7W YKWr. d -V r.:#�2 MG4 TF TS µ : ,^ �fi m tW-a-: 3.A O s1:•�:.=r-T I Area Type: Other I M^D WO _sn . AAB:; UF E y z» IK VS5r Y ?I CSV YM Ktu I Intersection Capacity Utilization 56.1% ICU Level of Service A 1 1 1 r i it ti I i ' I 1 1 p Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 3 i��,, HDRENGLVL7-FF51 -- ' � � 2: Lake Washington Blvd 8 Ripley Lane 2005NuAction Barbee Mill Property#11735'OO1'O02 Timing Plan: AM Peak ! / / Lane Configurations � -_Hour Factor Pedestrians Walking Speed(ft/s) Right turn flare(veh) - � � � / � u Median storage � 0 ' r( RP � / °°capacity r~^'" 1347 47 816 � � Volume Total 7 814 222 88 NM Volume Volume,,Capacity Control Approach Del Oow Intersection Capacity Utilization 56.1% ICU Level of Service A r | , � i �-. u u i | | �] Y:\[LienauUBarbaeMi||Pmpe .ny0 Gynohm5 Report 8/27/2002 / 8VL Page HDRENGLVL7-FF51 `' . 3: Lake Washington Blvd & 1-405 SB Offramp 2005 No Action •,1 Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak --. Ni. _� '- t t `► 1 4 eftlil ^,. ..-,,, n ^'r4"v,+� ,"1+ Y,"Y S'iri:.._ F^ci,r- .•-��,V�^_ "-':°C.•'7.t:: •,'id'u _A"'K' 'n.t ,3TM � - L:�: r-. • <, ..r,:_ • - ••T - e ^T, • 13. . ., „L T� Vil_Ft_-1: :''RfR.,=,' v%' xs ,.. >,u'��p � p ,Alp o Q r�Q p �; �n=='� Labe .oup�,,��sfi.,,��s�: :>�.,zr,.��.a,•.'.;n,41..7.,5C=,E,?.r:s._ I.,k't�Fa7�_M;C7 t'�+3`:�'��,473,� >Y,-..,Yn..r`.��✓'�Y. f, {`1. �M.. ,.4�-,:i. . ,.,•L B:J!,.,.,,tiS....- Lane Configurations ", ) + 4' r .-.w„vl� W,p ;�,y... ,,t,.,. ..5:.y;:, •t,,:, - t y. '_uc. :t".r"".',*7<'":Y.,,,,.,,.,,,r•. !t ysr' #(`"�eaf Fla' �/r�t"j:: a �r 1800" 900 ;rsri`900' k.•` ('�U.:->,#'9,00`r-? 90Q',.,r:r.900 .:, ,..;, 1.9Q0:,i,-.-1-900, f`AOU• n.L.,D d 7•,.v...�wnw�:`�Wta��,bT,y`• :c'�ti:tlYt�'•.�.:,,a-•..,;'h:,c:�:,,,..a_,..,u:,,^,.,, d...<��.nt•,::.t7=:�`T+.. ,.K:,..-.v..�.., ,..�:.on ,.t:'?[Y�"�., sT a.'>!fir�.c'.,. �,•.t.ui.•.u, _•�.rJ:,'�„avi,rs.rL�'L,�.,.lo.:ua:• +, Storage Length(ft) 0 0 200 0 0 µ0 0 200 •.«ra4q+.;:.r'.-.u:, .,.-...;.,,;r c.:f^..� a::;,a_ .. - r,. ,:a.,r'�. a+:` ^t :_r:• r�,fA'caa.e _.rr•. ,r ..�',•, IL, .,Y ,: •' tF ,sr'k„.,1, ,,ln• ,.r; MT, ;';^�"7s' ?i' ,o-,fSY`;^`),. g'" "`a5.",w8 ^n�tr=?.. ,, .:u ,�.:v'"k3. `®" a .�tr,-,, ? - .f '''r ra' „ii, ."J.' r ,• xN e. ,:r,. ,, ;,,. ¢, /, .4 .rfk• fsi><%Mg ;i r^;i�;'3i .'>ar•y, St L `rT�Srr ,.`�, �,�:,�,:�^.;:0�-�,, :'f.:r "t.. ,:�s''Ou' .1�.:: �.�', J.O.. t.,�''0��`• .f� 0� .<�.�: A=.�?'�0 �1e,, Lp1 CR ,yf �<,-� ';Y•„n,af, f"� -, •vt,�+ p...:t : ,, > nt �7 .'3�.vt.,.. 5°f.'w"l:��ro,�.z:1_.. �,�r.-L,':.:1!...ig�:: •t�,•'Suc�.., .�•�r,+?i='``i.'4 �'I'.;r...e,Uic.r .., '�:�.,: .. G4-,rui3t*r.S'�'2.`2'•.••»�•✓ri,,.,1.4°Ss'�+,.a.,r:#..�u,,.x��{;�6�'a�x`'i��.a:: �� Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 �a„v.Ttilt'ra«. -r'.,,•,r.,',, RO.:'a_' "kc'<. - .9r. i.=`tze .:,�-,,rv:.�Y-,J^r: .s; T:w; v.,,,�: ''p ;;yy��":�: .,i• •'ia;;�s °.�'>: .rC• ?r.'ita '�Y w r`.t,, ,�:r .urSY•t�q �• @@ m 1'a>•;: ;8�',. _b;; p ,�.;t,. `� x.. r _.�,r.tn .�• aK ��'<lt::$ .t:y.R�.P e'a`"�:;"�!� t; F�, rt `^'2 9.�P..,•�•�.�}�:..,P,.e�45.r:b.t�',!,'; : ... r_:��..;-'.;i1i<.';I:.: ..e,l.;: '' . ...5t..• }',`';.;,,•.. ..J,., c.$ ..•,av,:wz7.:.,,:'r!ws..=�i^.�::kYY:�..>.r'�..xw1.'K..,b.,�:a,�,+r�'�Y�1..,s::`hk*,�.RuSF'y+; § L. Lane Util. Factor 1.00 1.00 1.00' 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 ��r. 't:•:t,: •r. ,.,i .4: ,y.�, --_y:i.« n:..9i w.r",.,t.:1'1' - R.; :a°. ..';K:rrar:+.�.T" ';':e' la jrl syr^,f y f..,:. "'-rzi.r ;rC�i;-�';�i. .'F,.,Y. fi�,,yy��"fi>,a..r ..t.;C"`3f'." �`;asi:iu.,y r,.�"F.. ..-,�, :.r.--.> .( .,ti,•<. .:"„se "�;^�•a��j, rj "jy' =.v''�,-iq n i'��.[.� /y�;�jC 5v.4y7 , ':'s•,1,;.,:.„z „ap<a.^- ,k` ,.A. , R:.4:::'.i 3'.M.. r..,% ..s ... - r.ry N .,...:1 Y.arl J�Y•!..tr agki.?N st t.,;>,.:...its,--kolt,,./:Q�JO In -,, ..fr 7 .a,t..,.,at: g�:,;,:?'t �v'099:X, ' ;,• .;>t> �inu�;. . ; � x : a7:.L:^i.��c:t".-- z$G6r-::iior„_t-�:s:Sl._'c-'z�x+ 9 ,.,...a,.. --�a.J,I!:x.; :rttdt','i�'.,i%•' _,..�,�.,,. �.y:, .>s-yid `'y'_i's:�-ris,:u,'}r-:hb''%.u�2:�i.��r-�,�r.1G.�✓}r_:.��""'..•'.r"r.}3�t:.3�:�x•;a• <<w..,.r Fit Protected 0.950 0.957 'M,rr' - .,,:,t:�4�` y,gJ.. .s,,,. •y('r{iR�.sa:wa;•+F jrs•;;• 'r.;.n..r,�'a•"�.;ru v',+=h:h:?t�.c` .r�"'4^' M,trN r^�r:z,,,J ,Y,tk ..,�;'4'Cle""'.. a ,t,l;::. <5;i: `u;` -g e,k, Y; 'a 7J=1 ,;, ' a, r, ,Sr•;; 5 t v 1.v`''_b� . .014-__,..Y t'.yr A 4. ,,�, Q i.#,.'......AL 4,.r; ,;r(:.i.S` '"1_7'l0; t:. 1,' 3:• s, `0 , • r}:a4.''S bay.. srz0`.. 4,X,I; l*: 'y s �.P..:r„u" :�S„c.u.,.,axxs Cr..:.��..,�Y:xn},wg�t,.,nwta: ..a�'F. �+�i.:'�7r, p.....1_ ,.Y 1.',.=F.�tst-a.�� .», ao>1�,�'r:�n.-�,St.�RL.,ahrr,�.�ia.fi_�..x,r,.'r�.v'«.rv��'>�.�,>.n..`.'3�,�„i.+„>wl,:'�,..r.,:x�`9a 3 Fit Permitted 0.950 _ 0.957 ..f:,_ 'r'H g}ar > <t'r .�::e-t>~•i;�w --,F:`_ ':y:,'f;Ser.<�-xd' :^5i`> �`5�;_ ".CJ3"". ArP:a:na,(',y,.Ch. •-ii,.-'+.51y"•r'd "'.". 7,." L (7i" R ;;f .*f3r.ra_-, q.ryrr ;r: . .r+;.G., -'ty,.,, :.r`•* v.,-,#",, ,y; .v "'s'�{; ,av,.�rP,,'i xY°".Y7,'''`... Sa Aw,r @ �i, D 7,7,A.$39,:M,. 0, .1 70' t ii:8 �.;;'• 4wr r'i0 yr GOx;' `' 5 t 1' -8 a'r7'�v....•wo�«JP,•i'3f•�5�:�dm�.$".�t.•.,,�t.erg.'•�.r["^lr:.f..,.,�ttttia-..,,r,.i,m,..,';:✓e�`• n`k;'r'r`.Prt,.ca�.,..S.,.F..l.�'Y,,:':.:'r,�3.�:d""a>ti,.. .-n;�3 i..rvS.h.7'c�w'x.,:A•...?2�'t+J'a: :u,�•�^`k '.�?:a>r.:.;±�..r«.e�,�U.r t- _- Right Turn on Red Yes Yes Yes Yes - ,�: - �:i9in r�� :.�4�e+v.';nx!c�°t>:1:?t".t,,.,x?,,,._„ra.,«•x,;ru.,<trK�,.,sF-sa, 'aF:tt iv.��. _,y,:,ui7.`�a':r ,tr,,�:�vF..z::Y".4�it�';a,'� ,rA' :-d'"*�+`�''/s;�:d"`'�"B't':t2=#w.i:�'T 'N x a ti tfYlr'. N,. ,.rp ,?,.t d -rc i e'?U, .41S_ ,; a',., w. rw ,M t:, afc ,¢ - {y �-v t d.�-CIS<'a T'�',v's 3. ,Fry:a�&`7?s3,z. >id��..w "!'f'c.+ .t2r�r+�, �'�...}::�i:r,.,k3.,:a.-`•s-.`t-•��'"'�'•.,,.:t:'�{.;fiS",•'","�.a,,�'`:r;:'h'-;?<,:Y s, �?.W -.{ .;i� q�'�,47x9.sz...;17�' Y��. �« ,:-. :),��,>�.�,. .<., t=�%�*,..•<..a,�rY,:u.;c'<.4''r..37:,t<.. ..u•>.v::,F.rc. .Ywf,�a:.c.,k.-.�',G�9_szr,.,a.v�,r t._...r.nxtt'e._.,,.x�:i5,•€�_x.:r'�-,,:';�'Iin''�.:a3:•:,�d'.'?i'L>tir....�§,,..A,>�L..�`,u`�.. Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1,00 1.00 L " �-'•.v:. :p'�' ;li•'P 's rs. .,y.... T�tC;,:^. .1 Mn •:;�5•. 7 ,n.�,, - P>•• P^tom:F�iir;. wd;43. „ ry \ ,iF�" y l,.x;�:..5s' ��ry�.r••,tyy'>i=, w�,py '-�.,i"- .A; ,,t."r7;! >y`�''^,',_��Fi'�-.. s„p�2�..t^`�J`r�s,Ya'"e°Jr:r,,'�� ,.&•;�i..`l ;� g., ,D „711jP :?a':i,,A.,i. ,•4 Ck:i^3: FAe.t,. 'i7,,":4,•J r:te3 + T, �`�:Si,Ay,.,:�'),t�x <}.s , <•n,' �•rnr,., ip t+ •, Ph H'.�•. ?"t ..: i., Ltri � eta. rt'l',,.F _.�:. t•`„�-�t`.�•,s:;�:, .<=25'r, .rr,.� ,��i•. ,n,�;�;,�r."�,,,f;., ��":,�. .,}.e�. �.z":,:4:,�Q •�., �,. •.��,��',,��.,`�,�.�. .�r'a�x;.,_s, _:..,.r,',5.!H M�mr l �is:.i;>:$::,s...•.;`,atae,.7r fir.�lx�.a.,,it�,<=,,. m.t.,.r. Ni.'r_„•rrn•,^:.,,.,:,,.at,..t,ti�.,..�.t'rr:^-::i.,:<!,'.e•"...,.7t.,.::wr,1.,5,aT...,..'�v..,z'>•�S;x'E,.,Y�r.JtecF..rL' a,a, S',v Link Distance(ft) 288 572 1320 1319 • ':'>:}.p AS`Y..q}Y ..y�.. x... .:!-•, - :3.i - o£.:. •TZsr., 'r'Ty:Gy'� ''k�. rIC?,i `<nY- �W.y'•r y'>a' '`,4.5., ;:`z:_ l '':,:` _Lya';,:±.:_ ,,;ti, .kth"r"�,', .'��;'. ..,$.-'o-"ir;-, �i. •:`fi .:4'tr.t.., -�- i*: a, 3fi;•- :§r ,.lr - %!. •c9 '.e:, A^ ,Pa •,cv i4•.'aV@ 1 .iy,$ r ,.j`� _�::_• .�,-;,'. t «„-,.�,_ a�;r":,„r•`�:J''r�ci�fa.�.,�:..:r,,.si,....�...•x•,....,.:�i;t,:.:�,. i .,',,,�,��,I�.l"��rW.,r7::l�:ic>.z:�:,a,..,....-,. >'�� `.rt,,,-...r�:, ., .�,�,�P.�:�, ;rft:,' -. �,. .,,. , ,�.a••, t Volume(vph) 0 732 14 377 77 0 �0 �0 0 48 6 72 • `^'•,T'.'•a':rtY... _'.�_x�-.. >.rr, k'-, ;.Y:'."'ix'" .vi:,,..;�... -`:_h<4re - -^'nr,-�gax?sl,;'._ s..�'e�.y�•y.-,N.. ,:'o,,y,�t.^,r- ,F,f'_ .;S:i-i^'x, •.:_ t'; G_.,a,.,' ' `.rev,. •:f:' Peak,:�r,•{our�F'ac ,:,w .>nt; .0:8'Lhl..,.0:82i"'�LUt 2'., ;�Q:9:3ri`;�"'Dp3`�< 093k;+:''�'09�, ,:0!',•,2, i� _>` � " ..,�� .J-._,S� .,du-y,��r°:Cc;sc,,1s::.miC:n•.t t .- . .,....aim.- •.. ..... .,,�«,.+".•-.4 �3..... :L'., .,�a'«..,. .,., ._ ... -&;,^,. _�.+:,_}�'s,...��.:,vra�,..'�,,,..'.:.��.•.�, ,a--. il Heavy Vehicles(%) 3% 3% 3% 2% 2% 2% 2% 2% 2% 3%� 3% 3% -- u-,re!, .pfs^< -nt-, ';w`•cr•::' 2S:' ^`;x"c=i';':r.'. rrx •zee:rF.s•"rSiY, ,--98t.?" .c7 r•, ,{-�..rg... ^-?c sr.' 4' <,°'Sri ;3c. �,�., .>-s„ .,a��, ,a.a• „J.. r,. ',�, x�•. .a�.`r'. .:y'+,,: .'a .�'.,',�i;: ,), 3 _,..,.r•, "i' -',Jae. ,s.r l.; ..rt,,.. ai:n"�'�_ ^,4 ':.•l,'t. ,.!J''^ .�+,.,o,::'rr..r:Va ,r-.,",. ,: .<t >.: r .r. ��.2 y4,1"1 N <'Sn z. r,(w v0„ .�''.�"s,-,3� .1 r,•• AIO ...i".J=''„,.3'.^eMr „ ..x:"-%'•,. -rs0,';u•:::,.1.:n' ,.::ar'ih0_..s,.,�rt$3Y;�.Aa �„� ,fd'+,. •4 � rl�.�S�.+a.:a��'1,:: w,�-�3=�Yt��y�:..�;,.';;�:ii'',Fi;nur.,<;,�"s:i'.'��'�.v .... ,<�!�r:r":t^:.f:-at ,,..,.,t:u;� .a:<.......•. •,:.!.v,,:b?.. ,:'xt+:U.r.-zs..'YF_:,r�,..,..,� _,:t<.t,.,.,.w>•...:t,.4-�kG, �,..r.-t�'x�:rw.u, �y Lane Group Flow(vph) 0 910 0 405 83 0 0 0 0 0 93 124 N -' ,ec ite �. -:7`.-7r k_i,. .'."}.'-,r�+r,:b :�.,:,.., :"n'^^,y.Fr:,'r.,.x'�'S„q.�.; d:_a,' :r-as�,'-.z-6c�1.-" ,<Ty'�"y-.":'aK;.:., "R,._, - ,r,;; ,.rt' ~•:?4; ','.'r•;�`rr�7� .r;zr.'%,•r.:ia:.:f,.�-n #r': - :'d`' ?r�:+c"_v^ "L c:,s, 1 tt'i<-• " , .'k >:Y,`r%+': sc& w.z ;trJ Jr +3:3. ^:k:t?f`j.:,< ,,.t ,.7 a;`sr S,e._..�, d' `.1-.„ ._ Ri: �11rE1�Tv`.('�8.`P,,[ ,dt: _<t'k:t`..t*.ti':' 7 .I' ,t, ,.+. ':t,�:t1PI'Ot�.,%!r'' >.. -•:r`;:'' "-Je> ::!'. !`��ja-.ehr P2fIT1:.. ',1:,1. P'�.., .:d`C.q.J.Lt C�.+1,�4._'�i`_",.":`::t>':.St,�i:.a?u£,y,.u:d C,��..^_,..:td'.`:"t S:i1�',. W,Dil;ry... ..'t y`G?�,.,...r.>•n..•`. ��e,-L4^'a.. a.21�...,_,r.t,..,.....+,..:i��',.i�i.r:.:,ASJ�....<,JL,.•,:•a�-....s?i.lM1"}`arh•,;,.,S4i,..r:w.,.>�:c'J'f!.?,..s .2u�t41..,..,n Protected Phases 4 3 w 8 6„ P@: ✓t2 y b ailk r f[ _ y I ,. i _s -i ci * a" wl : r. i' K ��s-a' t" �&��5J �{r r- r . M in imum,S plit(s) . 10.0 11.0 11,0 12.5 12.5 5 12.5.5 TQtaSp �» . ,tlt¢ Eg;, ;.-0J07A67;O : fiO E29O:r Bt Qas� ,O<U, ; "r0p,fei..0t, r g:SIN 4 ,r �0, 0 0 0 `) 00`)/0 0 0 ° Total Split(%) 0% 57% 0% 29% 86% 0% /0 0% 14/0 14/0 14/0 �>.i„•._^,R�""!+':,'.Ml�.Via:<::.•:r,-....,.v:^C .:,,:,4'..;.,.:.,:-,-'. - ::t'TS'.. - O'T•i�:Y-:.,r^?.:.::n ,tiT'��:1HJJ''i43;;�_.4'a:t•�I�'r'"` 'bfR�f;� �,�i?rkS F: "} ,r$;,L. .3. %.:; - '-t E,i.4 •,.,x M:.i:",`'. -r'K+r.. ...!!.>e. 1",el., ..A,..x=- vi4° �':'n. _��:'- ''4::0-`�":`mow ,.r., ..+,:�" 4, Y@II•w.Tim@..1/s`1 ;r•. a0. �� ;>.,.. '�� :..:.,".>v...=>�>�:•`_...r:;�:.�,.,.M:�:";�;�.��::.,-tsrak._�.v.._��....,r-:-,,. _Q,.._ so.,.`„[..q .:c,t,:il.:v,s............. . ...... .. ..._, _...n_...t.. - _ . .- . a,` ,L.;�' L... All-Red Time(s) 1.0 1.0 1.0 1.0 1.0 1.0 p - _ -' .:s•'+- JF:.•r<s. 5 L,vc,:�>5'i S"x'•T.-crv..�:r.,.2 i=4". .-.g, C_'.i. n,z'r' ,r„ y., ,:r .,.ry:" :,r,�- ?Sriflrr." r, .!, t""ac• tee, .z. -.r•'" i� "•iwb<"'' �t•'<E`" :i-. e s :�.5;.. +1t< ,,. ='f'"' •-,,� :i�'o.v, 'its.. ti�.�;: 'read. , ,�K ,. ".g� ,i1,E:rn;.vz;:; ,.,'::�:;a:,,.(?'��...;';r'.,_.,. :g:i,zu�% .�-.,d;:i:�iti:, .... ..1. ��E='.�...,_4.. _ �r,•.'°•.:.,,...•,ir.r.,_�K�;:a,`:'�....,,•,.w`,uw='.�.. Lead-Lag Optimize? Yes Yes ..s,..c.-.,..:u,.....,.,.,,•,. ..,.,......,�•-t, ,...rve,...,��.,�..,.�..\,..1-:�,.....rY.-:p.:..::«-:.,_.1 •::Gx ::bi>:l f�'.ir 'x,4'.k«:5+ �t'�Y`'+'r'ti',n", ••,k� ';�l�i(� t .T-t .'4•, ua,.k r._ .Cf .+(. ..,�i, ,fit'°.'^.',�j.. !. ,;:^Jt:•5,;,` ;.1:, .`:17t'±Y, ':�'' ?;ti?°. A t1 {{ E: ,d-'• ":l:i't .yp';• :",�:f,i j;r :,7tbyYl,.:�s.-.,'.;....1:`a a.f,. `'>r,"'„�..; <'s r' P.:i.r�/�C„c �^Y{+,(�'�Q" n($• 'S,( `,:,. �5'•2 �iii:�i��Or•*`.'�:{y '(;'��. ...15:�,:,.• .Fr_r r ,•.t a :' „" .� .rtd,�,,�.a.,.,,:srt;,.. k.,,4',Yi»`rTl<:..•�,4:4'\,.,)::i'".`frtYF..�/µiei;z;.51:_, .... :'ker •„O::'SY.",....u�?.),., eh la:�Yt�.?r ,.._..,....a ..:f,._..,,+i'sn°lY .f...._::SX�rS'rfi�.A,.._,,.., .,,,. Actuated g/C Ratio 0.52 0.24 0.81 0.09 0.09 6 ...;Y„ - - - - - Fr«":rl: �l':r:•:'yhi: �'eM:^:.i4;M;gurov:' b:<""';yr.. nS« s• V%"�Ratio,t::,``�:;�� 'i�. ..Q95.. '�4'>•;:Q -., .,.. �.,:.:_.. ,�, .��i��:.�� .,:-��r�r,�:,.,.Ax.'��,�,.�,�r�,pG:•'�,r.,,�•: �.t,•.�,,..^ k�k.,.>C�:fr<.,;rL:rr•:'�,X..si� .. .- ,;i`'�,.;,. .,ww°'�'rt_r*.,,_a,:,, r._ .a;;,,, ,,,,, ,,,, , �.ss,,..,_" �,.t: Uniform Delay,d1 22.8 37.4 1.9 43.7 0.0 , .,,�•y,,,.,.>t ,t-.< .._•' nr•+ ' ,,tna' .•:tr" '(""St-r yz:. C<E�y:. -r_h�^t'•. �,t47�'r.',r'rr:,x j1":l '•;'•c'....a.-'a''`aFi�;x;" .k•y;C,`cr .d:•„>n:J:*.:_�� 'Y'4i�� cS �;?;"x,.. - �i..�=ax;;'= 't'' •'�`"-_-=�r_•-.• �.o.�':h.-.' :s'.+`,.,. s.-. x.. 7Fs. ,J• ``'7•„h. :� yr; ,P.:. -:+.a::ww e. ,�,. - t+?}%f 'r• �`. �' t,,..r�"a� �r'l`1,`r)'• v,-; .,,a`- "'c:r�,t:0:^.;•J�.-t.•�•„•;':� ��tt:n f .st_.,.•,�,.,,' _ �t` _ QB�aY,"�.:.tsh2��'h� ��r�sr1..,'�rK,irrJ,'Z�'nk�,�o.r��36�, r,....>�F�t��:<";�+:��;�`,±^c: :��'_�,. .:_. .�c'^,3:.r..�:�>..••gY�<7z!-.t�:.�•�.a.: �:� �:.r,.S:a,..Y.,.. .�:,,,8,*'- LOS D D A D A i, t+,•,r+,. :•+5.v-' ^•r.' t;l+v_3':ts.�,: - r Y'; ,t. `�1:'r �;i"„ A - rS.f`r,k?+ i:ry'6's. ,.,.�,',"'E`%,'' ��A�.�''r:•tew;...r.•`:. i 'S'. -�4.. M .t t4',. .e.�w:y:':..'A o3Pih�E.�ay'�� ti�,:+`t� ,,ts•,�i;�n x :�.�.rir^:�"�:_,.r.,�:i..��r::zest:r:.��`?'Irx'xf,r.,,a,,,.,.-....,.,<r..a,r':�,,wit_,.r�:>:'t�.�.,tr�,.,w:><t,:,�,z:x:':d:4,�;n::..d.;;rr.�,� .�t,,,a "'I/.�I�,� !'i:�tux 'V �,}'1 ; Si,2mcJ.Y i+c}YlIS•:. _1 _ ' Approach LOS D D C • VmSCii$6 0 6$f-J dY5" uSiMIN?r RONS WAz R ~S : z? I, 2Mh N " ; kER1 1 I Area Type: Other ssa;. ,��'..- -.•:a -,r.ae,•�. •.,w,.,,:�•. - ,ter•: >C�;;n;` ;gym,*,; '�'{i;.+";.:i�?�h?,w""iFii'T1G r,;:4;scr�'{• ^'x,.r :;, '-krZ` .�'`=i; b...r:`:7�•'e'FlF:3�",'� •Li+",: `:'�a`,Y.:S,<,ir`,..��"�"tN::cr;vs: .t .sl='.`r4;. t_4. vYd., ,Ar..•h ��y, a�;r';' . ".F ; i',"erg ',Y' "•. r :^s'rn'a7. ,iF< ,+t,, :` a•':z.c- er,..,2z'•,. --i,:^- as.r,..::Arft,s "£;,f-e7,;�" ;,ji�'� rl` ,-�"" t - �yclea,��Y��w1��,�;�`�";•�ks�"�-3=.�s�E��.r n�• t �>,.�. ��x �a„n_, -�s...�,i7 ;� ,:;��- � �',�:��: �:tub::-:.zR��`1-i€.�;... 5�.<;_,.w. ._ • .i^.r... 5azr ;�:..isi:; +x�Ca�: ..�,sr .,xi:'.^•;� .�tw c1::3:r-:1�-..�I:`�:r. r.,.«.:;,:�:r:,..,e-,. ror';�<�;.,'�`2. 1-` Offset:72(72%), Referenced to phase 2:and 6:SBTL,Start of Green ..,�.^ „>l.. FrD^' "iv^. ,rr<t':"`fi'v:•,rb, rt r^•• �} ^xe,y»trk•�+t,°:4{:<i% :ay. ..ti'•txY'�`St:>'y2't,l;:ie''i;'`i rq;Y%.m "y i???-':??';;, 'r*,, 1 °r<.. 74 ."-Y, <,-._,' 'f;::;fir.. ;5.„f' °-"$` '`•"'; p.~i- ='°��t±?o%j7I +Ci... e. ::r>„qt .>+,Z., .W .�. g,R,^',• Z°1-^ .a.�. ;� a,,d:. r �},y+ �a (�,.(... ;s'' `"'`i{,. ,1�. ,rr r •.t r,Fl,,,,i• -.S"v: ..}'l.`ae-.•„ ,,zC'% „',,,,,,vy.,a'<..., i... '+AVZ,,''= A ""'' el :.r✓,-.r lY.(�jlura� Jo�°f.�.<.9Q,r-�Ex..: cv U .:/sue,, i!n 7 r>";'t,i"k„'+,,,r. .``�'-+„ ' r, `i'.' }apt. t>" �. Sa,^' y,, F ,ye "dA.,�«�u r. 'C.r. '=�'�•J�vrr# .,a'''•C;f'�.:..v:�s�:t�:w:%:..CMx.e:r. :r: .L'.'t».:1�•rts"�'.^:utii ?:e1,r:..,�,f.:..:[��'�LS,:ixa;e..,,a,,s,1+,.3• ..t::•, x,Sr1+a:A:xxL•b",`.�'a7�as��,S''�`�,_:�r>: Control Type: Pretimed `3 >1.4'.3=. -'t"ra,^ �rr,', - 'N: .V;l,.-" ..£;� 'Vfi"»],Arc ry�4j y'Y-Y: � o,��J;�:Fy�r+i"f,J,` :p.� n b^.:,5 f:r':"" ,•,• 'x•> .*•, ':igx :'s`:,.z 4fi i=., =:5 r"< :�?y=" "•t"r�`IW.P zip T^ i � ^i 'ta +:•A M�y rtt��ry��¢ �y ,t" --aba y,-. 'R ;.r .#� .\ ? wry'^v�L•:,:;:-A,-.w 5,,,:z= . 'i,7r ,r '::,: _ , ,'„ ':- r2tm ;'_ - :".��',".,dC•,;;n"�Y��fF!�t{�;5'SQ,1.��::fa.+�k5:.' >�✓ <:.��,ul��y`::�',u�:fir'✓i,ST�n_'4ei;'a}4 ...�k.,rA�"Mrs.(�?"r''.o',"u�..•_•s �,r.a,:�d�'ati••,.,;:Ns,.:h;r.rl�„frr.,,w3'��av'M�'.J•.:'r:.s 4K,� }i,l�;��,.�••.... l•S:' ��,>sa:i31•�.w'�,z. •- Intersection Signal Delay:37.1 Intersection LOS: D ,.d'?x Lrt:>rr c-"c„rs,.,, .�.. ,..rvr.":xy.,...;�, ..rx.,fr.-.;�,,aF._ •r~ryrw.:.-.y;a-•,-••.,r•i,rr..,.r,':gu':t"�4A,(:�Tl��t"^% `r'9e:G'°'.`;;e+E't�.'n" .,rtr,",'y'j',rf;z, a '%¢:?t`$ ,6^.+. L;,r:..,•,,"rvY..::r,,:.:;a"t.:v,.:!'c o • ,:.r 1,,, +r'(tj'..:i...h. :sy{" s.. Su," , fine?section 674 clty,^;0t�lli40:3,08 e pry,:;- 1MIE .IMI veL-' f 0iy4:057.7-•C4 ,; •C .' ?xiwr .>fi1»:w ;:r„. ,}:ci%.' a, ,tna: - L x:..l`Eti:...:.glt':,{ar/,, ,o.'s••rr;2.t:r�,.-t;:a_a.n.E,48`:'f,•:rwa,,,:2'r'f»imz Splits and Phases: 3: Lake Washington Blvd&1-405 SB Offramp f I c03 -'►'04 1 4 i Yv 06 ~ 08 a t,,. hf,„1 i;: 4.1.4at:.Y?:'k..i :a�"a,l:HiG.: -"4"t^`:ark., i:,,:s'6.+ '', ,,t ',y:-:. ^,fitgr tbith.. ;.vY'g ?''7. _ '.16'f'•1: b Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL • Page 5 HDRENGLVL7-FF51 4: Lake Washington Blvd & NE 44th St 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan:l AM Peak ,.9 f --"4 -- s 4 4,.... � t t \' i 4' -i.T.,nz.-, - ::.�,.»;:V i r'"Ji: ^,7J:<,,.i :,f:Jy- ^iR^'_ __ ..,"R:�r'__ : $tY-,�r^""x-..,-4:F::',T* ' `•.�;<'- ,.r 'Tt'`.a?�^[_'l _'.".t�'-'%' .r `,:N,�?'J�« •ul,..:.'l„a. 'w >,I,. ni'ASi ';I7:i}•A' .M'.rt.: ,:,:R":r B'1 ti'f tia L* N'Fg.0. t,:mot .B, I..ane;_Gcaup>�r ',><:��.�,d� �:,;;::k�.:E�L�..�^�B'fr�:<,�i3 .:�ix,:W:BL'FW�?r`.�..,,_,,_ .,:r<!;.,�181.�..,,.,,• . -..,._._N�F3r:�'�r�.,.,. .B . f^. .�',..,,,�>� ,Ffi B R... ,�' ...:1hlBR� IV . . j, _' Lane Configurations ) r� X 4. !.vN_<" ,:y!K:r _.•.'1.v, _ r r:. .,{:.;.r 1 ..t:" .....�.�;�y. _y'%+nv35�'f"t M1r vy.,!^' ...Y:4.'.`rfry ..•,..kCWsf+,:•r �' `I.F� �p�'�(•v ��''.1,'�1`- ,� �•pa ,J:(��0=;`..r.t�i'90b.,.� 1'9Q:0�.�=.�j9.00��wrr1'900•,� �{"900't �;�i�`Q''QO..if, ;�Q ,t f0, 9 .,t��'��,1 3;, ('� Li �C�2a x�:��i,Bl�f�+NPnC:I•::,i�:J.f£t-'.'}e�`Pu.�":��..r:�.,...Y-.�,. .,:e..(r,ir.: •.rg}�w'...-. .v. .., •,..r. ..:..,�..;i.rF�:'.'.'„Aur ..i:..._.,Y...-�».tx<'..%....,,,,T✓,',...,:5��-..k�..s•Y�1f:k.,.,,wx tvfc",,...n.v:x•../-i.>,w':4.n wY' Storage Length(ft) 200 0u 0 0 0 0 0r 0 c.�s ..•. r ,. .. ...,.w:7....:. ,r „s,na:.e'fi:-c_".^;o-":7:.i<.,ir:ql<.✓,u..,.,•,:a>, r.>>.pA'r,•td AYtit�: :}ie.'i;d.?,•ifr;'kicZsYY.cri.,r. /, „pr;,:.�...-„w+,,,ct`S`�"!"Tri fi.;. t k?�'<trfa••. 7.•;1" _ t, r`r` nr1P �.{:nn •YJ.-_t:..•f.1:..F...d % ,.Y?j,}:(t q\r, [[ .'I"�i;,',`.y�G fr'W't.�r 1, :r.JC. rS;:f v. •�FOf.:'�j d-'::,'z.yY4�-'-:ir. ::J.Q�iY, g �`217F>t„� 1t.i* I�•,-k/.'T.;.� � Sto a e.Gan :��:..<r;:r<. ,.�:,.',° .�. ,:�:4;;< <;,0, _ a ,`=• --� �i1'• :�.,�^ ,z, ;�.• }.. ,� .�4 ,'r>s�'..r,.� •,.'��;,.,..��.r.s:,%'Y'a,,.;.T;,. " a:'"axr._.,J;,rL�7:, ,.&,L�u,'.�,.i.>a:rf>�`.ta,.. .'s?.,�rrL, :3N"r;ii6.,..�t�;:>..rt.,,,,r..r:r,.l.',y>,�.w.,.5`§n<..r,.i,..n'_:.,o:�n.:-._:.?»��:�,'�..�-,k„f7•r>..,,F��'S;»P::.,...., Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 % - - aR.v.::...y. ..'J" - :'er - - _:@?; },rf•i's^`�:xv''':.,Ti:?;,(JL3>w x�:?S". .,1�>tR',�?- •'I +'Yc r:, ':;t': - :i - � ->.,. .,nJ p,�^ 'an. .iFC`t` k-';'.'Z�a��. •,,{:'v�,'^r': ykc :.�'° ,'-?,;+:, p.Y�..,i,...,.•,i:J`h..a .C'ft+.:' .1. U,"�in`//'�SS ��11edlt� h,�-p�,.£«'� �;:�i5..<.�,�. �,�;: 9;�. ..��"-(:5��....�:s-..k:., 9i�';':s �..d,t�:.,,.,��.y .r,:��.,�� e �:�' ,�\, �'za-m,.:.�,�stT::. f..i��r;:�?�„�•s,e ___ .,._�',z":,^!'_%.,.t,,.i`t:.:. ,•x'.'1:,:. ,„:1..0...... J-l':b. tn.,Y:z!:,:�.J.�.._... ,:^.t'z.'.,z."�Y .,4:.`.Ja:... :::^n�„2J.'.�S„ti }J4 .ta^s: Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 .:.rr .,r. :>rr ,u.' •s' ^ci3F:= "Lix'vk-��' :,�/.. - .x,,,..J.. Ri+ :v+i=, "fe. Z'q:, ,.,,�.•.. �,C., -S„ .'t e •.M'' ^(.e +9�'+ J. -`=i''''i.r ..,:?.;+i'(. �t";��. ,rY.rr.•;.is .{,L e.', ''.t:.tr,J„'J,.:Ly;+l�'�f�f( j.Z.f��':rye;.",.":^::p';:;,',u;T:rV ,'? p"-� 1� .,4' ,.C) f�:.•l'.,.R^':N:;�"Yt�' �Gr� r`sL:. t•'f:` 1t•('�� 1Wv,^.'z..l- .T ,f 5 �y��y .�x. r:,t,r,;: ,i:'-';c,. _ •: .2.. ,»Y.°sQ.�V'/'itui.'�,d=`.:sie.:'4h, ,,Xiy.n,:.•1,,»!,3 ,0.:' Q,v.tt Y,:Y r• - 1.7,5Qu: r>. :,4'F'''Rt a£•Q' l,V.rC',..r,t':r::L: � ��.tr.ek�PT3I,1,rfe9',�,a��Y•' w:..'�,•• �:^,, F..-,..,-"�,.,,. p� IX> , r rR+,,_ (�, .., � ..•,r..r,.e.:.iF-rt : i;, 7r<;�•�..v,•. ,.,',:tisa,'�r.''.::c}u'n:';�a'i:?,?'S %x..c,rL+...w-::.,'1,+ ..• , ' 1�:n.S.X�a t:t.e...,., v,_�" ,.,•,?, r..0 tv..a.a.a:rt`�lu�t';'>e. a..�e':-d r`�G.Yw..v,At>�.�<Yr..ta.i?.c�a*,',. t... •N • Flt Protected 0.950 0.950 0.997 0.998 _ -.4,a;,- y„i,,;p_,a�;. ..,f•.. _ _ :1'U:a. ..,5'::•,.i'� .;.i.`. _ _�y:s'+y,•S$' rt yr.q�•Sf^. ..w. •,-,kk'OFiT:a,r:.tY.". v my Y ,It a ""`ti, „a 'i7 v-J"r. f7=_,,: ' 4,n.. . h. d.:,,..t:J. „f,. ,:o.V:ZA n'1,- T7�:' V, r ',,g r 65SW....,Sit4?, 4.,..• 5 1' .,. r<;::�'.. •%�'�638`a..s.� `��U:`s-d:::�''.9.a:18fi3.x} �vj�5831f.,�.'� .a,'�:�k'r.�1747,•,• p;- . t.. 0., 1:'r, &tr."-r,....:r0? Sattl„a�lovits:(PrO�)`;�°�:•:':��=.'.:..=rr-d_,iit�l7h5��a�,:>rt�.,.,,.�:.,__��:�•-�:,�:�;77,. .a.,.,_,<..,.>:.r�.�.:.,,..,,.�R'.,.�a.'>;;,�.A.r:.r„_,Y,�,,�.:..' �s+�.a��,:�a,;7�7ft..,,<1,.�.:,>� �.,�.>...,.:,.�, Flt Permitted 0.950 0.950 0.997 0.998 •c-• w.,rue'.c•:'._.,r=t;;aty:r:.x. _Jar•-- n2;c,.. ::p+s'_:_ -'f.r• - „rr- r^f?<a4-^�'y%i7rl" �,.7 N: ,.Jr,;a:=.. -..,?cc '$'` ..i3r'- "c:f :. '` '.u}` • r'..(.`„` Yx.., +E'-- ~7; „-,V~ v,�rs.'''r;"f``,,- �*'i,>.':j w �f ., :,.: :x. A<i;.OA i 0'iI�^f;77CtltO3b,.:..r1:583' ID fgfZ5,,-�. ,icgiz. is,' 1 32 r:#.,f.,'{D- 11' atC�4dWFSQe '7n M sib �:752 f,r �5 , >4Jct,y.t.,:;,,.w ,a .,+:.,:,: r•r :,itzA'l3ua, ..,,_tea .,, .4s rm._, r f.nti.�.... i Right Turn on Red Yes Yes Yes Yes - - e:4.�:..,.,.. /� _ ..,ri't." •xT, vzi_ ry<3yN;.:'l,,y rT7^!( s,w'Y':'..c."Yr':3': j-.3,:N'V!'?r.,m,h; ^Lir.:r":S'W F/fiJ,!"' -?I:J'�'+; <.,{5' e�r,rj .Zvi �1:� ., ..{, f�� ..�, �{4�''u).Yi. ,, i•v p, .7x..4��` Y}... rVi(•f," �4"":!' 2-fir :F':F .N:. -r!- Y�'� ^�Y4r.Y M14 ry;�,�',>,,,1:!'+,:; ,.t f_ '<'rr�:r.F :��,.r7'e-,�lir`^•e :`k ,' ,�x< ri. a• ,� c.A ,-,.•;,r..e „rwr,t PP ,;,,n..} ,'s. :'1: $., r,. �� ..tu,,. xZ-�:: :8'¢•>F�;r<�,,. '<. .r. G��2iN•r?Ji- �1. +t`;^°'z`;'v.�0�'',.r, 1' �-,•�y t'• sF�`OW^`J-,T.'"Ype} 'r,2<u'•�, �,x,c;� ,:.<;ri!.68.4� .+ ?:. e4?'; -;1-: .,�<':;�s,,. :'<.Z ,se...�',,+�.' � ,�., ..s•;.. .�i r.,- •r,�,Jat�,;�a'= �4J �r�,.�•:::,r...,,,{S�^�J.,�.C';�•�h:r,)..'�'ai,.�ay.-:of s�?„=,,^Is.,.'.J>., �`�,tr>r,..:r,.. �Ys:...,:<"w"" :.,i :t:i:l.`u'fi�M.. to f.J,._,_ S�z,S ,P.., t:,+r z.>.Sir- ...ta,.:f;.Jit_T.c,._ . ,il,« Fr Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 +`r.Y." 7 Z^ ."Y." ,,,}-'. x.:F 3..-..h:^Yx :zYv`r•J ";.'G?v "T;C"rS?'`.C"' ..>,r,,•r,- •r'r.-:s ,a"- <:{',•,7- .,r., 'vt«- �aa Y s� �,'A_t'w_ '�>k, hr'k -�3- �C' -l-::'� �: i-t,. v..,�v. ,fie: _ .�",..:,cRt.: ,t, .,n. •'':d'-z. _ul'. _ :'a�'Q- ;r :;. ,7,, g.;(n�..ti�:'%'�!•y. t:ltik: 'YC�s �2 sr,':.,r�:,,,,..:.�k.,.f, ..,...fit-:.. ,:�;r_�.,..r�.-: c,",_..,...art-r....,�c.�r_t,_ a,:rwa�:;;:�, Link Distance(ft) 572t 1320 1320 1319 • vJt�. s�i ..�:i ::7' i + ",Y�.. .:.�,.):�-.:.:_1:�,;:�.,.�.... ;- -„-.�. ,_. - - ._ -e ..1,:yaw _ . -N, Volume(vph) 388 96 297 112� 129 69 11� 107 69 11 • 22 315 '•'r'� -'�. •�C.x �:, ti±lK:'7 ,;ji?' ,..hs1L"`' 'a.r. k.. oil a t :t';,{• �:';�,:',lr;,.,T 15 , ;.: .:": ', :0''9'4 .010.9;':,�,.�;O IO -'047 _ Os;:6<,.:,:}f,0 76',. 0:88�. , .07,8 , t?ea..>H ".��.G��-::�:u�x�...r.._•....- .., : ..:1,U';��,;:�.::. <:�•.,s>i;�.,,>..�$,.;�:=..: +.1....,. .,f':::��,.� .5.,,. �.,..� . ,..ry_ �>r...�.x�, ••,_. w.,5 ,.. = _ Heavy Vehicles(%) 3% 2% °° 2% °° 3% 2% % ! 3% 3% 2/ 3%� 3% 2/ � 2/ ' T } .,t... Ht.,: :'ri^_J':Yi:'4„' r��l,.r:('^,Tu"?k�,,;y" Y:i,:/.=`U' .,�:� } .7,-.Yh. • - �-sl`Y Jif'y' _,�. f; _ ''�!f\;ittij - 1:4' S '•._``_7 :,.i,:�..a.. ..,s(::,p.�.�_rs�.ei'_''•W;t'`3,?....."<3; .i:z'=,;:.1'r,< ._... ..,.a.: .,iw..._.,.0 ^., ._,r,.. .r<a�a:-. 50 Lane a Group Flow(vph) 479 486 0 126 145 78 0 246 0 0 395 0 D _•c*•,,. - .r:Yr. rnh.� _,�..: ;:r:t,.tsr.:: •;:r,^+r i.'�k�' 'S-'I • `aY'- and "S i �'•/ t r ::C�::M-YP.�,� -•tL�•.,ra_��':.r.�„ ._.. ...._ ISG:�'Fr: ._.-.,._.....:v:a�f,::a:..:.::.:>.::�:J:�a,:'-.p..,.,t.. ....-.:P._.t,;,>''��i.•:.:;�..-<. .,>•ca ,Y'�*.:, i_ ' Protected Phases 7 4 3 8 6 2 2 6 6 Per rtt P,hases:. ::,F° A, g..-t. . Minimum Split(s) 11.0 10.0 11.0 10.0 12.5 18.5 18.5 12.5 12.5 ;:fir, ".�r, J t _ Q"Q Tota1,:S-li' �::A:rx :, ._.._.may.,,.• 38:0,:..,. 89:0:�:>'r_.-OaQ.`':.,..,,1:5'0:>..,;_1;6:0:' r :.2^ .., -. ,.. .. ° 38% 39% ° 15% 16% ° 0% 21% 0% I. • Total Split(/°) 0% 21% 25/° 25/° � � 21 /° • • -::s_,r. �F• <:4:Q: :4r0:�„`�,, ••„4.0:: ,=4,_p.,; >, :AsO��s_-.=7. Oe�.�;.. �.,. ,pi; :._) `.-.:•.:,I::,:,..y-_ .s.r�")73;r._..;•r;'•','ic::'�.:`6i'.. .-:�q+ti.; .z,.--.. r. `h'r. ,..-.'k�:4i":.fl{ x.�: -.... ,. ,. ._,__, .r.�<�:eit_. .._i;,J:,r_.>,. ...&:c't'z Y'_... ., All-Red Time(s) 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 'ir' 13-d'� :•4: 4� ��La a,: :;Lead: ;:.Lead':. ;'<_ ,?!.,> d/.. �� , _ r:_ :g. ... .^9-«,.^'�'�r;,<::�,:.;�......,�.,.�t<f-.,:z�r,. _ .tJr.fL>,;r�,'a.,r�,:.�....,._«.�+�:r:�+,::,.. . .. i. Lead-Lag Optimize? Yes Yes Yes Yes • '"- "-^".., :z..._..,.•..,..,::�.,...,,,...,.•:',.,- ,.....f_,..,,>.,:, - .x..,-�„ .r,. - da1','r,•z !at5;;{r:<r p;�"„ ";vr ^'!: 4ti .r,. ?..Z, ':l':,.%•. ':p YK, ri s'+ - - ,ii:: 1`a};.'' ..t,` (r',ex':`R+•. -ee,�s' ,,.,: - -:�33:0:,.; ,0::r.. '.1`0:0. .,,.,. :�:a,.,. ,.J Actl'�f�ct'?Gr n> ,;;:.r.;. ,:�,.. -. f r .". ,_ .,,.r..^,,. .,. max. Actuated g/C Ratio 0.33 0.34 0.10 0.11 0.27 0.20«,. 0.16 '*'a'tr:+-^' - - - •'ti:. - - o.%!J% ,� ,v.' ';yr�t'3,'i."'Jr_=>>r ';gY.'nS.xyrr.,1... ear - nw;`� - :=a:':z`i - -::tkr =:'r,; �� tt'`.. :'.,,, .SC'%'� ;J' ;�:r Ci'� i?'7.hc,•.•`:$•Y.s N: . ?:�e''� ti«' .,r'tar;,t:' .•�".~,... ..l-?,t-,-,-$r,J--. 1,,.'�'F" rM. ": 'w 5,, N'+I.-tL;Zt_ - ":,J''+,.. %r7•' .rs _�-;;:,x. ::zr,• t ..,:�-�:.,c,': ,d�1:. �0�6�- -:�•;,... .s~<. ,066.:;-"'a.t.;, �r-' `'0. Q:e'=;=a,�s;�: ,//,,c�Ratio`.• .:w,.�'�;::;�A:�83:r�= f07.3.„ _<; v:0�7��'�x. .�,.�•w��,.r,�.,�=ih<,,.<�...,zr-��-,,:�>:.,.�__,�l�dE.>��'_{::,.,._.��'n:��..•. ._�.,.��. ;�S;,r�-c_...,,_� u:�.�ir�rc�tv�:�"%'.._.,...,x,... � -��='zi a. r ..;.,,..._ �.:r:. �. .J�J_.x' a .. Uniform Delay,d1 30.9 18.2 43.6 42.9 0.0 32.8 3.4 0 De:a YW - r:i •n:u� .v1.`6 '�^fi:. ?:`, ,5,•2' VAs.r5.0:2" . .: .C` „t3.36 T .�_�Mc fi d X nu T,2' : LOS B A D D A C A hl": _ 't;r--' .:+t.�x'' b r.. :,c?�� .. _, _,_, ._._._.r.,•.. ... .,...J'.,;a.,Cts.v:;a'•, 'r"•r••."rt .:x.f.r.. 'I Approach LOSB D., C« A ..__t '°� - ``"F°tEi+.' ,.-�,Y •.,-a. "w,'•','k":.,a;:;r:.u.,wF,. '�„`''n= 'W-'' r� '.,:' ., '-F s'`,a„= s%uL�-^: :a`, `r.:'Sett7.::b':;' h�i .,M1a..._�';�a'k_,'i' rar" "Ti;'.:�4„ �a' _.,.rr;.., .,xf;.a a::t:r �;la�:1 .�','`%v,� '�'z f.✓_, ^'.s..Ai •'.0 t-?s :k?ri;t 'r,-;_.::tom- . _ Interse:�tton:Summary<�r:;�:x,,n,.�.��:t ,.:�`€.��r�J:�:�,yap,:�;��r;,,.,:,�.�:'�.R.,.._... ..._�:,:...`� -.. >`..,<..,., -f_,_.�•��:r�'.,, Try:'�-0,r:_,,.::A.;�--,.�'a 3<. . , �:-., f ' _, Area Type: Other wq,,, cY<-ry s3;f!•,u: "43 •'a'Gn rv,-r,. - .x\t e:, w:11::: '�t' wK:!ji: ,I?!;t..y,-k,y<"LJ,�,�;te&•F'n`f •u+;7 ,�;. ,:.; ,..r.,.g, -S .-r..:t „r:: -•N: -u`f:;ii..t „�'n:"+''.;i,;' ;!'r' I° �R"� 'izr; a',�'n3tc ;{ ,�+mK' L•"::3 "<M1 �e..t l': :;.ti`+:is.'''t'ie`..,.. :\+.- ;:s ?L,.,r•�1. •k,1';«tn.'�C.- „. t b'.^r.� ,J�hi ;}1'Y '�i n r;R$l,rl.t :r FiY,•.'::i�'.v.T...•sa•'.. s.'¢a.,,,a 2:^"�?s�>1::7 `d'i .7pq.,U;,n rY-...L> D.jj��cle':Lenry}h:r.:1'.Qh,, �, :, r: � :=';,;. , ,.'; <,- ::' ^ .Yr:. t, , ..•.Y,.. ,,:. `.. ,...,,�:Yaeµjyf .2.,.... rr'z;�c?'"a%>?t.u�.,>`.., :" R.< :.{',. ....:+,..,I'�v:.,.-,S s__. ,4....4 ,,:'3.ti •:-k._:.a`L:'_....,...;•,n.•:d.._:.::E:.,,..;_,ar....ar...,..,A ,c..:e x%" �:i. '• .x.,-., Offset:0(0%), Referenced to phase 2:NBTL,Start of Green �� _ ,...-ti. ,.cr%re.<:- .¢Y,."'rn,•r,'"::+• -�.4'.:-^.a.:.:Jn:'v:Y;.. - ,:'cn:.••':'^- :F:h=.-�-^' -.'xrxc� ;s:4cr";?. •sxt,%ti';_t:�..,'k•. `Ss;q•.n':, :: :': .ji "',ra'_u.,. srrf:'f,.,Y'--' ,-4._ _Y' p r. �,,.§S_hr-, S�r`at'",• `n>r•. •:r; a,�i,.y`7u •-L. _ 'r;�:ir a'y5,c`i":°?`�i`-+:� J_ e� 'ri,`.� r 5.�._. a rir`" G. cl. 0's., n =t4 :. z..- :, ..,.- ,,;._,, t ., .,,.- r; �' t a. e:,7 x„ __ ' .. - - .�ur,.�ti:��;�a �,>:��,,k�'xt�;:,-.^_,.��s,..,�.�::�^�'~��.r._,�<�..�.«...��.�,.�.w_._-.�z- .r�;r�tiu. 3• •�zx.r»61ri?....,..-, _(....,tv"..,...._.,_,. �._,-,?;NA`•.�.,.,.v,n ,..,f"d':"�Y�:....i L Control Type: Pretimed i '-fQ:}^.J,a9.` _.,Y•---.•qk.-, ,olr• _ :L•a ,r�:- ,.w�,,x ::Y�r{cT:, f1.4 :l° -ry:: ,'C'i:'-)�. ::`��'.' •>:Y-'!.: Wiz`';'}' �i-�i'h'Ys<,i,:.• Jr` 5 '+f��t+ .?':}. .) '�f;�t: j - �,'. .si vr:3:.I rl s�. .?-' <,J:.. .�,..+':i>°�'e,_ } -�<"d ,,,,'a( �`+'.4.`R ':,'-,, r.7.f: �-:?;, ..1• '�Yt..-Wit'?�•` - - sta„y. .l :F. `.ram`.. 5 `+'-t-5.^. ?C,t I... �'•"e1i?,".' S:. ?�- "�"•i`•,.`,i::'�r�.r7,. ..�'^'�:z:i_' 2' .,�`T-%.. r�:YJ:ti�to 3#.,.ryT...axjmum�'vlc=p tio..Oz83r �, - - �, .,, .,>.. _., ,, ,. <:..;.., • �,b:. ,,iu, -w �.... ;l•_r.'S':fi'Ct.r. ,r.,,.•rr,.C•: .., ._.-.. , . •. ;'.1:,,�'r., ,•I :5asc:'-t:.a`.„J;.. .. ... ,. ?'.'ci`�:..:r,...,..,,s,"-_kA,_....-:'+:`, �4r::c.'.a°... ('� Intersection Signal Delay: 18.3 Intersection•LOS: B �J se:•u..w,._ .vf•. .:N 1::, - >r,...x:. - ,<r ;cz'it in Yr,3w�r,��.;� z�s'E::cF;..p,>ir•.: �::�r:: �•*:W.r.:.':f,:� x�r/:y .w„i ,,> 'tj' '"k''. ,.`f,'°> °^7:;5';tr," .°i, �;"k;�rr�it;' '��, :;n (: giii 7>=,, -',i'^ tt rs. P- v i,'4 'avv'31;Zit:a. :' P... tflt2l' 'OriitC•r� 01 `�IIZBtIb 's`9./o �: _;r>it±.�".Yk:.N-.G"v 1( ,,,�rf^.S@r)/1,•��'�,=�J. 't/�.•�' ,��'.t;'Y'�: 'n �c ,:;r''.,=V�;" ;t_=i,.:,.. x,rr.>�tj.:, Ir '"T"+ .�._.S'��..:..:�F?a'rtY��:,�,�.:ww^.:!�sT�.,.,,..,,�t'sztt;��,,,:L,;......-.,:.,,n��„M,.u:.�,.,�'��?-��1...,.�:�....,,:,-.��.�.r,..;�,.:.,sr�-.:�...,f.,t�?,_,s��J•��`r,rrt.r,n'�..,r.,�:',�kz�r.�•�.�y,�7�"'�'.�;r--:,. Splits and Phases: 4: Lake Washington Blvd&NE 44th St Y 02 06 04 .�y03 J 42ft;a,a+' . ..y, a: ..4:1IZIAVI�'s-n1 ,,W1^� "� t,�,'`'.i•�,'.k5,:.a ',,- ..: ,. "b tl� .l3V.'�, ;::,,,ft f 07 4� 08 '-' Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 6 HDRENGLVL7-FF51 2005 P . M . Peak Hour Los irons Without Project 7_1 1 17:3 i„, ',. 1: N 36th St & Lake Washington Blvd 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak ui --'4 —lib N, „,- +11— 4..... 4\ t /I* \* 1 4/ r: , ,... PITO% , , '' waawatzomoomeargemmywatifwarromFamswaawarormm L3 Lane Configurations 4. 4. 4, 4. PiEF..rdifiMEEtW,IPAV.MPAFMKIMICRVgaafPMNMFZIPVtMqgfffgtPitVMgN 1 fl ' Turning Speed(mph) 15 9 15 9 15 9 15 tl 1 9 IF44,111PMAATEENSEETKRIONMESNIKENVINIMEMPEEPPINIDEMAREINSTAAV Frt 0.955 0.883 0.993 0.995 EIFECWilittatr TalitifiratMETISHANSPANNEARENEMPYINEEMBIEV:g.:MVIREfil Satd.Flow(prot) 0 1566 0 0 1645 0 0 1826 0 0 1835 0 Rgiofftmazzgroagorismorwateatiprorgasemw,,,,,wfoiL..iinz.,,,.!.10:114 Satd.Flow(perm) 0 1566 0 0 1645 0 0 1826 0 0 1835 0 git4:7441,—..„t WIliF 2145.MBAMENTEMMittgeMEMEEMPEANARVCIP'•—71,RDNEIM ' Link Speed(mph) 30 30 25 25 gr. A:-ToZtttliWfftfiflitgflgMz7zAkte;Ed9lr.eMYA'Wgr:',"litWARIITAININEREWI Travel Time(s) 30.0 30.0 36.0 36.0 ert—,rtgliTPMERMSEIMPANOWNEZENEMONNOV,(1EUVRCEMIERMT_,4 Nig . Li Peak Hour Factor 0.58 0.58 0.58 0.73 0.73 0.73 0.69 0.69 0.69 0.94 0.94 0.94 PAEWAflcT41aBflgatt4V2jatgatW,KEMSaWPYIiriW,MFWRaArdES4W§Wigffr:RgqS Adj. Flow(vph) 10 10 10 0 8 52 9 155 9 73 259 12 I, RIK9:04:PNWIENiSNO0,614OZAZONECIVAMMVSEAVIAN:.VMPRIGESEDWARME1 • Sign Control Stop Stop Stop Stop kJ;eiroiiPl'I'SV10-.4i1:1147014-72F,M„,,,,;:73M-: .7:imliWigligita:%,,i,,,a.. .,:' RT-7.4iiit.i.4.6111-Ci:,,,;.41,77, Area Type: __. _ Other MliMgCqk#.4tAirfetkitNP§VggaaaZgtltAefEfM:MftrfOCISM;FRKCZfRZMPffiln 1 Intersection Capacity Utilization 43.7% ICU Level of Service A 6 t2:1 f 1 , b ( 1,-__-.3 ,. z.73 ..1' : 1 ‘.1 1 tz:3 czza k ; cro' Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 [ BVL Page 1 HDRENGLVL7-FF51 t...; 1: N 36th St & Lake Washington Blvd 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak ir 4\ 4/ Wiriiiii4iitlaVIMZEKOEVROTAMOMMOMOVAVIORMOWEICWAirtitaVATAITIMMIKainTIO Lane Configurations 4, 4, giiitgANSECIAMESEINFAveiRtig;REEEPARMANZIEENONERTMERRIMiggagin Volume(veh/h) 6 6 6 0 6 38 6 107 6 69 243 11 _ E6a"kg§gfgt§NRf.SBKINEEEVAMV,g0,ZRqf,t*::lgfgntTtg'M!Sg'ffZgiolViMMDMEESLP42R1D74 Hourly flow rate(veh/h) 10 10 10 0 8 52 9 155 9 73 259 12 olrialafflaffdra*ORNEEPWWWaN-RWROONTNR:ffetWWW - Volume Total(vph) 31 60 172 344 Y.15rKitfgaraaHR/WEITVEMEVRPNraWgZrfYgrftiCMZEM*KgenlltntfattfOgttSgnNZ Volume Right(vph) 10 52 9 12 .401,itenTififfillilitiffitieNNEWONDKITURVITSERIMENIRESEgg,INESTMEI Departure Headway(s) 5.2 4.6 4.5 4.4 rialliCIREWrINISIFtietWidlign-Wagw--RFOlgit•PWKRomwpvgem-jpinwohwilawitrugyl ; Capacity(veh/h) 628 710 772 804 gigfi§gPWi.WFIEallEnqagaTgrffgtgrfggNMESRNPTMBEAN,EattgeWAVH2EV.N Approach Delay(s) 8.4 7.9 8.7 10.4 . kOT64-011%. '431.243.1tRil.E1A-KAIN.471).(Lli'M ESFAIINT.Agr.:11:3 • iiiiiiliaaWartifigfaTIMMNIAMWEREUR-WWW,,,T„- muyamiggyaragfaulau.47-gm tlifiammItaiktelfgArlifilFRPWat,.',,k,M3.-00,mtpogitipoinaigiostmottsoggeomm HCM Level of Service A if)jgS:0:AIKC:E,i.gtlggkggCaggREYA*irkig:Sf;,:qOSr*Ot:§t:*Ngi:WSOSERFBMAEEg.Z.KPNRECEEa 1 I , 1 • Li Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 :j 2: NE 44th St& Ripley Lane 2005 No Action , vim_ Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak JP' 41.. F0. 1 ,,, , a`twei +i}.2. `'"' i?T. ,.., .ti-,., .,.$r+,yY 4` +,A,; ...,. .tr„ i 9 t;,��`�,.. •'c- v+,a -',zip ..y ;., y.+p�;,.,��•KY T.'',, .. L3_i . aJi11F,�€:, �s�'xx<xs�'.h�?r��i�.. s>, s��e�..3�r�� .�`.,�;B,��,,;�>.�+A�,��..,'�?��;r��'^��"�: ��±�a' �`�. ��,5�,..a...�,,:+ 's�l�� '<��'"'.'w� �'tw�� Lane_Configurations _) f • V �d„ga�xy rm: .h�'2'ri'7�i'� .'?Yr5'+r"s-n ^y^rc:Y: ,.� sr!F.,_ ,.4:<, "�� {ktit?riN:a a r �.�; �.rk�',.5,Y�'s Wt��. f,�'r, :!`.;,, 'Y ~'er.��tt'�'`h .'2�*�^t;J;i+ ��,�y7�y,.QQ,if.l..�[.7tJ.V'`Y�':,n;41.7'Vu ,e��r�A-a;C{'��'Q..�vi:4!,`.�5;�,7V1'.'�>' �.� 'i'�Yy`3t�g�`r-«z.,�s..",.��,,.,:.�:<,^�•p,;9�i�.. <"' }�=' �`]�''�°':-$�' -Yi., Ytw^ z3 ��._��r`r'�C,,�:.:�.•..�aT&'�«, • -., .,es.,,,:�a....,..,�cx�.� a,u�.,.t... �x�t,.,<..Y:a..,.wns.$ >a��*�...e-., ^mck�s,a.ASr�.:.L�i' ..�".rn. v .. w....;%�.� �� Storage Length(ft) 200 0 0 0 i I y,.g rct -:G'T, r?{"x-t,,j�.'.., :.:, •a-:'t?;a"`X,<�rraJ^,f,rc ;�cf, ,.:11•: .'v '^?? Y's.,'"i i'"•',:;g'h`,� •':v zr''T„�-,^r?'i'z.,,. �. ,,, ,..;.,.i.:A '`fL',. w. q - t• ae'''t. 'xr`..,+b`€... ;,�.�.%1,er,'i3.:•a"+3:'a4s'A�t,� e E,.. r; •,.-,v�`r .,y R.:��''.'�2.a,.,v'WM .ta, ..«;.`,. v•:5 I ,3'> ,th4X"»,�"`.,. ; I s a,..G .amass>�.�..s=a+z.,'.,::xa: ;:a.�.�''�;..,Y�s:;.t r .rrsx_.:.�. -'�.�>£,,:��3 ::.�'rz,«r�a�iP.u:?�,s,.�.,:^;�� a'm�.,,,:.c�: a; �P• .<..�.:6,.... kil Turning Speed(mph) 15 9 15 9 rp'y - gg fIR p X :4ki $ « Y gt 4 aMIN � �-"^7E-%x" +� vr, I 1 Frt 0.989 0.970 , L ��A/a` �'3e, a,g,.j$�� y,� bh �f�f�,, J '1� t;`• ..,, - � �'..{ (9 q:..`,l'�:�'•Y�•;"1� y��,4�fi yy4�� t°"�y q� ��'^„'_'�'LX: L°", -a•;:u�t�y;a� ,:3Sia'a�..f.'Y`!> � �&��''.LW[fkw'w'��.L��1'L�`f.4ei"L1..�'�X' .:.. �:';� LhY'^:+YA�+rre'"I+LCS�r..i+ekW2.�.Ya`Y.�..� J.�,.. G+,iq�3�t�!``,�t '..7r.--�2rF. �F�" V:i HY]'+ Satd. Flow(prot) 1770 1863 1842 0 1542 0 F'-' H•:V.. .. ' .t��,L' Zvi ,', b '.vt`t+-.. u �•`l .4.F, i T tY �s,�.�' } r f � �� '.��(� �� 'e' X�.�*� �'�''�c'�j6�r� 'l iE:r'�"-.,m� ,�tia,� Y .�'' 'a'�a' �.'a rir,�4 a�t ��1�"5,��z+it.:_:�azn�i. ,t+.,�1� N>�u'7,'aa£,:.'��:.-.�iax?,i>L..c£�$I},.�er x:'J::+3:�.,'i?S:s `.�. t.;.w'<._1s..: '*iv��t :? .'�Ziia"ti��.1�3;:re,�,��...,:�lu�.v. z�::.�:°.'�. Satd. Flow_(perm) 1770 1863 1842 0 1542 0 - .-".s,+°' "'g"^�ca:�.stc';s�,r-r"y^�i:�"�M? "'fr" ;c3'S:"";*�;'"�1,:r'.,�,t 'a,`;, ^.Gs��i�. .K". 'f.�`�- � ^,;�W Vic'•- ?,�rs�..�� r,�-t ._� a.-4r�r°.,.,,^""Ktssy h,"..";u '�a�_�sa- ,r9t:rw ca;:I�.nxl.:s.,ls{�F t:*i� ,�d"r.`snr..,.oi�+�`< f�x'^'�[.:,-:i?4�as,..aw J.Fa.,A�::+...,,::.sa 2 4a":' vrc sr�$i� ��` K Link Speed(mph) 25 25 . 25 P,r• „ a: s a� IZ E :I PISS aE NNY, -A iNIF �.(�I " ,n: x .-.&, �' Travel Time(s) 36.0 7.9 36.0 L'!, (�Y� xszc:,vy7 .7. ryarf>n;. -�,;,s .:^33�. r•�k,;�'t3 n �r� �"*X'` .,.v"; ��,. .r.'s"s!i' ';•: 5%.., „�' f, �.. i : :i 3••`,�, :' .+ `.�l�,t'.,'Cwr J..-t,�`4#" tr nfl'iii ..,. �.:,. .A7 'y`�.r,':W,µY<:r •Y.•`K,r: 7-.v.c ,f w+•; jTArel yy 2,'t;._y'S;ea r4r;:t�"=s: '. +:' ''A i :,"a . 3"l' 24 £„3,�1....�:. .f?��a�.�».,�n�r:,,�g+a .�cv:��.y.-,.:,�<..�Y.:,�.+�",a. �?�:, ..�w..,_,.� «„�•5hg?�.. �.��r+�� w�•_..nr �'st�:�:.�.,,. ,s:�:4:...�'� �x Peak Hour Factor 0.84 0.84 0.96 0.96 0.68 0.68 o rra- ,.o •zr*.. _,:�.., .,:y.F. ,,P..:. +"f:•' ,as's;r*3`--'" -r.•.,trr.; ...sy�,�'.41' ;,'�S^�>;>. :=r.:qa'�: .='rs•:ems ,�:"ri;$^';,�s,Y+s�y°s 7'C +f" ��F!Xxt';��' �.g, ;''t-at mx„ .;�,.. i., ,,r ,.�.. .a..». + ;;1,x"':#°y: ,.:,.'.�r„i.,,�,.z...a,. +W "`� .':st,i•,•o`': . dz's z ;a;,-V 4 90,�;'axg " `+2 0`` ;,, "o"K..,m,.a.>.T' . t r, ,� fi, 4 1earet :� .: :,wk.... 91a, n=2.1 ,_ lq . .iouz;. 3 ,< �; Adj. Flow(vph) 7 185 314 28 32 9 L1' �;,.. - ..,1;....i�.•.^`fi:.^ 47•. a,�'.• �!.•'w ."+.:z,:x: x�'--ca'• a; ,�.p„ h' r '3'",f."�"i::"'??`. '�'w" �,. -;rtm''i.,.xi"kT`'s'F ^ .�•- '^;�s-`'` '5��..-"u.- °t,' '+:.�; .,r' .�•. n.�,:. .:;T;.: '"i;.�:-. '�� <•,. .r� .:�:,- F,-,.7,+•�.'.J.N:'< .F �1.7;�a��'.. �.%;_�'�:;�T'�`-•w,. :r :';ut: .,,r., t;+ •wpV,'.' 'f•.^ '-t!RESTb.,l,�t., `+"'Y:f`.t,, ..;t .,t .fir, ^.,Z.ruq.a> .' .+.j� q` r. u �o i � 7�-� E.�1��5�'„� �. •0-.' °•�� ,k;':�..r�6�.. �'l .Y.rF��r �� '•�"..' =si"n bi?: :ia:,-.'r:i;..u..,..':..F;.:;�`.,x �i:Ya�srs>�%��n2„a?:x?�x:.a,l�+:», �.s�o-•..v-..'�,�<...'wt�::;rut:�k>.Yt:i%r&«�..��I.�s�+.,.lt»�..+Srd:Wn,a;e�u'vu,Cc-�.v*«Y:1,1`�"1'&itS3F:.',i..,.. Sign Control Free Free Stop fartitidirc!-•. M a.. ">-;�°' s ��•�;.:.,a iy:.,a";'T�-- w"„t:• ;:'� ^r';«''>~' Ph' e" ��' -af ;,,�-y"•.=,5' .NI ;� •'..',�;R .;r";::r;'yS'"-'�« R .'s?,`e'a.A :'RK�` -�::ram. —".i:�,`S` ' x;,sit�- '„ r Area Type: _,,, ; ,.., Other zli . On� ' r�gG�2C W r SC T � E .x EMMA rc �-tsa:i^-R Intersection Capacity Utilization 29.9% ICU Level of Service A i t '.1 ; F e1 - I 1 i l UM i::a i l.9 I 1 Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 3 ,,,..," HDRENGLVL7-FF51 , _;J :.„..) 2: NE 44th St & Ripley Lane • 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak 1., \o. 4/ ' NOStigailgagairafWerka3VORTEMEWOVRIMFAIRR-$7.611WW,VagfaftM715R3g5174:MITTRW1 1 i Lane Configurations ) + T+ ''14` 0 ' 'N.:rKggff9JNIZSKISF.ZWSg0.,g!Nlft§,INN'OffiAtcligfiniligfaiftff:Effittr,SMEDliffgtlif,:Mg.eiRN Grade 0% 0% 0% oraiWeNktyilrWnggin7rFignj-':66TggiVVAVSIPtrVFIVZa',i,V2gri;*ffeap,.:,.aq4PNFZMPOSSAVTVIRRir'"Fn"'I _.,...d.:241-j:e....wa..4R1I7e.v;ea;..4 ,,..±T.;,;,...ilor,v,,,,,,,i i;,..4:.'AL,C,„:,--ziek...;,-.4-.1.2,..bl.t,e.4';,i,,,,,.:,.?::aiz.-4,,,-,41%-X.;„..,,,i140,;, -,'',.,,,,,,i.,•!-Jsattia,,,,il,„.!,:z,,t4,,g,14.4„,,Aga 6 Peak Hour Factor 0.84 0.84 0.96 0.96 0.68 0.68 EeliteaRA:440410:10110.*,10.$XI4t4RAINg4aMV412:241MIZEVIZAIWEIREWMPARNATil Pedestrians , t-"'"-'"'""5Wqfil'Ttqs'--s,q,t7:rrW:5WRTM'DNWzf'pw;, ,i;',/Q4tq :r5m:'z:Wia:oegn::zw-;;:~zfxve'<cak=rprpftwzir-4ToT,qx,,,.mwmpzf,f,t7,v,,qrre:A?,,;zv,,rc, 4,0k,,,,,,,,,,,,,,,2.', ainLig cd.ai aiPx':a 0 IdQa.0a agl,*iT.'W t,,,,W:10. 14.4(a.:4,?:',Ka: 74,.$,ZOM:',V4eN i4;t0kaataikrk4,7-,U;atiW`',LiWill-L4Zgi,,,VaiaitkW:34,;3 Walking Speed(ft/s) 0 0kieg144:461211VSEITSUBigatf;RIVEXIMENESENCIERMEREWASSIiii,E.,',IMVSZIEN Right turn flare(veh) i-- ilii-I6e.i.71',,alvi,F,,VIT.T.PWCI;T'EskilgRirRin-WV-Igt.'7-TiWMR640,14:6.zg-Tine;SV.EfeparywgrolptEw-g„77:g”,Try,q,wAro -M1,44-k-Arz-z.-3L:ba:&,...,/,k.,,,lakilligg,„•-3:`,,z,,, Atmi.d.;:i4.:R:xv;p4-:.1.y,thAer.,:t,,,,,,,,),„,,,,Y.tati,... ,:•,-A4r,, 2:i5:14,"'tgliaar.'414,6ate:,0';.*Zi.:',A.., SY,:at;;A;tdates-tia-2(',4i 11 Median storage veh) ,-. Li Vg146011:61,W4.1Erigiii**ERMXPEii-ENIM52EDI328RIEVEZEPEREMENEMESENIVIEN vC1,stage 1 conf,vol , ATilOICO707,NiggaggeggERZZERREP,§10E07,40101:2%.C.MEMBSINETERSENNETERFFS ! i tC,single.(s) . . . _4.1 , , 6.5 6.4 Li ......,v.,..,,,„..... ...„,, . tF(s) 2.2 3.6 3.4 , iT.Cc.iVggf.O.i.,VX/ifftirAlfffl,OSPSE.Z4RE,MliEi41,2,§M.fg-EfiqilKSTEIMSE,'M'ZEtTdF,W1.tif,IRSi cM capacity(veh/h) 1217 • 487 685 Lj airieflO'fiTarf0jegiRMAE13X.V4FOZZ-07-fitagaK'MaTagaifi,,,„TAWAT,,W,.-Ffigg-grifearkigg-WWWWATIES . - Volume Total 7 185 342 41 1.. gaqiii012,6:15MINEVARMIONARANOTP::,13pzgraNymiectog,fiyagzugnmpiamsytalargE Volume Right 0 0 28 9 J 0-AMEENNEMENEPTEZIARE010020UKTATAEMORMWMAtegall0ENOMETTA62,4 Volume to Capacity 0.01 0.11 0.20 0.08 , 1 1 1 giii,P,AfidgarOMMTIMSditig!',VtgagOles7-..:W;MageN15:;.1,N..i;;Nirakig.RiFkgfagliaggNiFEEMPART t Control Delay(s) 8.0 0.0 0.0 12.5 ii ,_,... Pblltgg::RkfflEiNg-n),T.:af,ER,-IW!f:iEiNe„Tn:;Mf-:T'Zg,73tis:RnTf-T7V::7:lqV-FIYAFi3SPrnIEN,2E1:Mr,FWPIa'fe;74;! ; - Approach Delay(s) 0.3 0.0 12.5 6a4406-1.001-Ma.;111naitageeratgraffigE,;13-10E4igOgigi,EMMESEREFMEMPIMME, [:) riif*,gairoWg'OliirhirMf$R';iFM:W,ZZIRAigiaagaig0ttM+EMTrrg'a,:a'Wi-V,rfn3,tnt:M.UFCagi,RPRTR,MMNF:V iA§fgekgaf;k-Nr.NEC.tZgia;Zg*SIARh..geggnitAaati7Ziitg':NggN,FgtftatnriVMitVPRVZK4 i Intersection Capacity Utilization 29.9% ICU Level of Service A 6 MINE.11,TA: z1M.EfESIRI,114511-i14.03;MINnift-LiftliTiggiFiniTaffig31:17737AZIPMETEMINUIVM J i tz 3 El r-r i...:i Lii:-.-1 _.. S , ; 1 Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 4 1 , , . HDRENGLVL7-FF51 1 , ,-1 I„) • 3: NE 44th St& 1-405 SB Offramp 2005 No Action 6_ Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak T.v;-:r± _.,�..•.m,• .,T` -_"''a'xs#r:; �,n. ,1 2 :r rn �:.d `; r:§�!t•:,.,' ..; j ~, :. A].«. .` ,•. - i�c�e�r��,p~��1 ::��,.��r�si��#��s�',4:�`. .$��zr,w�s�.:.�:;>,::_t�.r�T,,,:r�;sR..w...�"B�_��.+F,�sTt��.�.,...Q�_x,.,,.r�� rffsg Lane Configurations_ 1 + 4 r - :U ion?Wimes 00-i. 0x �.Yn p OO 90 �i - fgg .QOyy Gi� apktib ..,a`�atu� ..o_,.t Storage Length(ft) 0 0 200 0 0 0 0 200 ,_„o r+^•rr.-•: rrcrs a,f,,,�.,.�.,.,.,.,... :r. :a.•.,.<,,-;,,..•;:?.,,<`��,rr,,.••,:,...._-rig..r<-,.]qs,....,,;,....e..c..d+:..,...�..�+;:. .yarn+,..z"zs•._'!<+.6ra ;�r-5"� :,r,.r�s; !r:-a�4�?""fir)":fa`t, Yu.�'"r�l:nt,'�, a .-a .y .S�x.�:a„tr" �.jy<t,td.S•;.•4_ g`�•�3, M• �.. :-��, '��y..•r']' ,;,,"z •v ,.<- r,;XJ �.J T;;';'i�,�r,r �y+?,r,°s,` x '�; ('t,+, {` s.ar.l ra,.•;r f„n: :*'",'Tt-.;t Fl..rt&i.5•C,§rC:�. esi ^: ,,..F.,k ,`I' j"��a. :.•"R..Q' -'.. it Q+t, ,f.:,,JT"a'S„ ;•.. •NE '�:-fib»:Sag.�,.a::q�tl�,-x•��'`�`t';��:N.«,:nf��.r.•J.£r.•�x•<,,aktw,«4r,:r.t;�e^•1f:7ec+:,.r>7�-:.r3 .,�4t:�a+•.€A�"��'si,.;^ya�i:'Y .:'aa,{k�:°Y �S.ia-�"^,a-, w�`!u�Skr �`. >., ��rw �a_...dP C?F'�, ;N� 2 a>ti: �, tn.+„".:.t: <fGkw.,,,.�.&�, "Yen, hw .r, Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 •ssm+-yw,ya^ .r.--. •x,ro',:� ^.r:�-- -:-';{,s::,wb"f";...:h.::r'.•x..:�s>:�. ,rt,.,.y,F�^a';'.7`''' .:if•ar:"v"=P":,, u.'+t'!s-` wnig7,"°...f.r•'-`•:„�;+,t:?'Y-t7�ri•7;`-ri'R'a�. { `'{t�.a' <,'�`;� i�:` '%e"'�:''r':; :j" .Ib:..;,,'. =.i,.r '';ff�a`,' .rt'�r~t.. A .,,'x 3Fbz •'�`,C., �0d^,;, .'�: .--?F a+. Y,',r ry �y ,j- M �t,,,a....y=-t%.* !- ::fw,....�'';.,:9:,t', •�1:5 .s.1,9.;.,, " ' •;:.,. :. t}•U�!��`>~�-�';P �1S.�!5}p��`�-e.ae,::Tax,t.4...y�. t�a,#Et �r _.,.:-r�y�::r.a.,,r .• �:'�,:••,; ,,L� f�. j ( .�+`r.,, ,-'a, .f: .9'.�+r-,,s_ � (� .�r�;+t�'f i'' Y z •-,. ..�3Y:,, n.d..:Z .. 1.•�yy"��<��i=��+':':i%rSivta,. ._�t;z'�+7<Y �•...�;::�.i`.,`YJa.Y.:�.ns��.wiS�' G'„�'�.xr�Si).,.13f•S �-�h:}£wn Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 L., 7a- -exr•-mx+ ;rr;:.:;yU.�.,y��a,•,•'r��'p>;� �:t::�;3,wei.S"_v2r-aY-a ;,7.`(:ry-'{<,cn:�:3{.,5=? 4� a 'rtir.•�' '{�',R^9;""�'. �}r*,n:� .rxY.,`�.,..�n;=sN F.•..a,fre�rc .'`may '""•,Y.`. � �ti .,ec `'4t"r.1''/;Ji(w rr,7, wx;.:,.';".tr,..�'i +��+,, ,r"r.r,;;rf t-s i. "',,`2: r „c ''. n,, :i? {� {'., �'•ry. xr � �'�';J,. y. �o84�:S" p;, r 1t �t -�"u'w..,'',� 'tr�- 5, et fk',,."� „z$an7 ,�.�,.r'fa�<r M �;�r�,'��c�,�`<� � C�Q s;ainzv.�'. 8::'�.w'�'...i��:x`ab¢uc7�c.s.�R' .,:=.-.a4st•,a,:.f!:�* ,,,,,?i�c4a:::-;ab,C'�•.K.l'.?,'S�Sia:'•evxr....a:'�33Yi;d'.�':lM'«;�r:+.:rs ,Z. F�fi.' ,..,.r'?�'.f� •..,.<,+.v, �i'�',..r.'�s:,.<2�si..iz :nts+F.,...`�•..-.rT+:u' Flt Protected 0.950 0.954 (- -ce <ar,.-.,a,r +cArs„'.z'r'.c,�«� ;,2i ::-g.r ....urgsrz.�,TP2' z: tK r.yt -.r:sJ4(nA:k<r7,,;- •��f ¢'y„'�rr-'i•'"�;zEf«_ .-0Fr';�`,> ,:p'r'.:w9"�`:v.,. -yl:iM �y ,;,fit. -t•Sf"J{r r �'� �n. r�,... - (•_r]r�jy��„. pyr��tr�x (� q}<, '.•,,.ri, '{'3.,. 'o-E.r+r':-c YS`.ry-1•`}p b:xY,,,,s:, '� },7�} .�.,,:�{yn� I� p,' � 'L' ),..rd C{g,�.{.�ycyx Q' {,..�s�r.iyl'1"Y'-44, si:. 4 A,.t� .r.'�� S iw'C'„"y� >iilf11�n.-'kr :'d'�fJR3,�d�'3I', AA-rt t'>:1;�f;02 M ;rl',' �/,� J.*„�rS1Ya6N��,r�T•i„ 4....y�.r�/(��.}72B :.1xk��iRnYi'ih",GFr. ,sft.. , At?,<h! AS\��9A+i L.oL`^.d'i�"S�Sar': .^r-sN r;:.F ,�rfir � S2, ,2..�'..�r 1 �. .r;Y{6 .w:�'?S;F.nt'T-.'c'.-. Flt Permitted 0.950 0.954 LI r- -r, 've^M ^{m -.Tki:z:Y�.,• n:�5'r2P.a .:s':.:z�+S°"" ,45�<".,'7,a' nb� ..Ui�*s'� ';{r;:a„=7:'�',?' ,aa'�rr*v�-�;�5 ..+'•5. '�".2}�""�' =,�:�f�ztvar',,. ...��'2^."""' , ,,,Y.,r. <.:,;8' }:fd .ijy. �s k f: ,;:�.ff s:,.{j'. ;,. r Wa �,.,' � ,V , ;;> Y a t't Said'01.1-.ct Q. .,.;,.; ,,.t ;ske: , ,),�:,: . 3 . g.7,7((�� .. Q�, F:: ':v, g i. Ate.,. a - ?,. Y. ..�:.`a`-}:�i',3rz„s��5rs 2'.M u-ESL! -v.,•.:rr�.:,s•...ta.`•N,�%�'i"sr?3 (Sr.. �,S.c�:,.:.n.r,�..:.,c .XY.<.. Right Turn on Red Yes Yes Yes _ Yes _RR,_" -'.rEwe• "�z'G y'.,�t F•N?r;.q^.�;svr<,'*�..=,':n:r^g+,�.x,!�;:�. r^Q c-' *', ;, nE'>�ir"-:.y a».�,rr}v-e.+,:as;-,..�_..:�oraN. A'rF;� p JV Y.y 'r`�,,.b;1 :,l!'u,•. z .] rrP e. '.:;,,' ,:I,t ��b l"j:'zil,-ayr, `r�%%:iR .k" .� `r`• -5 rrs r`r`•'v�FINSIi'r,„ram g s��a�Frow� -oR: ->r,� >~�,, > }_ .Y.��;Fr�; f3;,� :r�f•��'� � ��>� ��' r �� f'��Y� f,�'��. z,,.�._,,.��r� :��;�,� u:sC'< �iti�;�..sf° rtr_ tzx.�'•f,. „c '��.».s,i:.e us ai>lr ..tn.:•s.,;.r'.;^.ru:-�°.:c�'a'�,?iN„,..r..,z..:. 'r+ssesa, a s,,..v -t3&...>„ f Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 ..ya,^..,:'.r,u.:+ yx:g•r '.r, •y¢:u�•,., '� ''Y" E%$:`a£i:' 'r':r;,ti d"a^.SG""'v:`T �S;.rg;"' ;'r•.gv;ari e;:3F•?"% ;M;�'°^ .hy`"":?a:-.;ax-y S..'+YSf'a98^.„': ;�*;j'{i¢, -,.,u.'^.�„;.,,., ,.; �n . - ,p aF'. „`;a;;'< ? ,, r'' ' :i:,.., s t n1 Ft,:,;':'_ ;, ,, t r -„-,-. ea ,.,,r•z'.3-,0� : . ('� 4� .ed��..,(/,�r�(��:�'?!'•;y '�° `,t`." 4 a •`5t;tu,'.��:'.?,..�., yi. k,d.;.,•+„ � �,,g`};•� QFJ.' air.'`�'� ufi �g":;'.xt` �,�,(r ,'Xr # ,, ��7.L�t,.-.�>n,A:.,.al:f.£MRY'f.�,r�"1.4it✓•.'r '�xrFsni�:,.'.:i;�r,..r.S,y 7:,5.. .... ,'�„'L6F'...urJfS.G.i.�,7Y"1a,.•�� f"i�,d�7'.4'aeu.!',:.n-,,:�z�i'z':.il.�.%FC:t�,'�d-."zrif�;f,....s...u...r.A!;Y"•F..nW,srnz:;.?�.t...; c�r.+3��sYfa,.•.a-a, v'�, Link Distance(ft) 288 572 1320 1319 F^✓: ': .F., '"1'<.''Y^: ..'.),^>t";+. ;E•f.'Y; :f..,�.n<G` .''Ye'a$J'% -4.cS.~,Z'i`t. '"x�+i",�C,y�4' ":`r✓.i: vta" '..^+. -n•a.' r,t '`�5'-';� :�#;:' .i''rz^d-r,...� "S:" Z. rg4+.; ^-:s'� s•"* .x.., .4.Y!fe�,r ,J` ��r'ys'� ,.it' '.W., ,�y'::•;��;:. ,`•v,'i:.` .�€•«{"'� %�s!'��._�-sr,`;. �T/� ,ses-.�.e..+:r,r ^:R- ..r..ry- ..t$ +, �rn :,�, Y.!tM1.•-2a, Y • ..fii - d,P 1` ,i.7.;,rr, -1; it 1.,..... ,! x,i>^':":;'hei .-i .tr. ..}a'�-''' 2 Y:a 7''Yd'`�'grrl"�.-I'!1r7IC�f�`$:..3.t;.:�.i , tr,�,e'�J'L�. :r�•..,..,..t?fi��":'_:?:n.•`r<t,.-t:�,a'"::ssw.. :.r<:_ta:;:- J.»...-a.x.r »`:i."��,.r..Est!,c:/,�iii::?4:�n�h,�'aa.,� -....�,.,, x>..�.Sv.,t.:H-,.,n3�s_.....rL.,ur.,:,:.�_'ni>,-'eC=. - `=`' _.�, .n.as. .,,.. Volume(vph) a0s 155 �21 197 138 0 0 0 0 176 6 190 ' - -r,r.-`-.:^..r.••,.,� _ _ _ ,:.ar�•,^` :;:��:rr.`v_ "Tvczr�.....-"+...'i' ^,$'-=:,tr-sti^, ,�,,„.afn..,:_...��r-,y..r:.;.7".?frv.-yy,,;,rr•' -„'•4•';�;�i!-..c.,.•„ .`,, •-r>,rsv:xv,ea a :.>`:}';`x'✓:+. °' .�,•i*� ;s•!. .;>:^;`. -:.r:.. S<•.c';'P .u'%-rr. r..`'..t ir{._.> x. >,�a`r' 7'6 `s . t. r r";'r s' t.0`82';>:�:;>.Qe73:�;'M 0:7I., ''�.Os73'r; .,�s9�L: :`0.92 ,;f]:J2 1 ,O,:r.fY 141 z..a=;0. �'ea�h&�;�90,>rAF,�c(o��;•z�;frr�,�>�r.r��-.��:�82:'�'s:�',....1:,. �.�;,,�.: t...,r,,�. ,,... ,;��u.;K, -.r.�.,.h.. ;�'..�,.>s.� .. a.>1, . :,:�:��..,r�.«_._..,�?.�.,,�<- ._�: Adj. Flow(vph) 0 189 26 270 189 0 0 a 0 0 232 8 250 „.,,.r- r•-' .,ar..o s�cxr:R,.Y-y-.,:r,:R. •;,�,•-x:. =a•:r• tea,..rr.��,;x't:J`F:"` ^.it�'c•�ar,M�,�,,<,r:,r' :;a--u^•-,t`71 t, reP...'S+*. 1. ty,- ,Jack;. t ' ,%C' ,�,x^ 3`P[..a AA:i -V,'�'',k 4r;:a ..Y 'xV,'I ,4.1 b<rr«... r... .; Via,.. =;,Ir :,< :.,,-,, 40. ., M 4 .�� ,F„ t,l.x.y)!, ' :i';n` :r.4.,, t �a'j: I,:; )..,i:•< fi`.'V4:;e:,,�-{iFr,. '��r L. 7.`�'' ,i: .� <G�,'ui (Q 'h f.` �• .r�r1,5i:n ,O;t, ,;927`�,Q,;r•>.'� ��.`�`'"�;�r..�'''{�^'- -r.�.�.,,,,:„_:,,,.,aL,.,�..Q:H�.:.+:w.,�'Qti'':;%��; ..,...,_hr..,w.,_�r..aa.�_..�L,�.....«r Vane .!'5�..,<�'s�...w>�yP.;��,,;��a<:,��-t..-... �.��..,,...,.,.,..;`A=:. ,u....::;<a .,.,. ....; .. ._. ,.k{r ,,�, Turn Type Prot Perm Perm 77 ,��., - ::y-+:.` r:;:. •."-'::, s''A::S'T:;: c--:r`-r�. ,;:Z+C+'`.;,,.•�+1' i'sSs; ,.{.may,... mqv, Li•,..�,- ;s,;,. ;t;.yc•. F.,:• - .4rs,+ 'cya m::ii'' -.�a, ,.u�:"'.:;r~. `+�'?i ""vf'f?`. �r<- .>Jl•E,^ 'YE'-r N= ;:zi .i'�'.. °;:.' :.F:i ,T��r, 5r.,n �Y^^ ,y.. <t„ .�ii":] �o-. �, ' i.»R. •`<:i• r.f. ?rr;: ',.y,•✓a ,.. T:� :»<. .r, dii..�.,,.y.:e,r= ems., '�!!}r,. .:'�..,%l:a `7?ro .:.V' v�,�%.,a„ ,,h:i re^:.��' ,e,.: ;c.a� •-.;a�`-''n�....,c`r:ei�k�'7_,w� ��t�Cit�dn�fd_�`S-Q,ev`�,.,�.x^r.'31,+:a(.%.L...r,...,.o......_.,,'�3•... ,..,..:.';':«s.<-.c.,•.:..'.s:_.., ... :`.F':, b..„_„?P..r�r.�i;.::.r.�v�:�i�ss':a;'LF,:xl�a:G',:,t:c,��:r,r....•.:3t,:;�1,:,':;;I;'t.: x.,. _ , Permitted Phases 6 _ 6 - - ..:p,.;; - ^34.;= :`FT,t„•yr• c:ia-:'ti.?.^,+'.,Y�+�.S"^_„- -•u-' ":rSix..,;�.- ;^.ru:': ^::iV::r^p+ ,ri3- -t'j, :•'ZY['.'.•` r'f:li5"` .:�=;;- i l.r;;�'.:.je+y - •-�Yt.`^f��tt .d�`?i?t ..�•) '.�� Y v{,;�. •':}:_1 pri-.`Y. ,.!R er�l'".'.n.L4 ;`S'2!r 5;,n ..eb1!a r E:,, ,:;;,R ..r _ _ kx tr2 �:,ai,l 5':.VE 5 �•y��'�ryf�+t1�-;y .,;.,:<rs;,, .r1'•�<0:;-'r �...�:M .1'10. .41ti0�:..1>;•, ��r�:x �:- ,_� ,,�;�;<.;.?:<�...... �: �. ��n•;.7:;i,.T!1'.�h`?Y..�-'.ls�?:s:i^.'`.i(.rn:c_.. --- .. .0.. .rr,..n.3,:.- ,r a„^o.: .. •r .,.,r ''%''�'h•_.. � .:�,?i:L4l.sr.....a...>3.� , _�,....3.. � .. �C".z.......rrF,k,.n.. Total Split(s) 0.0 25.0 0.0 29.0 54.0 0.0 0.0 0.0 0.0 26.0 26.0 26.0 G__ ay., ^r^. xy•i.`,a rofl,z-� ca�,,...y,... ;,F�r_,�;,r,,.,.b.:t`,$.T:F"Ei `3 1...:� -sr 1w:»,.. ,,::,..v+._.., ,.ar,: rr•_ 'sa.-..�r'•� /_S.: '-0" .,,o,.c r. >O ��0 s:. -4, t,. �,< :b .,lS :-,';trF..,.Or 'o "t'.' .G'+;k..,.e +',� i'8 >k�-f',{. •s3"(,+. , r� S�Q ' ';,is.��* "'titi'r.ur ,3 . ;.t' rr'�., •,Q•, 1`':;c1,yTMiii O• :,t-.� r.•f• „,S:... "..,r.0 C,r,,s`.,.:y�-, Sta#'•3..7'�O', :. .4 :,t r- 1r ./��i:�r .'.r.": v .?��7;�;:�0;(,0' .;x; ./d"faa�i<V/.g:3,.J:36 0��"�s:;> $„*r,,,.,,.,:,,;..4 �, �,,.>, �:�4�>r<,.x:,.:.,,...... u:�:t��...,.t�. '��,.� $P ��'(,R�i•,... ,^r.. .,.,,,. «u . ,a,_ ,...,r<..,S.N,.9�. .a,i....:r..,.,.:.,....<iv._w �,nw�.. Yellow Time(s) 4.0 4.0 4.0 4.0 4.0 4.0 - rn:,,:.,. ..r ...h. ;:fir, ,fn .;t:rr.: u;+4;;r-„" ''�c':•E{.f"s'.'tF`:;F'•r.F'k?.•J:,..ry„,�t',._diYdr�:`F';,y.,. - -;a;`: •em. ,P-,. ..i'•a ..}.� 5{" r i!� �.- �.�..�-dip a,l,;.,. ':3.`.. sto ti n0� `+ar: Si. 0'*.'i<`'C;, �'1-. .rr:•,(,_. ...F. 'a.,r , .,.-ac-:i•�3,. , -,'I=.edt�'ime'• ='°�:f�. .;f, .. ��0'-°.. . .,��.,.._. -.. , .. _ ,..,.. '.:.a::,. _.....�.:r:'t�:�._,.::.. . .._....�r ._.. _..>:.�._r.�, u�-. w Lead/Lag Lead Lag _•,. ^.att :r'-:r :r.. -•r;•-p.=i;:.n>�"s<-�•_ °^.`;�'>.:zew,;r.?a.;;��;.-.:,,;z+x:R:>`�z-?,�,,>S^!",'.xu"'r'C•�.E.,fi:wx�' �.� Nf�% "+H'. �;t•i MSA:.^.{^t ;':i'S+,` ,:�:: s:..,rR.r,.;,_ f�';=:r^� 'if. ?.j. x-t.=..;:F,� .r, ,.,��,',... s - ...,.>•L.;,.(, Cn.,,-..F i` ;..t.s - '-i:.. yr �rF', ry,F, t: _ ,{.^ s,{,:•,•. r „r:Y":.x-"ry'�', •;.1�=^ .Y::;: »�sj„ "•.1'.,1. .F-. rJ^., :>Fi �dert )r,c r`,,. -F `i1.4'frP.:,,,�;�`,r7;.,.�� Lear.. °�0 �rmz�+.�,,z:'.�=��. `�:;Yes;,,. ....r.,>._�.r.. ;�i., >y=h:'° .;.:.<...,.. -,,.., „�r:,_ „<..:�.;i.s;�4=�...Yt.;_.,�.�...,_..uu_,:�,�:. Act Effct Green(s) 20.0 24.0 49.0 21.0 21.0 .,, e•.,..,-.,�..,...r ...,. -v'.<.,n,r.,.....,._..n.,l.ci:r`n tx-..,:n:.l.,,r,!t:,,,..z•�;:{•....,w<:n wY'j;,>,�;., e,:,1`& hi,rn, .kY• k..,H.... r.....;_.,..,. .•x-: :^n,:^' :gat: >:n - "i a, r.t x,Ns <a,4<+.,.+?,:s ,'.>.;^. .c.d•A,`-;E°n.xa;Fei;:p'.^ n"±;=�a' F'ip `:�- .•,z•:•'hr '';axi>J r`-i .5:.:;, rr� '�:rt ki�;l.,,,.. ,,.+„`Y:& ;k,%'m;.sal..,x r.> s.t p ; .26 A�'f�Nj,,) eTTjj f/� `-!f`r-:y:>!>t'..;.ir .l., r;,,v •i��/•�'41'� ,�y) J�'`, .«.0. j.i:r ,r ...;c:. �::%.;.:::,,3'rti.v;.Pn:i',i...�i: .a y +... ''7.2V.,. 'il�ptCl�'>t1I,V:"(�a}�.�•'>A.jr., per. ,U.�i�_ .,U..4' cB�f:;:£.i'.ta'G.nm'x.,'<>,:Gr�c�C,.::a,.4�+:`:`..,Fa�.�.frT.,W�'tiiV�'`iY,l;,�':•a.4r,'.i.'.>1..a,:.t.L`�,r.,.r...u..�a�r�.�zs's,.a;15k..:,x/rn`Yf,}�'�&::?^.;4i<t F.{.� ..,.0.i.�:1�>..,r.cu .>7�.• .J,tl.,:,....J7'.h?..,4..,,.....,,,r,zn�;l�-fy,,ix<(`;u.�-:�r;, ..�">.,aw,. v/c Ratio 0.46 0.51 0. 0.52 0.42 •t'•,..;: '^4,M,•r i•r'F,,. ;?a 'v1i :rFY% x.A';' .r1„�,"y':',i<,k:^T 1. .f-��_ i, ` F: rat, ,.;Ti::.;.,�.,. q'S`•`i�y�:,, .t:.:. `..h -.,.7+ •t., e.," `,.ia' :o :�S'..4,. jS A.;, tf { -.-a•t �I w1._, 't('i '-.g.K:'�.�..,-„!r. h;,;y.,'4 •r� „I-, ��'' ',3:. .,y�,. ;r.�r`F.4,v�.: �:�,t.,4,1�'1G3:'14�r.�;it,:6;:["'+.s�^w,,. trC:.6`.:'o',.xY.4:.i`:£+1s.dfa,xre:2.s�.u:.?Tr:::zl:r,rfwu,.-.u,..a"a>99:"�.s..s.;(....,:..,.-�n.?.?rs<..r� 111'�I��nl:'DP..�1cy�...._�.;y .;..sX��'.•...xrt=`=. .,..;.tr c,,,_,�.r..r.,`.?isk;Fa.,,.. _..,__r:a.c,,,asfr.,>,..., Delay Tj 25.0 13.3 2.3 25.8 3.7 y�p - �lxs... - ,emu. __ `Y1: ,=1•t-�;`rcr a�tn<-';,r �,q-, ,:S Rasa• :�,�x_{;.;�r'r'if.S','z; .�:;�F.-n"p"�hP;.��;�s.•,�•i�"fc ��ry-"....x-i g0.0,...�L'.§",:+1' t?e:s�'.s`(i'"rbT�.S;E"'`,r-.,••;j;�`): .�.',tfc�r;�; .:$', r:.$�$ 5•f•:r.;'�''`t' ,,1�`i1?-�>•-�.t•w;.,��i«a .'�.�_a`�,w, �t .6'�•`,'�•�,�s^' i 4;.,,�P` A 3• (~T'+;F'''SY"1�.x• 's*{ tE »'•-:3''F�l: •,.. S`}.:A:u•,:y: ;.,Cs`iw tL x#'1.E�;��ik<• E ..x.; A�i'r'r rk�I :sF- 1rr f9:c+; ,! '4 Fi •,mra i ;,. N�'O: ' i�� j J> ,rs,tY•a a ri:..,2..sf ..•...r .:t � :...o-, ,<r..s. Approach Delay ' ,,.. ; ' 25.0 . '8:8 - 14.5 ' 1 a��g. aAr f x _ k i ' n» 4d n � 4h IM E mn nb] = _.r q: -,tti'h raps,;:i?^>r�2te; ,v<.;. ";�r'�,�'F.?•s' :'t'T"�+-a:,'r_-�..c.;^w"x.,,;:�.y.,r<<=v:z�:.k �`:i''•`:�.••;a"t!+�;3£`. P p, 'l:,.r'�t°�y7'�.....,�'� �- zy ten».-�+-,--r.• rli-. > _,>�y «i.E;::�';*�:��-,r%J;�"g,,i;"t_r,�.`,�`<;..`�tk"�a:�.,r: yu�>s� :s°�s a#,.,.,. �:kr, *"''e`,"•�` fx �+;-'�• ti .c.r. r.,? I�easecUon,Siacrama. .�;'� ,�T�,af;;`�lwF.pfis�1wyt{.�.,,✓C":,3pe:C4-?v'a+,:., '"�a-��`uiv,:�:?,Vv,u=3nt}.,�F:•.;�':::r.,d'.�9«t^.aexr,r:l.�i �+'�'J,2�.•�. P-lA ;Y. n=fti.lr crF, [S�+"• N. , - ,<w:-r', - _ .-v�r• �'.,xrr-x(" t;SC"'.;'.._ _.�. _.?'.ice - ;mat;. "Im's�z�`" .xrtr:t:i•;u:.0 ,+,.a:+.;mx:xsu;: :,,s, `-,ram,,f:.'z,:r':r; dp rtr er=-�"� >f'', '>?'% „� .%i::'i:?s=.ter: rt,•X.k. �:�::f.�>:z;: .t•>.:�v`"i-.rz�"e��,:.�`• <y;1-`:,. r ^' yam, ;i. 7 e" y, ,�3' r t F;;:rrr y' .,'T<'_..:';' .. lga xti`', s.., xY:",e n.2�`.gsf�'f rt•r ; r-a� r.�.r^rL,`a. ,ys�r�- �rea�R�XP�;.�:>,C.�i,`r'_�L'��',Tz`��:sfr��r®�lAeljir:�`eta.".,§�nG:�"ii�1r4}x;�<:�;x�E�c`s'a`Y,.:�i. �y,.'..f..�.-,{ 4�';)ytpfi' ��;'." �.m.`�.T,'�„f;J�....r�t��n:^�ry fii`:.era'.i.""�..4,::,,,',2:iwkv..-.�X,� l xr d:' 7n:`Qes..,�'c' il rrrl.+�._u.�'9,s. Cycle Length:80 td p erl(1i� ;;^t eg�vgd p1? gt2i.an .STgStaAnre aHa e6 {��ME��M M Natural Cycle:45 e,,;•¢s n. °.r;Y3 Y`rt: ;^sri-tea s;J'rx5 zt. •,y,,:�„5...,yy,,c,+.ym�i'fy 3"d• =ti,� v',•k+.��-i',•w:j i _,,x.;,..yz •-•� ::a;_- ^..vezp:.. `;Y,•+< ":H'r :ra=`Y;:" jfis kt=- 'f'.c $• ni;FS"; ,.^ •Ya�r .. rwtK`r. r, t., p yy,'a✓v .,t'' `r.'3 .a.r,. :^ _- ,..s-,.t,.r.tn,r i.]7:2..,+,r-g';s"whr,4' 3. :''$J .R�,Xr- .z fi{n. kY£5. ;,hYlc�nM.'M:"E ¢ Q; ,% �.Bp7l' pU..��<�,y;},,�a$,>w;xn��i,,r,,�.::�"J,niy4Ft«�- `��t>�+t:...t�„'�"'}.r�e,''�'r's.$,">:a ?a, 7�r: ;;,;ia:t,.�S:.�;:r�.G; 3mr`=�,�,�L,u-t:1:.ar:,�c,4;•,a,;:, �v��s r,rA.�aanru�saa:�_.s, , I V<br�t�Q�'tt:".�',C"� .[.�7, r,7F1:!�t,..._...,...-r....:-r�:...�...,,u�r,r...,........�.:.... ,.?i:`,...r.a:. {..,� :zR::4tdr>F�,�',.- 5,,..,.., Maximum v/c Ratio:0.52 Q _ .y •,•:o,<n�:- -.rr.:a -,:<,:. .a �+:.air :>-th•'' "°-s1%"rS"'„+:*F�.,:r; ,a�N�t-�;:r;+ z,',.d�;;:et"z�+atf�^�'�+�.`�',;`+..�r„Pg�nrs�,.:5`n,:-n'{* .^air:. .ttx». C �jst 'SY �:F,. :'$,. <a. `eY .fE. t`•- r, .r '1. t .x .. :.`...- `?{.ir n,Ai{i •, r�T•r ry,�.; s:y+f,�;, t '.+! r ,r �,,7{y,� I ec�Id;��i'�ai,D�l ;�fnt4.�<`ta>«s:`"f5. •`T"`•��.' �:.;'•�lnferspec{ion;�OrS'rBtux�''�F;r.._..rl.�tco4,xr�.,>.5:�`r'�.G,`"t?:9:.3,ri.�)s3:,r.^'+..k<sx"'w�-�'.Sr+",`:_: s.<:.5� In`ter�..._�.�..�.S`g.,�.�:..<.�aX,�..�:.n,..a«_,,,,.,-,._,��::�:�_::�-:,..�.�.,. ,t, rti.°_._ Intersection Capacity Utilization 52.2% ICU Level of Service A ; M Splits and Phases: 3: NE 44th St&1-405 SB Offramp tm Fl.in s�:r,.,�u.aalAZ.r.;u:'.,rr T aa.:3r..S,d1 x . ��",r:MMUSt4 tWiu ua: '.F,•z':^ ".�.t'.e rag „_7 _I 1 S Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL . Page 5 :'_°r HDRENGLVL7-FF51 ',Li 2005 A. M . Peak Hour LOS Calculations With Project CD Ji a 1: N 36th St& Lake Washington Blvd 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak --'4 t t \* 4 4/ 46-- a.r, !� p �� i 8 4 Mg1 Y A W r1UR Eu aISOMw FAY R ;t icet Lane Configurations 4. 4 4 4 r•'7c-,^:7--`N' <^.irnarc}..y n.:•+e.z,.;s,,;,r,•. �ra�, "-. ✓£:s ;:3?'"y......;..4,�; :z,r .,r.;.:3e�.� ,a;`t_,':. _t.. y�:....,t..,. ,, .. .,,y..,.,.,_ atr' .to.°` 1 <° D OQ'•;,-,::'90'.,; I <: ':1'i�q,- Or �Ys.1.gO: 1, l•; A C�OQ , 9LTICt � (0 _�Q Turning Speed(mph) 15 9 15 9 15 9 15 9 .d4Y•Y� .•R' n TuS�..�5 s,4£ %iN'`+;R..,r yi a..» ,j,•,4'��1:," ia-fiY+�F(M rn•�+s v.�, Ysy;<r f.7•v Fvr R',! �c- ��{{ ••�� .r!'•1,� 4�"•�a:. �'`"%a yy .,.i ,{ .�.^� n ;�c,y .'s�?i. ':'%:�'�t;'�,y.�; �:yW?s: �n' 's �,`S`y,'� � Z''f-�f�, 7 '�rEtrv:. L rg§{V '�•,i•..• ku �x�.tli :F''.•7.f4:.' .v . ?I'dVO. t:'•3i r{'�Y"�.,k"4;:'1„'.�s:�7» gtQeF yig', V, ".t" .` � :;v' ':, I( +• t'�! r3'i'y:•'j. �t`.5*z;u.. ��{}�) N s�t.,:.'w7.t'u� SE,'..'!u�v-Stt�:sr�tb,h;:Y.x).F,L,SsTi��'�'..a,s..i..�.:.,;in mow.�?�.d..»....mod:�].�r.nsa 1^..:.{?zrw.��ra.:�7s��sc4...,,�.,tAY/xi,.:,.'k�, ..c�CrZ.:,w......��'�2��L+.� •X ��.S„4..v.—...,. 2�..r� Frt 0.955 0.870 0.998 .•:e-r� •aY'.wr .��r i,�.fi75?'C??"��`,="S7>3�5,��' �'�.wx �,.""'�:/3(Cr^+�.� Y� e 7'::.'n ;�.,;,F' £'•,,F�;> P..�.r,.p�•.'-6,�' a;....,.r•,»N 7;s "S` t�;�r+n'. F ,T,.�...-i � - f^ �.�,trrtT: r,3,�y�.`3'.:x` su:C's'z,: q{Yk S-,�.• t-,.'.`,; ¢.ti�;i2,; <rq i ''.., Sli:?;r fli'po.�z lj f'.,t l�lkP[O�eb'�8 ��vv �:Sr �� ai �;�9.8d:� i:�„ "'x�:'��tlit�,.�=s �z ,a,..':r,a ,Y9't`s.�.•a„ Q�J9 r- �•.. 3: �;' Y�t t�,+ �'�,*.fi�3sms, zTT.'a`Y'Xr-�TIesE�4.$".s$m... 2.:�,r�i ,rvdurv:u;+.%.!: 7X.tet:i S�.&_,.tic�3r s,,:saee3�:�.c.nn�7:;::Y<l�•;?e&�.SS�.a�.i�:F�i:.n- �e.`,: '�..: ..i 1 Satd. Flow(prot) 0 1750 0 0 1621 0 0 1839 0 0 1852 0 �� Z � £ �x �NIN r ri {�E m��1 , HN �pR_ s M ",-N4MII Satd. Flow(perm) 0 1750 z 0 0 1621 0 0 1839 0 0 1852 0 - 9 e aare�W��n xi b moONERN QxNI NIP TO$ Qq Vr M 9 O..,R [ lag 1 Link Speed(mph) 30 _ 30 25 25 -'I.v, 'q"'9r .� F+.,.¢ ^,,e;. ,.� ,,�,v �., ^.^s,.,.s��s+J '?["v2r,;R Nry^., ,�n Yt;'w�.�u-.� t., .•,r,�.. ..w.v,r y .. ��; F", ';,`1,g•(,T'""""$'.',s,',,� i�rrt,'-;i.'�?/'.drry�. '�"-t�»++''i"l`�e' 'k,.Wi ,.O. 3} 3,.K'< ., 'gw .;t: i i' g;,'',`r X";,/f�i gin..` ru.) I t •. ", i. ",, gIS' ^,� m:t.„ ;" t \ + f' ^ i•PAS ' ' x v M'at,. .� _�� i��' ueaSx,.uv�.�' tsa�:�ki.t.F. »`2�r.�c- :':;��. .� �.r�:,�?ws:� '�1'>...�..'�`�� .,�'�,t�,�s.=::y,..,:`"m,•��'�,��c�+ra� +� �ru�t�:ev`�5'�,�A,�,:.��,` Travel Time(s) _30.0 30.0 36.0 36.0 -L- f+mwsrr::,.-r..a Y.,Po?^pF •:Si;>^Y 4'zpuc,.�Fx^,u�ir�.:•�.r, m--Clrg '�,ctxr.. i.�hF't' w;cp yvr�-Fi.V'Jr.(�•`r�.T.cT�`a:�"' ,�, sTr 'K};al.nyh*^•��,�<•�.`�rtFi°s°.'�.%'y'•1xs', "j°`�;x`g�e I IV. .,,{ " qZ7'y+�5,_e.!it�yl��Jy. p• ".'}>&:n..6.'1'• ,iT,{r. 7(�f.tl,;�b.• y,�Ac`emsr y-lg.+}yEFj? j`'.�.,y,{;.`/c'2rr.. c ftr rtL%•'" ,°S '., j.mist` �j� �j' ftsf.'. �.I,fmr-:',u.+li 1�� `.� � �a K �. .0 I��•! z 6,,,•2.?:..{,,��'ifr'l� � j '.� 7?j y t`"r .�+eG�y�. �. .C't•-:,g �F t�s77"^_ `� L6:�F5 3 3G:a+�E:77k+a':;tsin:`."vr�S'i:..=�:,3ut', ..ul �G•ra::c�S�S� :rt�,tv�,.:,.5'%r,*"�.::s.`�.�ntt;ls�.u.axc. ..r.,,.rz-.�� >6aasat �LLn?�.�.zeci�+r:S�r:. .a:4Tait., .:s,S, ,,, Peak Hour Factor 0.40 0.40 0.40 0.87 0.87 0.87 0.88 0.88 0.88 0.69 0.69 0.69 ffpk�ga i� iitliM SryJIV E 2 E u_ Z O r EW L72,g . Adj. Flow(vph) 15 15 15 0 7 202 7 534 7 23 183 0 . tr_.m�. ,r= -mx�: ;+: :^355'r.••«.a--s.;'•r:e.. -:*�'.�?7P.t'?7'.;�` ��=:•�:ii�v.rn^-`?tFr�:^-"'�i%t:; •'?$-''�,"`':7if��xr`;°;��-,�-;zy'F^"",�T.��;'9%:;:�:;;' �-yr�.: r'�'�,"'yr'°_,,, "'"'.`��'3�r i�: ..t rz.<"+., rv,': _ ,Lr ..t,r:.tf v ,r, „ /yi :k.�. !T4-';s > C rae�GCo �o�� u (��'�.,,,,. y�p,. ;r;�S�:,a.= :� ::K'� ;x.,,,.2Q9.�.;..._:.;�wRr•��. :�•<,.Qz-.,,,�5�48,... z;.... p..��,. ��UIOG�:�;��,. �a.s_v: _ ��5••a'��`5.��/.bn....rrnrk:;F.�arf;S:...:e � ..-M.....SSA.'..,.�...wnflLh;.:`4;:��-�,.P.',�..»..-:,_,�-.r.•.•�.v,,,�ds:•tiuP ra L�r:-� �mv.-?ni§�i..:r„-.r:e�.�::- -�c,r.:..,.a:w.:.t„'�...:;a.:u Sign Control Stop Stop Stop Stop• ,r-^'a�.vrs:r"-r9;-,• ;:.r+ ,;•cap `�:Cr_ :rT ,`,;;S,K_.;. ,:,c•m��;Y z!t;a;,;�n'3s, .}"- v`r°r'�M�ir-?,--�,e. "`�;"`"'•t.3 ,.:(,v':,^ •,s;;: ..tea•• ,=,.n,'�"K<�t�'d tR!T7.,t.�'�illQ.r'i5?Sit .d. y .r�j°3 N"'} %; . &k�.tk�?��ey,s"K,z.J': 3''.'t5'v:°°.Tic.n2-.'�.x,f+:� 3i��itfr..u. .Y;ti.,+;.�,rh'-ze°, +,:w � �-" n.:.-:. • r Area Type: Other ^97n��SYTO 9 • MP : ti " m d„ E B7 R .b F 5 Intersection Capacity Utilization 53.4% ICU Level of Service A • (' I , c f t.t ' 1 :L, , 1 I . LI1 L „ , Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 1 ..7 HDRENGLVL7-FF51 T 1: N 36th St & Lake Washington Blvd 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak r— .,:•,r.-«.•,•„,x ry'�!�. ,e.rv�."}..�` r _ ...,:. .. r ,�p;,�r•,-,,._.._.._Mr;� p-"`ny'7,Y""." cp- r�• ;! 'Ft'''w''. ,.:>;: a1.+"_ ., +"..„MRZ `.`,i,. -^Ff':�`-.'-w �.� i;�+ i3. +. g'+ .4, ?"",a,t.•_:.... �V8f3ter ;- : :wcs; .,;,: 1': . '1±87::: •retC .Fx,_.wiN; .L�:'WTF .., BR;..: E3r ,....,NB�' '�?, .kfw....,.NS1 ... 5� ,:,.,SB.f Lane Configurations c _ 4. 4. 4 -.^crn^• n.„, yig•)A+".:.ra^ •�..t. .:,uxt-r rt.a:' 4*t`x: �.i:T - :s xr,gt^?»� SYr•d.::a'-^7"i."?3'�,nr;.,..»_,av^.id�r"te'�:; iR'�i�.�`'f..,'•xr .a,. ,xrsra;Awzg•1+,• .�r] r ;-� r :t� J,.'_ � <.s na... .sr•r.. ,4, .q :.r;t"�5 Y�.. Y„cx t,: x .>y:, ,. •r <.=. -„y�v:; o . ;;rd'$>.�•,s] ,r.., .::tii .> "x.k',•grs:„;z..»;' :.StO- ,us.,.; a``' „E, SIn� {'�O',tl'��`�� .[.t :Ls'>' �js k�•Fs.�`t0t� ':�-:,,._.,sir. �5�•a��0na,�k_,,c. �� y�:t.,,,+, ,7.. .•.x- ¢0y�.r,,;' .�� s• 9..t?"��tu�+wlw'•.�f�t..x,.�l,•:,.x,wS;mHt:)zf%is'�.aer�,t•:'M�i•:.,.�.x.+.x.::,I.o'a<.,,»+;7':`�'x :J..,,...w.,�xdit.c?}„s?a,�r<r<JIL.r,..M'�7n°+..,•„1,<:.r,<S,x:Rrc�,...x..•.,7.5s''.aa.vw.,:•Y•;.,,..r..4isti:!�.'Yii9.<f:.s,7`tN6G,:.9::..s �.�„rr`a..,.Cw.+�S,'tx,.L'nr.,..fr9'xi�,. Volume(veh/h) 6 6 v 6 0 6 176 6 470 6 16h 126 0 - .r.•c,:: ..x.•v et,,,,, _„p,,, .;�,. .{.,..,�xu•^ _ ',.�'.; - �5.':t+"1„ .�.,:. W;t•.°,f"' ,A,•gip.,,�. ..�zm; �ti- :+'x ;�•'`4�-er^�7't�°. y;�t=i1�"'`4 ,_Sk'•r f'i a+,.t. "c.;, ':'i lac, 4,a, r' �§" s� uah; _ ^Y. .�xa "O r<;,:. 4..;;0 ginggin ,:('$ .I; ��`..88:'.,..7t1 Pt'E�O.65.•>..�'bl 'n^.a., ��K;�Ou�"�,{�`,��?,��C;-�_ �,� ��r a U� blw.u��0 '0'�4 ��$7`'� �`�.�-'w,»"$:�,��<r� �r �„•.� �: ,�e�:,.x..�.w:w.;w. � .�, ,2f' Ji.r,. .tuk:,u.. �,.�'iidi:,,.,:6:.!-�„s.,ec».e..L;suz:",..,'".r.�.:..raL.w.��A.,.:rf.a. ;_rS� a:�v.df ae. xt� •X",..,.o:a �wza✓a.,v..f7a::..• Hourly flow rate(veh/h) 15 15 15 0 7 202 7 534 7 23 183 0 .� �.._ _ ,t,_ q�.a� - Wiz. �-� M �,^�u-•"`+ -;:^a•P s+'*,�x' " +ieF p �"i� I p�f ,�,.'.,��1.},,,. r-kr, �.'.e;-, t• �.pf"'•n` `�',��]�' ira.Ti�c •�z}t• T. °� � •�'A�ti,�A";�' t6'44r B�:�•� '1,7, T��+��V:1..•.n'-�9�,^17{J,`,�:ts»:I�J.^"'�. Q.,�..sT'F�^'y}`!":V�?^n'�' it,�r`•�ij4x� i>"�-•:�:3n.':."RSirSy.¢`,.� W?:'}t��yA' ,'�'z'#,' 9"pikSP �� pi �,r,.lx� ...:dC..�..,,�,.�t .. .. B -.I-. 'tea a.i;,nJi: .. .,tw.a-i', .rq �' �sa_ .,-•.h. Volume Total(vph) 45 209 548 206 'v rr-. •cxs•r^• m•�•tags^•_^ r^ 'rtsw'•x;fir.+,-"'E,:�zsr.s�:: �sy - 'tic• nC •+yY�°-'?. , xti.%^3�`.,�"rs-e'.:'.i :ia �;u:xs,.v ^:7.�.??'^ y .,T„•g,.-,,•ri� fe', ',� Y •�t,:'v;�•Y''::f,..� ,�- '71x..,;.:J. ..,..a.,:`7: ';•. ,.hy .,LhT,^+n¢,T;" irL'�., _ y f,f.�i'•�"+4:ik., ,rf,'-;tus,,;4:"- ':fr>a.,. Voluine��eit:/ rt �,u •�1��' =?a;°Qrs�.s.;,x,�;�?°°� 3� � t .-,f ��'f� �u� �a�,{ .� �' �>� � �.:w '3 al��...;�:'rS�'"`e,s'3 'r�'•.x. t ,;.;ad` r �:.F��'ri�rry:bG`�txr:�;.�N�A:Yo-G..ra`�:,:_`�h:"`.�<�� 2'w ..�.��.:�'Y�.�..a»3 , :�f�.:�,�>' Volume Right(vph) 15 202 7 0 ^�,..fx.;,. —r:.-fir.• ngz •"i!'x,:��L - '^+r,.i- .2a• iia:;G.=i.« s,+rr;= ..,:,Z;� wc.U:it'• -r-7;°i" ,..xr �:qr..�,.-�;.v,•> :k?� '_=KS7..r* -:r,•a.,., ,�i r h.,. � +"9i~�. :,;Y, ,. sa`�'xd•..;-,4+f=•.•y,:vry',�;n "<-; ;r ;'�iNY �1'="','^•7": ;,'� F'rt+'�' L ',x�,r .7,xraar.. .,,.$c- :>r, 31r_ -..r, +I '�% - *::aa...M,.,.: F..•:r.>;+.;-.:.:,;,.`�+?_r• .,$c�:., is ?"`� ., ML, y;ky" p.c^�'.r«•^.f.-,..•z•lr:h2 �j C�'�/S a�.#�y�..�= ari^:rN,;.••Ws:'.��;:v.r'.,Q1;, �; (1s'5y.;s��.;, eQ��tir.;u,Ul�:r"i�n<"A,..,k.afi.�•.._�fi,�•.:cifr;:a>s�..�x'r�.'`'�r.,,vtst�i�:,:h'�'�LaxY�?':.�n�aw`1xa�F..'•m's7 �..::. ..s::ed3�.:..y.•sra c�ta�.�:.:�,k1,�.w..-�... w+..r�- �.....,,,�1%,a.§,.. ..r;Sri.„.,rs..cv..kr.a �_.b...,..,a ..,..:..t._u._ .�.we:.v Departure Headway(s) 6.0 5.2 4.9 5.3 -•r;ce. +-rz»s c=-. >s:, 'c'4 '+,a:r .,r-.s- -•-:u•anp:t7t^',:.0 r��•i,�,,�;.i;f�,,.ztr�:s�.," ,a;ry�; -rr„^=u'rrs .?x�,_"3,+ ;.-µr>ruz nKrtJi. n " s,h"?!''i'+ ,{� .'n.:�:fy"`'-fir'„ /'fi'4"k;` '.r.7/� ,:tom,, .4`;k,'n'4, y4 S -.a=thv'�, .,..'€ *r'd. �.+�5-,.; •s+,,,pa.,.,.er �y ,s' .r..3" 'X3'c..e; .,4 ♦�',s:•.. r i g'}ciu'yi .',t,y: ,�'CS; .•. .V'']� �. D,i7�" '^ik(�"!.':�r 2,, .,.l ,mt:�it'`.yh'. :di't..L<i 4a:.f:ig,�.""". .,Y:'a>.yf�:,.C_.xz A..,l..� ';7'�c a }„n tq,+Lr b,9'Cie;�l�f��wG,tQljll=f`sf,>•..iz,'�.,'.,�1•..xox,-' tFku�r`�S.:m; �`'L:z:..sSs:�r...�"�•:,:,�'a'aS�_.m...r.++`}.i��g...,a,ae.::%a.t...,..1.z;k)+'>wzs�.�"i...+..tk:..riv;..;,rw'�u.,, s�o>r:s..1_n?i`a�#) .`zH..Ptt.,,.....,..d..-, Capacity(veh/h) 524 625 716 637 _ ,,rz. ,•.•r. k,.�..., - ,..f, .r_.!�^•� t{,a. :�t�'2a:-7x?:•t.+<_z-r�,��„ way-,,,�. ruz�. e:x;L;vy::.x7n 3t.'� :?(rF fi C': nw`Jta ,,Yn ,Y�n� 1 ^�T'�, .i" � t,lt•e 6, nit, `^.'NC' ry.�t,q si. ty: .,�.,x. r.f+, � 1..,' _.�..ln•,1 --} rt� .�+ .n�L :,6.>J! '`'k� .) { ':fLr',G 'A' t +'i"`.'s ';1 .•L4' `t^a; t�•},. `ad:x9;�`>•�r:t:�i'.fl5•.Y .��$'�; .';1!06..,.•,+�1.. ,3.•�'. { ,,..,u oJrra:,,;, .,,.;.a,...bk�v°.ti�t:. a..p.,:; `".'.r3: u4Le ,'.J'S�d�#r�i�;�e�iaY'CS�: t��,w.,��_��:,.;�,��.�..,,�•.,r..,u�:.,.�...,..,,..,M>,t�,<, .. .„u.�.�,�� ,:.��t - ��.. -� �..•.+.•�,•..,..k. - r,:- wi f ..,...:a h�r...:f=::..r,,.4�.ka;.-,...s ...7en.xa..wu�a.n�_,'u`.nv,..,{!•i a/:�fi,>:i'ra...a:.r�E�::v,w Approach Delay(s) 9 4 10 5 20.8 10.6 ..�.. - •a:,x �..,,. :.��.v .;.�.. »-�,zr• :,.ru;3^,-., .;Ew*•,,.rr:s• ;�r_y ':'7e. '•`�:��4=_C'vt't: f%:":.Y rtx��,. ,.ax>�;•r ;wq•r. .q.r _:4;5.•. '�. ,.'."�.. 'f'a ,t a:: -..7 ."C'.. +�', -tto:t . -.S.,x ,,,T;�- r .,.6'�ra.ot ��ae+?"etv:� ""°J,i.f.r,;3 z,•z, �rEti;a:�"":'-.x.v,s.h ,:r&.5.., 1..., .,•rr.^, „`,.3:'.. fl•tt.�:u\, :<.w.:�3•: •:a.. =° a%f,r ••t�' .n.F, .,.1 . ;::'>_.y .t',?:,•", ;°3,,,: .AtpYroaZ'"�Qsra'Li:.,.s,✓�>`-�•"r?rt�':.';+e,';Ciadz"F•.,,,�.,,:i,:,.7:�';,;y.ax";....a�Y.s',....u,..oa._.:.��°r........5:�,'�FTr.,..4.,...,,.,P,::?�z='.'o'zt;.z�`::..,.....,..,;.3�n:i'-K;��::'�t'w9:eza';:e;,efiV.anal.:m�:..,:,4lfcGCiak�i=�.e..:nav� .,�.:�':�t'� .�.:grgm .-,,..�.-y. .,.rr,�>t. =7�>^."•;f. .m;:f"_t`.';S,a ci•4:rWas m_-•:c7xsa•.T,_,x R•" �L'rn'r3t. C,3P'°V„Ys;. ate. .-r:.;•�oL•:.i:s. tr4�e�rsl� I•.--.•ezx'rs'4?ar�T�^'gi ^'-'.,my'" a,.D'�„RA i• : .."'"!T,,�: .;,., ..,'M•.•,s..,:p `�?, S.r.;::m•....txr 3+• .`"'�r,•,3.'L`>}3•.S:r..- d',a -:xw' :rz,.E R,;s?;: k'' t:,,>r ne if9.l'iiIVI,F',lt:.c7U. 4a' '».�'+:6�.�"�,�rit;C`i`s^J>••�iraw;*��,�r;'u �.�`<,�•:%>t�:�tt�.t�•:,�t �?a�ir, ,!`tert�;,;...':;v�.Y`F�ns�?.:a_.:S:;.k,;,>,.c�5"?~sy�:, i°<�a�<'�?ia;.h-�arrwr,.,a h�k�,..,,�,i z 9; 1.,:•?S ::2"u •$fah { � vF w �,C: ":r'`' ,..L� ,r,r n, .�` �'. :i'K4'•c,'�. be ays•y} , �;n - F., ...,^.i•::szh�i-e..'s,`' :'i2.��,' Y� �:tar`: X;-s..:.'a?ttis< :t....,,..:._ri:.aam�r,,:['a:3%:'t.::a` h.+rx'�:�"_'°i�:,.�3y.- .az....,...::'rJ,{�, .1,:4-:.,': :.>�.y�,t<.x.�s� :`.k,'_..,._aa.".1...�e 5i'.z+^S» .... .. • HCM Level of Service C :.-?.,; -f "�+'i^:t-:a.'s+. ';:rN':`` r0� - ".f.^r �,i {{"'L,''x .1>r' _(� 'ttffi?•wS'_Jr.g.: ..'1 ./ Y, ^: r' '-1. _ra-F;n+..:.ri`3m>a :F, ^" 'ri'cY:;%�::;✓a.y :n_.. :%iz..i"n..,.,::,�,�s,.,„�•''5$4./0�` iCU.'Lev�t-of�'Seruice.. ram_, ;r _.�::A`;`t.. .'�,-. - I �, trltersect�o��Gap�ei)~jr;+lllii zat o • �� :� �,��.. ,.w.u . a,,=�.._,,,...._s.,.._�,,..,,... „. _:�r�.P>_.,.�.:�_re>..:.��..�...._..,._s,,,.>._�._,��._,4•..-. -;:�•.,..,r�::� ,,,,,,,�...... wr..,. ..._ ._�_,_,.:,o::,..,,.,. -.?':. - .. .. rift' ..._:,'t- • y '• f Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 , 2: NE 44th St & Ripley Lane 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak ....# _,. 4— 4s, n 1 LJ afiwatime3y4":0-atemfoximmommorlisgatemoomegmazwygmwawma.,,,44Fasm Lane Configurations. . ) + T. V L NERIPIONUMMOSSMOVELOACAUSagnMtalinitagight13113BIEZIIEME - Storage Length(ft) 200 0 0 o T 54,57.440-00.53ffssammumirmaxammaggormamoympairosi, . -At.-1,TARrn Turning Speed(mph) 15 9 15 9 gigigfflaalWatanaMOMMOUVOOMPOR.01.10,iFenoaMP.27=4,,WWIMEta'''-;5°:7 TagePKI Frt 0.971 0.988 L3 EraktowggoattgsEt.ommmmxggspmxowzwszoNRNNBF- ALPITAFM1.7'1'ill Satd. Flow(prot) 1770 1863 1693 0 1618 0 011),,MitgaitilMITSKOVASESSEMISNINNMEMPASEHRTA:719REctr7 Tidit-SEREM Satd. Flow(perm) 1770 1863 1693 0 1618 0 L,i HarYFJEFAVANEIESEEPEZIWo.--anconstomme-pwrr- ,..--7,--7-Pifpwwwwimilim Link Speed(mph) 25 25 25 ta-Viitigai.7',.i.a.PaggifElMigitagarTitanaNggaPMENERIT4-...5%.' .1'7*wviegit '7:'1-17e.'; ISM , Travel Time(s) 36.0 7.9 36.0 J iiekiliNIERitigiralWIERMINSIMEMENKINEVEZEIVITOMESERECRESEM Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 ,-- tkagifigligNEENZE•IVACEIMENIONSINOMETKEIMESERIERAITATEEZOCRIENTIM 6 i i Adj. Flow(vph)..., 8 825 182 49 129 13 gdi.-igI.EOPY-ggkiggaFRRRG',-ag,Oasr:LA,EFIOYOI,,.,Eia.s"VtEtrZD:T,PAT.XfArsgP„,,YSMX:,gr5.,,,g;;P„'Zfy.aS.„.grRNL.t;,s,..,N,FVj Sign Control Free Free Stop - '1744;‘,:siAggriZTXjga'ZiA6aTEARARRRFOW: ,.. JERRIRWRWARWR44.,,.;:A: '72Y- Area Type: _ Other gj-gtrge.ffigpggrd6.gkeZZMMgrgWRgigfigfiggEtfggA'gHFaggaREZP^VERRN.Eragargn Intersection Capacity Utilization 59.7% ICU Level of Service A i ) 1 ' ;.., ; I i tz 1 J c=7 i 1 . Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 „ Synchro 5 Report 3/27/2002 BVL Page 3 HDRENGLVL7-FF51 ',H _ � 2: NE44th St & Ripley Lane 2005Acbon Barbee Mill Property#11735'001-OO2 Timing Plan:AMPeak 4 ~ _ ' Lane Configurations + �r <- Grade— - - - Pedestrians Walking Speed(ft/s) Right turn flare(veh) | ' Median storage �T � - � ! . Volume Total 8 825 231 143 Volume Right 0 0 49 13 '- Volume Intersection Capacity Utilization 59.7% ICU Level of Service �~ _ ' ' ) / �- _ � . ( ` �- M0 SynohmsReport 3/27/2002 �-. 8VL Page ( ' HDRENGLV[7-FF51 �\ � � ( 3: NE44th EB@ 1-405 SB Off ramp 2005Acbon Barbee Mill Property#11736-OO1'OO2 Timing Plan:AM Peak ~-v t , tj � Ur/ �u ---Configurations_ / Ipgx- } Total Lost Time .'- oin � Lan ---- 1'VV -1�V 1lN 1�n 1/0 1.00 1l0 1l0 1l0 1l0 1/0 1l0 b j ---- Factor �J NTKNIAP Fit Protected 0.90 u:o/ �- ,"'=""e" ~~~` ---' MW Right Turn on Red Yes Yes Yes Yes Link Distance � -, U \ Volume � vnnmeo ` O � lnmo ' � Lea ag p imize. 1 \ Un�orm - XppmaohLOG u u C A�a OtherMEN reen Splits and Phases: 3: NE44th St&1-4O5SBOff ramp � —+ m* - ,. Mill Action GynuhmsRopou a�/o2o«z 8 . '^'�=~~~~~~` '°--------'`~-' Pagaa �� ~ HDRENGLVL7FF51 _ • " ---- 'r ' I .,•_) 4: NE 44th St & Lake Washington Blvd 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak , . -,` 4- k- 4\ t ' P 1- VoljaWialFAIWNERgattagnaint5f5g143745NraTt-KOMEWORRTROriggROVEKtfani:',0131MNOR:q$0-.0 i Lane Configurations , ii I) t r 4, 4, 3 TracificiiibliromP.,-w-0,1---iivir'''0-escii'f7A--t.-0.1%.,.,'71 '•li'''‘'','-• --,''"fiVOIP"wil466VW1'itiRPF,T§IgordmiliVititi . :.1.09.#,,,z,„41.,:-.S:=L.„...=,hy,,,,,,,,,,,,,..v..Ar:v.,.,,M,,...4y ',..,9 ,,...49o,, AP.k.4,PPP -.4.--..`..t I.,..,,.,A-al, ,....,.,,,..&,. .-31 ,!,". !;;WQ .,„ ,,;:i„„„„ Storage Length(ft) 200 0 0 0 0 0 0 _ gf6ratarallgeW3Igl"K444?2;;;**4-1k447-W:*tig -t,--',;;;,eft,;0,r,,rittt -Virt'Rt.sigA.',Z-WOW.45-1114kY4-6,-',WA;:%Vilz,V.!;;;Mtii.z4F0..NOV;;;,,&?1,-7,Z,w;tz,m-mti 1 , ,....._,.......,.,....,....- t.tt?.,k,t.„,..?,..;16,,.t.s?.,...m.,_.,. .,,,,, ,ts,,,,:t?./. . t Total Lost Time(s) 5.0 5.0 5.0 • 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 .,Thriif. igigiiO4.41011341,1t-EM4§....4.E.AiTi41-::11,4VMA.V.:KEikicfaglielfggialti'.f'-'-'4,%„,1171,1'§„,..71.,,Ear-t:i.,§7.,11.,11,27,,‘?'2Fia Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 ,-- gattilikIERIPERM&VA'Ufg,i0.0:11/411-.1,ASIMICASPEOlPif.§.9:6111M0.11§0M703.151CFROIRAMS55,1 Fit Protected 0.950 0.950 0.997 0.998 ..,_, -i Saiiii (0,ii#AWYgnElffIt-14:10-6RTAVIMIT746):Plit68WelttingF140,5,101q.6,14NOTT,474157,3f,iitIVW501.6 :D,....k,,,',,.....,, , ,,,, -4,...La.,',a,,,,,,..........,32-A2z ,,,tt :d.v.P.o.a..,,,:,,,,,,,9.5a...4.&gai,.........,-3-4tt,,,,... ,,ow,:f.,...., Fit Permitted 0.950 0.950 0.997 0.998 ggfecraiifgefin"Mai. ,•z;ii-.0-.=';'4741-6-0K1'68-6,iagfe,;RTI-ItrilWfttgyrjgs.:tittisgmfqjffelypv,-.402.MO7=i,V;7r,Jjgc.F.:rart,t,w4x3'd , ..,,, --,,,,,,t,,=Aurt=s;,,,,,=.v....... 11:4,,,:,,,,..4). '...:' '.. `,47.,:o.d.',.:i.,1.,'% '....-'2" '.:. ., 1 ; Right Turn on Red Yes Yes Yes Yes L - 8itta,:jaailf0AFTP4F ;49,41:42.4:4WP:flf;r4" 7:7W'''Y'MATOT:V71-a,AXirdre.?"„:',T,;)-Vg'OFINAW:MiKg:I'gti,UrAtTa.,7A1 Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 figinAKCItrilitkriNEOLOAVES4PAS,Vggligaggiagffl'2,:;•9.17;?7,9SSERYMODVEROYEIMEA'46.11141DER 1 ! Link Distance(ft) 572 1320 1320 1319 3 rtigtaliffiitirekEgageitiViitPrinVEN&Avvr,PP-9:,,A4,-miidyf..7.TINPAvAPA.e.,-,::5:81,ga-gAff,6;.:i,:t7k-.;;,,p9,914,w,l,Lta Volume(vph) 409 101 313 112 130 69 11 107 69 ' 11 22 318 (. , .1ARIT,O.."01:M.O.Rigkagffl-rggf,-STO,V,OR101,-,062:7g6tWif9M7,076-369-Tgtr7i6iitG.n4iritctz''Areltf7492:gin8WW15-',766F-arega Heavy Vehicles(%) 3% 3% a% 2% 2% 2% 3% 3% 3% 2% 2% 2%t...LJ K,Org;t:14a9tte.20-11.1.17Feltg6.-0-§-,'if.';:S-1' 6,.,',,.',...if,,:'%7P.-,06,:;T,„k7434.r.21-4-67-7,,........................ ........................................................................................................................................... Lane Group Flow(vph) 505 511 0 126 146 78 0 246 0 0 398 0 ...- , ' ' ''''''Sfi ilFz..,,r irgairiiii0E'f.:Ritg'i'i,INgig (gtVg.:5.;:?00:i:::;fjY.-if2V;i:!eigit4;;;V:gk'6`--YP-fri+9,V8::.11.-....!,?;!x',';,x,',.`w;. .-dAcz?.y.36g .,„-q„.1,,m,,,e.,:,,,,,,,, Protected Phases 7 4 3 8 6 2 2 6 6 3peliiiiiii4EF:ihireigia,!;-1 -=',7',. .';:,7--,7,,,k:;m,l':-,':,'.'::,,,; ,.;w.,--,,--.'. 8- =',;,-,..-,,a-i:m:K:.,-,-;,-1474',-bm:,:;;,•47.,,,,z"rwl'gar:,:q•m..g.;qw.c.,gg:7,T2w .., .,,.-...,..„,,,,,,. .. ,-..;/,;:.. ,=-‘e.:::=:„ ...,,... ,,,,y - ,,,-,...,..-,..: .-: ,... :'-.,,-:,-,,:•"-., ,.7':.,.!..- Minimum Split(s) 11.0 10.0 11.0 10.0 12.5 18.5 18.5 12.5 12.5 tr414MK.KgiMR;N'MV';fgOWit':;'4:-t:;O?i"-f'',XO'24tt,4if:O:A ;tt'.'t'O:1:(:ftt.:E',t';:tgOI.,'I',Xz'gg'qX.ier,.g.'4tKil:Y,;q:#rr&.:::gD.g:,;':-il.gj.,147ti(,R:gO.1 , Total Split(%) 40% 41% 0% 15% 1 6% 20% 24% 24% 0% 20% 20% 0°/. .,,':•:) az ,tztt.t..- ,,t,'w ,,,,,.-,,;4-t4 tf,L.,;-,,,,,,,L,,,,,,itp.ve.,,,,,,,,y4„, .,:f L,.,,,,.•4, ,-,•,,!.,4 ,...;:w,,4••,. ,;...,,,,,,,,,,-- ?...a-=.,,,,,;,,,..9.",v,,,,,',-...=J,i,4 ,=41."‘,.,.. .4.9...,:,,,,,,,,,=.,,ic)..4.F .,,,,..,?..,,69,,,,,,,,l',1,;7::-4fk.:.4.z.v.;,,,..,-,,,Q,=.4.:=-,..q,,,,.:4,4:v4,,,,,,.„...J1f,a,,,,A"...2.,,,,J,;:. All-Red Time(s) 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 I, , 141401.146'2:VM,ERW.itlii:?';:1**C'g;:f64.0rif.-4%2,-0..4.44,2:2;.;;40:TS ,,,-;:„f.i&Y,':'ati0,. .-ki*:',t:a--fM,'-2,.. ;jAigy04,46Z:11.4K,'!.:411Y,..;i; .i Lead-Lag Optimize? Yes Yes Yes Yes it t ,..71 'igtVgfgr(4:itqYNfriNg'f',':'-'4S!;:Y:P-.'q*:.i0)a:.':'..sf:;:':':'"::',;'4.:fti;0T:',':'6'i:l.i:''(AlgOP!fM'jeg'A;ftg;.O'Si.',.'gifg.':gfif7,RfiRt4ef§:lc,k'graK;j.R ',..., Actuated g/C Ratio 0.35 0.36 0.10 0.11 0.26 0.19 0.15 1-, ikelNtt§li5E:EfantEZiig'Z.,OTOrgiMg0.1RaZ:-WSk'ggii10:jlifasAO:AEKRVRYS.kAPMIEEZ2t3fkTiE.tgtg-ifafii , , Uniform Delay, d1 29.7 17.5 43.6 42.9 0.0 33.6 3.5 t):4f49):EfRP.KRSIEKfFFke.:figON.a;Ei:.4r,g.g;W.11:.f.OA:g;:',83F„'F,§qVl:Nfl,F,:gigiffZ.FE.WTfiSZf.a,s,g,,,mkt.k,.iwg,Pi..,,,,,,:,,Ai,..pi,,,,, ,...„...1 LOS B A D D A D A ,___, kl•pfiit4i:01)11):41alf,t--;. .4,110;4:11,Y,'23%!1.1„X‘ii-7.-,,,,,,,TMi4-Aig,,,,FA:::::go.-5.73.igg.A0i0ligiiilfgaiNNIZiMgdinziaifi: Approach LOS B D D A t.li firaTiaraiSfriiiiiiieit:R=W*7gg',7taggt,':),AUFAFERititRA4FaigM15,02,11,,M3a-7+,;3,5,017234,0,74.W.,R,R3732 ,,--- Area Type: . , Other altigdtt.t OttlitTEPOIO-Rg.i-VATizAiiiiMAILIRIV.si`,;:;.../,,,,,g-a.ofung-c513414,,,mv,.R2raNs...migsfm-vainzi Offset:0(0%), Referenced to phase 2:NBTL, Start of Green 0 0,41001,-§SONFRINCE'''',1:,,arcrini4t.0071,,WagaggiOU'.2.;;MiNtiaggirMara'agriglagianfigt7.4117`a Control Type: Pretimed MAirfnlickg./42K41113:0121W100.,-.!:W7,Vg.005eattalfgMigg-tiggrlsgFaMfli.N.PFIZSgarinftE.W.Reg Intersection Signal Delay: 18.1 Intersection LOS: B C3 ."---7.70aTigiNfOliiitVrti-V,Mr5rt'.05t,:4,1'tn;M;•41-41,;itt...10.`-ott'egit't: ''''4'''''''''''T.147,-5P1'7':-;.,,K`..'"•R7;'4',7g1';',;:-,i4Z-WigagiF,'".'W/X,'?X0,'Sr',,,,) girgi..,§70„,4,9tV,..,„ ,-„,. .,„. „„.,.„P.A.„:i..,i.:‘,... Yr;v*.e.,-2.,:kee,6.,„......;:.....7.-A;',,,,,-.,:A,:„Yi,,,.4j:I.g@PAC.A:; :t4ZLSN'aige'"V.:,PAik...1.'.-liac•kk7ezofiftP,I.kaeli7,..Sk Splits and Phases: 4: NE 44th St&Lake Washington Blvd r---I' .......) 44 02 $ e6 --Pl. 04 1. 03 2:,fi tr4-'',.;;';...,..,,, ,-1".4::, q..Y'llarilWATA0V-..::-:14-1MNIOUSSOPIMPARir4W*01-.--',-10Wigthari - , f ....# 41=-- 07 08 1 , , . ,---. 401i0agitati&IttiONe1AVAit1: 11ViZitilla .;-1 ..:.:-.,1 !-- ) Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 - BVL Page 6 1 HDRENGLVL7-FF51 5: NE 44th St& Proposed Driveway 2005 Action tt Barbee Mill Property#11735-001-002 Timing Plan:AM Peak \ ':.oigiffineBRUMIRWENATE100530031EMT3WAW4NRIMARTRZMAMMTWARTRI Lane Configurations 4 , 're gr,e,kp,Aomgoomes.00,:satomgovzmlomzoo,rfmramrangg-fmtmwrssm:t , Turning Speed(mph)_ 15. 9 15 9 PIPIIIVFAORLIVTNMMPIRBAVDAPTOWMERIIIXNTKTEBTNENEEZMENZIRWIMM Frt 0.998 0.988 PlifORAMASTEINMENIMSFAMMASESPAgridin.fraffatifi&47fiii&-""Zitgal"MigaiN Satd. Flow'(prot) 0 1863 1859 0 1761 L' worsitoomoxfoomemosontasswormisymzessiprammistsmossam Satd. Flow(perm) 0 1863 1859 0 1761 0 %KW, g0.:EEIEVSIEMPNMPA;VtljkMOKW'MrfngKISNEZCVIASfNEMriltZIELMF,M , Link Speed(mph) 25 25 25 PNPVAgqitjfgiNillSW,EfgfWgnfifPleIZVBAIX4:-AWAVNMIMMTMZIWRIWltZSB Travel Time(s) 19.2 16.9 36.1 9:44MBWINSWEIMMINC,011WSTAXESZMANWINERSEMENINANSENNEMEIg Peak Hour Factor 0.92 0.92 0.92 0.92 0.92 0.92 Lj Ogren,MTLISESSERIEWMPINIMEMPINARIMESIVINFINEMEMNWITORES Lane Group Flow(vph) 0 760 142 0 11 0 :,sr6W,OtitktlrovMEEEMSYMfge7:kfENME::gMbgo'igt,CR?ENEPAEESTEIBVfWEZVEEffOBZAI pirriarAstioar, NZRRAFRP,KRWR'RtinwwRofs.zminzndtergsagwiztmzrxwn•W,§Wr,''z.,K • KiWsMPVNtiNVLVJNtaa,taggtdaiakM:figiakg.FaEaGMEFMVP2ZVIMPWE:Wi' Control Type: Unsignalized FitiggrANWORtilOWCWARNMARAgageFAMARVIONNEEMESERMITEMBISMUS tzl , L Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL •Page 7 t HDRENGLVL7-FF51 r / I ` 5: NE 44th St & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak -- -v;",:. - ,'�"'::�:; _,3�rF• Nave_. .�,'.e,.>.,.. - �,s,-:, K::s:r �.:,`- _ .:_fix<,urear:.'nr'-� :y'5,,'..'.�"' ,� E<�yc,'1'�-3'S.�'°�z�`f"'Y.'.y :>r�,^.-sry,N?t'':c';n":�i r�(y�/��y/.rya r..�re'Icr't'�,, .,'v ,f;,'i p -.�. o Nr�.. �}G( ,p'Wr�/ p`i�"L..ig.gf2 '6^ ,;g.a i 4�� L[A =?; '." .. } T �� I I��YY,�I,�,1811�,i.F't:.'.:�Rh�«: ��ti �:+:.�0�'i,Y. 'iy��i-�'�.�LA�:.s:�:'::Y��,i�.�l>yvw_'-:�7OLi.r-+:.Y;1JO,�litf,titLu�T::,:.lfi>n'F;�i.his 1'.s�.>a�ef:iL�i... r._*w`;ti',i.:�Mti.'Y.M�U,B:L:}��1,rfT57"F,:-, Lane Configurations 4 T. ' `1 §, n. tof N Sn . ,FefeM °Fe R p s..A a n 4 - E n 4 w Y iSa M ' Grade 0% 0% 0% --' - <„>ym •,v:: �{ �.r�, v.?'•"'�r'dat'r:ra rt, .,y-fir:r;:Y•'a:aqr., c.�,t�,;,::;ttt„<.,�>"�"'' •2FJ�Z^M!.t�K:'SY:t:A,"'-`.='rk:'s sf.:'�"yx^z^1,': T^jp:: ..,�;.-,- :,:Ti:fi+i.--,, "•'.�.,r.7�}^., i,lt': ! "j,`: x-\ ,i'1't~ Jkr J��Y•.<. 1i]tf,:�:;:Jr. -t�.-�i1.C, y:t•<,,:4,�'{ ;PF; ,'2r�f ,� Y'•e :tsc. .,f, t 7 ir,'!, sk .i R;`a`nh'.,>:!::'3'.," i I ;:il N1' ,�'�'..: eN'.' r4t .,td`Y.,'`rFF i „Y fF :: �Y'.,�.,.:'r, ..�4$,t�i;:�,.`•. ,!i ,.k .,1n V,',rl[f',,y 't.va",.h\ :>��,„t.�rE..r-,:,�^'�"„t.,D:a 't,699:�:�,, _1�9r .4�•rr:,;.2,1.., �.�. p 't:.,,,>1. ��•�;�;�.<- ,,. k � nJ..,r'.cf.f".,,.. Ltd-._, r7uy` ,�''>;�,`�.. �,,..ni�I,L_�.',.:�n,;�....L�`.-.,,_,�..-e�,�.'w..:,�J:T�a: ,:tC:uf: .,.N - .+rc,5...�.. .. ..P'��:'Y,.':iz',�3.v. ,.>..Yi,».....<.,.,:":;3�t:..1,'tt.�,,...•�<^`;cirf:�z.£�„t�i.,',.....�t;�,.+.....u>".zc.,.4.<t.J'/,.,.....,...,i•,.,. Peak Hour Factor 0.92 0.92 0.92 0.92 0.92 0.92 a'.^'^r:: Yr";r. ,.. •1.: _,.r.. :.•ttn?+=:& �, .',ry{r.',,'F r:vna --Yf;.5rLrrC-,'r,•?r'7' `-`v.';v<'1'san:',••.-s., - '.w.' - '.t:• N,r'--�: ;�:iL�i.,}:•. r:,'d <,r�,!::.7;r '"�.r :'u:,. .,rY:rc, F- c"1 -'S7,o-Ya`�^'`,�c�.` ,y 7,;^ .,Jr .;,.,.3...;5`.,i%trr m-„.�s ..1. .r :ri,:.,;.'; 'r` -r.-.Y'>:, ry...7<,r...> ,4 Y.; :IY.-x �O.CIrf >IO�rt tee'yE� ='v .3,:��,=iti.U?*�''�''#r7G ._, ,�'4. �::�:,:a,,. ,u•.>.t+ tu'.*'S >u.;a=.�v +...;i uv., �'i� ,.'�� ,r:�. ,.�-_«..�' ,� s.,Srw..s�l�+..�t��:r...,,�s<>iy�rnier�k:.�,r•,w;.�-,.:+_?'.,.,,,,r.r...cr ,.ac,..,.r_F ...,..,,."a..:,�„ ,,G..,,,...a:mt...,<,.:.�..;.*..:u,,�Aa,..Y•<',.1r.�>�'r,c�c_ � Pedestrians mf r:<'. .:f:_5:.. "'.4[F'<,:,r ,..r,,m:dy "::kf`".Y i'f"{>M}j',,w ?Ew>;.,L••PCU! - H:4C^�'I".^p„?1 " -'•<r,= +T!''fa.'�. sf'fi;i: ,i^ �jrl. :7t„' �;. I?.•`te;�. `:tn,, 'ti;S.ero'�:1,.fit.. � v,!t',;t.1''2,=1'rz: r .f"a u.,4". ...,.�;' "^,sx`!:r„ sF 1i7.;;£5'S".r,;, ¢;rYr.stt„ :;'$�7�"vM'rr:�S', ....t,. '�^>": •w,�.,i^'s2�"y:a\ 1,f -,c': r?,r tfir R - i'` •5. r t�:, ,',g,", ,�'.. :.i;r, vf,ry �;t,{.-wt:` ,:,k...k "rh"r.. .:k'J '�^,q wJ-iY,,;-„ Yd :f,.„,k N 5 t ''�l, •�l.s",..�.'�:. u`,;'?;., .,r...:e. .,.�=sF'•','.'n`.h,„t,., �::;,:;•.a.1Y'�r';•:•'-;�..3� ..;,x x 'S..f �•�,��.'>��!th?�ft�iw�?:,z�'wsr�,~'�a'u�uf`''it <„r:,:,ter".;�o�x,<.S?f?'Yf`•",�:5"'.t '.�:_.�:,.f,,fi;�£:�Y;.d,.-J.l,.,,a,d:.r�'�.`^`?,�.,.rr,><..•,tre.it,+.�,�...,.,,,a� ..rFww,a,,,.I....`a';.Y,'<2i,:r�'....:�t3iz`�'�r:.,,nf,uf>.:,.�./�'o:,�.C:,.,2.d..:..�u Walking Speed(ft/s) ,6.: +4+. ..,,,1, .j.,, ;i`, Y;,, +id? .tY:.:q'zF�c_',r>.:,";Si??r,,.�yi,t;..ate: "":f:'.b:_ ^iCf. ^:hR:: =v..Ve'ii' -,^n7rnw,Fs..^ ,.C':,::,r.f,n ,v'..'r'T°f:i„ -g' t.i 3Y.,, :IC+. _ t•Y .r'l',.. .<4:'� it r:. °rt^':a'?'.,. x il,°..:n r., %.t,..,;rr ;;�ti ..(s.,*L`1)".:,f�lx''i' ,:r Li°; x,.i','•`: }"^-... ..s:, ' ..i+N`,'J�.,; rr7a ,i.:fY..er^., ,.'r-•+ct„ ,, x�`y,.y�'««,;'�.t'` <=; -%. J* '� - .a.`,'> -.rii&A,i41 v,Y. ,,,a..,'.>rr: .?'},'�, , `� :!2S.,'y.:f :Azek4¢;:".:IR,,,,.i,t :,„.43, ..r,,,_ .>.,.,.. : tt, P+s•.i„a �erG@�X�Bioekag�e• J'1"`4iTt.J:lk.'�:k::�;:i�`"'.:i�,'aa;:.i?!�:yr.�.Ns;•,vluls'7,-�i�i�'?iC;°vt:l.,e.;L�;:',:�?.ee5 �2„s#Sf 'SY:.+hS2''i;:Sim..,,,nc,L>•nu;wd<....Js>a.}..::.ra,��,.:t�':.wtrJ:� l.:ue.l�:.�..mk>`n ?f.•';�`Art...._,t+': Right turn flare(veh) /' .1 �:B� ygfi7.�� y_ + 1• R : nW "� a3� R o_ te<u s i 7 ` E � w�.d'uq w ?r� aan i . Median storage veh) :E:..�.. "_R,d '.c:'.r.nF•r�•jaJ:; ',Ya'•:7r"' .�i':?`.rr-^' _.�:.'+�'44?n� "�Yr,'-..xn,,�•.0 .'s,4== Y'r'N Fr-. -..,r�^ ^-f S�sz""ts '!c� ,5, XYr'�;. .r,x;,'F'-'`' .i:�`M i1. "'iY:"`w>.... ,J "vg.'.. i`k.6"' 'M.,,:;t3..Y{i,`r':< ..;y.:•?,fi'._, ,r.:,r. ',: »'.<`} y�t,..E.,vFf.'�+..;`.- _ .n.. •a, u';•7. ,••;'At,r.F , ^'.',•' - VZ i f,, Z .l,,x y 1..-", ;a:?:>ir2 r y.;,,i,^":Sr:Pad:n;�:Z "+ry"'. co�'i'�i• uo iiy.�°ye.;��J,, ,�:,z:14 •,,::;N;�.,��w�.,rn�.�r,:::.,'_,:•,�,;�„<•�.:�r:.�A.1xr�>.f,:,x��i41: , � ,-"�'.: ^:_✓,'�t>�,_ 4�;" ,�,., �, � ..� ��ra✓,c��vi:..f•n9`r4.!:.`@r, •n,>„RA;,w,1S.r`,:,.>a:�4b>a::'r}.'1,.)r'w.;:t.`Fu,y�.'�n,.',`+'Y..,,. x.,,:$r,cM,r;,>`,.,..�,..,,.....v.,,,f�,_s1..,.n,,.tv�,,E:.1�.v..irte<�,Ye:1',,.luS✓..,..n......3.<rs.^,r:71�'tr,�a:.4s.,.'7�ts+�1>,.w.c....,;f,w-'t<:"'rii%;l.t.:, vC1,stage 1 conf vole ' .:ry .*Y. N^-•P.^, ^,F,i-1":-.:,{..-r�✓)u.�^ '-iili",+x'i^^;4r;:`;?'.�:�+a.tT^L?i{b ;..;.; .4„yv„:+':' s.,;..o.._R..,F.w,7,..b,a,.:..�,.;".,",YJ:-,�,:f••yy.•4y'��r,•;,..,._x;�..n:•::•t• tom.:�:t,.'..:�.. ..-�n.�K,n"�'t;' r,;.:.:.,,,•R,� ,..^y.SSi! ,."tJ'i ,f .�.f., r,'.:',t :.i�i., Tr a' ., .?-.L...1M..,...,n+..t.. ..Lg, K2;$.!a,,., ]�.° �xt..••:„8,,.t,,,,,.rn...,.y�;.'p:r'y'»::Ar..:r v... Q .,v r „`f„ ,'2' ,4:. - re,-,F+• ..k:- >a.Q.•v„ ri„ :�r.<t,k�,i:7;(,'• M,•t <+s, :Rd;°at�''a.r.M`+;rny;+$,e„4f?'.'E `:' jy. �S �s ='CortftllOk^' }, '':� --r.,: •;�,:? �:;, ...k^,. r.,:a;tl':,r<,>:"1�- .f,`�'�,�,�:..,. .� ,,�� -•a;:kz5�,�.::ss,�'��v.: .�.-.-`5'.'6:z»t�!gw•,t2.>�e...= a...,_..fiR'` :£�'2�;:t�_tip:'t;,nS:%rv.,i•',Ww;�./i�K.t_;._r,•.ic�i��:.z'S'u.,.+....;.r,'.,',._s:,•r.,>r-..�)::`'•�:"t*t,ulrr..C.,.,:.a2,..�f-wi.�.=.r,,..f,t,J2_o�..-..ec;':::`,.r*.Stw,,.,j,..13.�.<[.,..vnt , tC,single(s) 4.1 6.4 6.2 ,±t_•r.?: ,'Cl 'Y:'�:»„d.^.'.ij t.. •r�,�y..n:;7t��, .�.�.,5 :iMti:l.t i tflr,i p� 'n� tC. t h='�; - �r ,.. _ _ •�rE,�:. s'�::,;��`<!,:t,,.>�...,.��.>:=ram;•_x ., ,> ,•... ._-9_.;�_.�'"G.s_._.s<....1'J>::iY:,r.,,.arfr.�.��'I"r-.-r.rr�L%�',.�f:d+,-.:�.s.m,1��:"�......::.<- ... ��5,^'.r-,.::, ,, .. � ,,..,c tF(s) 2.2 3.5 3.3 � �\,- .y:.,.,G,.^:,'^P'a.'.. -_..T, �NeK :+q" -n;t£-v`.')': b..Y; •�2a:Ra'.,...,_. t'. ,=c rnF;: .t„`„i-'> 3".�iG'" 's.:. ,i.'b>fia; rii"-. `.:i;:"�::3.�' a...,.z:i .,u•.'!.;'4''i;=^'":rS- ..F-F''�,.k,'-s s,t, I.C.:�`.; •rru.' t'r:"•-, .1....:jT'=-t'i„•:.' ..4:c_ "�','tCr'?:�- ;V. �l�da;.. ..iF.,.a t'� :y y �=a ,*y.o,-,-y.;t. fF�� Igo£, ,,,t,^?. D :�. -a.+Y'� ;;rya ,r �=97,,, i D,'i�;:.,,<<�.>�?;t," >.,+`t` „�::,- :�, ,��;�r':r..:,. ,� ,.,�Ac!._ I t3�f��,1e�l�an:::,$Ff.:,...,, ,,.,i3'�t,'i„4,,._�..,;7�.�� :}��'..,,..,:•,��r.P:..r:.,,>�,:`f:<,,..<:fs°r;4t..,:�r�<...... : .. ..:...U.��,,,�...-..,.,.,..,tzJ.n.,�..,,z�',p,�i�u_..,x.;�,,,:�.,,J �::+a_v...t.._.�<:,�,:,.<,.a. . I cM capacity(veh/h)+u 1440 309 907 ^TMc:-r'ex-rr'<-rrs-'A^< :; _ __ _ ^"z"-_ "*q. '-:?c:, ;a':rr,,. '.'.: ',"',Y.M... ..,Yr�,; .�,�:N.'�z�-�;a-„'sr,-,mc;,� r'7?in %i- �"',fi:�c'`:'� r: -.r .;s�`�i�`w kyr.. �k�.r ,+:��.'sx�'=,r,�i;.x �:�'�s �.=.'r�FK�;�`�• �:�?�v,.Ce...� ,', :=,�"= '_` �'_ Yd`.:.f pjr'ectiQrr{a1.artE;�kr':,�`s-^..;�.�:r:..v�:�:.EB=<C:_-.fi�'YUg�;t,,.��:'SB�i;_�$:::-;�:.'.�;.�.�,,:..e.,,.z,. ..,..;�,;�..J. �>,:� >r.�-�„"' .::,:_`�.�:,,.��;.,.�,.•>.r,,,t.,.:,,..��,:,: .�,> ..,r J:::�x� Volume Total 760 142 11 - - - _1�• wn_.':r•<,r: -' b^.•tr•-r3•: ^,r;- .� ;• .,.;,ccl;,_.,i< ^sS,w•,p�;,➢�. r"V,'Y'.u`TJ" - „,l;..n •=3r' r3� -, .='Y ':. ._�_ - .,.f a:. '`'K:' -`i�r ltcu-• s'iS: `,:F� :�`r`;.„i..Yry `,�r,+if"-" .,.h -."i:cL t•�.", `i'/;ofiurrie eft:' ./,. - ,,:�>� .ti.:�7�:^-::��=»='s:•=r.".rw�M:..,..�,_>u,> :+.._�'�. :.,_..:..,;r�,:�,<: , --..",.>,f. ,.�,...•Y<;.„..��.mt+;r,^::,?'iz;;. .........v.:.h..ak."-�tr,._b. .:tiri`�::J..uvh:'s..af`.1::'.�;:...,+.J.r.n.:_.:r.;.;:.ti•+:"'r+i_. .! 1., Volume Right 0 2 1 Par u ,s .t r e Je: t. •ram•, �`,'U..i,.ii;,e,•:;'smi; .stikal•fi:1`ti'fa";tip=i>R:',;.,:_. '„5„3.:1„',>< „',+1.:. .,.,,.1,�, ,. ... .. .. - Volume to Capacity 0.00 0.08 0.03 :-.,..�.::•;,.;. ..,,.•,r„..,__.�_.a-�.,...,:„•,..:.�:,;.,y r..,::..,�,..,,,+:,..,,.;;,r..,.. : '.'1;{T•',•?a:"" ^xe;,k'�Fr�^e; :iA',-,i?'�-';T�q;,y - cif..- 'ems;'%�•'-,, to s ,., „<,...,,., � `7 Control Delay(s) 0.0 0.0 16.3 x'F: - Y'•1:.- :Sl, Y, .::f. .1,Y''•aei"m,.?`„",":z`-"f.:@L:ntmz,,1,,-,'F.3-F:?17�r:.D - :^t =':r',^r,t-" :3-':5T-.,.- a:1_:i,. r1'i ^�xt='{," s." r,r,: ;-r2-_�:: .::> _ SE"5 .rr• a �, .r.,:<. .:Y3;73�?`.�,'�'^.`"`'�:, ary:., =^i'.. ,?r."' r,c5"-,�;lt?� .1'��" :•r+,.M. '<.- r., c ,--- Approach Delay(s) 0.0 0.0 16.3 ` , n�,ti..:.,Z,� la,a:, +,rau. ,.<4�c.Sri.',. a,•r>. d.,.'- A>�p„^.�:.,'�t<,.....,,..s?x;z oi':7a✓<:�.'t,^.,'":, ., ,._._::F ......,,iyi"..::s_Fvx:',:,rt:r,.,,,4''.r,,�,.�''r,,..url;`b:.tx,:,.$.t.'.<vx�'Y,..t..,,r';a.....:>b„e.L:'e:'r,'c'a`,:i;�`=*.:...,Mc'}.'�<,«r.,n:..<.c .>c.,;.:.g,s ,--,, '<'p.r _,,y-; '}Z:'"'i=•ks'• 5::..- ,-4:. "'+'�F i:X:x'�s,< ,^r.._,,,r. ,'= a,+ F y. ri:,0'.,,, '+,'. �i::'`f''i':_.t... •'d, .f•._,?'Y`h,x,,"\,+u-_,.i> a..: .Yn S: :c�: T'%:?t.'.•;�, u`d-: _zr>t..: 7"t.:k'v'e:s- - ..,p.�...,3" :x;:y`�;:; lor.. •r. 'j-' - �i� ;ck' ..'{,.„fit. cy-.:.:��-`�'%/:., i:z:. ,!:•+,t.,..••N,, aL,r.?a.r -,Y, �rF�-^,i .G, ;.2f<:,,•' ., ft,,tF?rSBCittO�<�S'.uf)1118[}! V.. G; :w< c4.,s.u4° s:«d t. w5:rr::Z:. .,. <F.rot .aF>g• _,. Fd`.. ;, y y.isfii }^fir. <tiy i _ n.`L _r r.< 2�'�",::e.-('L �;: i-, c•,h' .1^ ,i,W .kr.'°.x,i.'-:T=i'_•..>.,r. •r„ _ Averarr,��p',t�.aaa - .F s. _,,:, ,:. -,0.. :�' .. .�___.�>,,,_._"��•u::�:s> .-.,�,��...�-....�r_.:�,,�.>_:._,...:z,�:��:'�;:. -s-ee.,�_".>,`.7.PSz.:.:. .�:L:_,-,�.+..�di�it,:'rZ:>-- .,., .,.EC:t=`•`a'a��._..1_�r'"��:''`�;'.::r>f -.:.r: Intersection Capacity Utilization 51.7% ICU Level of Service A ;1' ..i._ 5't'* a's: •:� +c;. xn. - 7. :.fi^t:.hYY-7 `:7F +'>,>•.,,-,. ^•r"'+ ;:aG �7,rk'v*;t,,:�.^«. •:�a•• - {.'<':%M Y.S..:S'�';,:e"s:'1�"k,.. ^:«Y., 'C�^-" :._�k^rklb"r. �. .•F�:;',.X' h` ,'r.. '��-.>2,(•;;" ,,,t:"';"i.-c., - ,.r#�.::.. tt r;�L",.T -`4M: ,R?� .:Iu 6 >l•.r, :a:J�'ii�'., ``rn1 - 4i� ,L''::'.« ,y.r. >-t }hf" .J4<,..Of, _.�... C h5',i• }`'�ti_;• .pwrl-�:M-t .,:t�;}`i?C,f: if r.., ";.{c. nc: �•�>.,yt ;:�a:"s, x,t• >,y, .n .,;k� .'t��' .N._„_:;�i,.,• ,�'<.s;> Jam,. _.:�.<, }} :7b''£;•�.:..,.,,,..>!'.<1:fi�.`..,,.>_.".t:...,..rv•rtS,_... .rw<';z':.,'<x._-,.<.J..�:�'c::............<, ,.....-.a..,.. .,.• ._,.. .._..,, r `S, I- • 1 0 3 Imo' , L. i , ') Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM,sy6 Synchro 5 Report 3/27/2002 BVL Page 8 HDRENGLVL7-FF51 2005 P . M . Peak Hour Los Calculations With Project 11 ? i 11 ! 1 L1J • Li ci •r,j 1: N 36th St& Lake Washington Blvd 2005 Action ff.: Barbee Mill Property#11735-001-002 Timing Plan: PM Peak 'I' —0' --..? c 4-- 4"- 4\ t t \* 1 4/ 1 i EMOTKINGVAMTMORROZAMKSMETSWORMSOMEardeRMWORMOWZMA Lane Configurations 4, 4. 4, 4. rgarMittikragegitRar#DOMMOROMINOMEMPiafailtaNitanalt. 14MFANACI .. .,x.,.. . . , Turning Speed(mph) 15 9 15 9 15 9 15 9 & PireltagegilaraMIERIMMOMMEMIMONEMENNONAMMaglaggi: Frt 0.955 0.882 0.993 0.995 eitareNIZEMIMINSOMMEMEMPINCESEMEMTEMPWAREEKWAMISM1 ' i Satd. Flow(prot) 0 1566 0 0 1643 0 0 1828 0 0 1833 0 EVEMINEEIRD-, ':026110149rMfiEffe,11,'RMETICEMIEMMEAStiTAWINIV 41 Satd. Flow(perm) 0 1566 0 0 1643 0 0 1828 0 0 1833 0 FlikartgaTaMarrAVIC,..JAPIWOISSOMEWNMEMWMPTOURV MIO.IMPIMA , . 1 Link Speed(mph) 30 30 25 • 25 MrtiginfiNECTSEMOPPERRESO` ENETIKEORNEMEIMIr'MINININNIEM Travel Time(s) 30.0 30.0 36.0 36.0 I ) gitge01-ffgerENZINDIE>WiifIRSHRWIMMATML::::IMETARM474ZPAM#Ai Orif __,j Peak Hour Factor 0.58 0.58 0.58 0.73 0.73 0.73 0.69 0.69 0.69 0.94 0.94 0.94 HANYWoreNSERINFNIEMIBROAREMEEMIMMEITEREMEEMERMMAWEN Adj. Flow(vph) , 10 10 10 0 8 55 9 162 9 74 262 12 • A PROTSIANNOVED240KIMEMEGBEMOIREERIVASOMMWERWIE,PWRAN r, __:\ • Sign Control Stop Stop Stop Stop iffitieMaiiiiiiiVA ,?c,-7747ARFAUMTIWAC'.TC47,4, :(4,ZCZYANWW:MTMCWASIRWRAWATO1 , Area Type: , , . Other ,.. . 0,51itaitMrtielagaggESOMVPMINagantgantWANINCINVINKFASPHICAMB2 113_,i Intersection Capacity Utilization 44.5% ICU Level of Service A „ b [1,i 1 Li k k 1 . , , • , -, , Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 . Synchro 5 Report 3/27/2002 1 1 BVL Page 1 ti HDRENGLVL7-FF51 1 ( : ) Li 1: N 36th St & Lake Washington Blvd 2005 Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak I.- 4— 4\ /*" 11/ 7:17AVIlik -rawartwavv"--ate46,--s-orrsb movs3.ffiefitvarisging4A,,., ..$1-** '/t7",„• % ,e; Lane Configurations 4, 4+ 40 SidiVaiiiiT§PRUFWWW,P$WWOlir/P2z5OPR:47,VT:N8181)W.74WIWM,1570.017 WFAVF0V-Pigam-FACktfire.,,z,w4w,9 Volume(veh/h) 6 6 6 0 6 40 6 112 6 70 246 11 'tn' ra*fr§l'Fg'ideW'r'R'F'kWf:t7;'rgtg0:V6bW:F'Q-73'gtrPrT' 23-WP3kfr'lf"-'trOW2a4:C§7cNt7:RW-97AW§47-.PWP:#47.gFZO1#4 LA, t., Hourly flow rate(veh/h) 10 10 1 0 0 8 55 9 162 9 74 262 12 Dlr,la—KTfif.'aiA,TraRrIR'E:EOgigaNtVB,gat:W'MttF.FTME-TM,W,-WAWNNTMMRWgN2WtrVFrt'Vvvkq r Volume Total (vph) 31 63 180 348 iriffenWOWfiliPVIN:Wil"413iWitan(Wrg. 4•k-u',11"diki-LACIAtitateli'Wel32`24(41.ttidgt.tii.:7WW,Aileg,Vra-iita, Volume Right(vph) 10 55 9 12 . FridlISIWWW4ferir-'194rfj"fmiNZO"TanWPQViyfici-vmrsztvwfg.zi.TvgAfi'd,.7.0.FPFeFf:37 rmnverrrovevziw,Departure Headway(s) 5.2 4.6 4.5 4.4 tj''eOgI.:ififitliroyp5fpWVprftrr4fvaQVtptyg-*n'r6;grg'qrtoFP,:v•"kv(,vim.FpAT,.s,wr;,.14;kfi%:;rv(,..-4(,(r:..xn myx7r4otroYr-vt(cm-47.ip;:wwIrierm Capacity(veh/h) 623 706 770 801 riglyguixim---0;mreopwziaymrEcts7,7,7t.fon6-4 (tv-mrgclikw.1:,m,Rip;rinvw?4:41171",r4pn-iplrygmxis.7.-677.,„smug,L7;,F.,-,Q714-i: ( Approach Delay(s) 8.5 8.0 8.8 10.5 rfillitfAiWggligEgAREEEWEIRAMPROMAR3Man3ROARFIPP(SAVR'F''' nrif-Fi4119fi"Th711W-433'" 77 r.610iiiiiar,074r$MblitalieR7R77K:rMik.73.q,W744;C4;,;WW4F7MWIF7XF7.7,IP7, 7174,747,:g7-Wf7A7.757131ey.,,4?",,FrAF,741347: 70 „. , • atwizigintiiireistArrtimmozogriargzonfamw-vogolwaz5wweitww,v410.'" w",-,-Fivw, HCM Level of Service A [ •• •7 49,44403A1,41,04'4 .-UP4,4i§,%1ZZ4''#.1'Al„9,144AY.0.9tC§ATWAIOA'. „ t „ i :73 • • , 1 , Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 2: Lake Washington Blvd & Ripley Lane 2005 Action k..' Barbee Mill Property#11735-001-002 Timing Plan: PM Peak Sa,rii -^'ma:^�T^',"e>: r-. x '.n.._ , '' -.,�.i-78-`-1ity _ aR•'• ..,�.^M' 5 `U= t. ,.^r:'u '-u _ ,t ,,a,%% a"-bi ' .;:.'v ^Ai`:K�„•`ti 9" >•el' f i,,.., 1 k�' b 5lr,a• ";(., . lt��i�',Cz��t�P!•&>r.-,;�:��:�:i+....r:l,�Na��;�B,t:,�''.��,.�—� T,:.,.��III.B�'�.:�,�,:SIU�B.R.��7H�SE3L.�s�'�S�R��,� �-,�:r.><.�'rr"t�'r.;�,�Y�a�;�.�`��,y� r: r��'"i�';�,;��' �'>�`��'.�.r,? Lane Configurations 1 + i v ,.j, _ «,.:.. f•._m:f ,mtazigum� :i3�`�..,,7'' .. 2'f,2,"' ";y• ,- '"(:.' _fit - y r gi ^y,�ri- ,.t i r a , ,ass.r,".e, ;,, .sx,h*;;; p y. to r n t.i, 1e17.t' A-,,riA:if;,;r„�^,.' - ., a.?' �iY ^t4,i;. _�`- yio'.w"trra' 1ie�f. .:[o •. '.t�.,��,?;c' ,:�,T�,• 1.(O,t-� '90 ,.t:4s.�;,pOQ,,.,;,��-00<.��;t900.�';4�i90QA, :�•� .,4�,a�u„ �ms��;s��a -��`��x+��t�! w..r.,,1�,t.��,:r, .,,�r.0<v�1..,.,�, �,.� k�-k#J�IS,.. �.. .•K„ ... ..aY.,yr. o r.:,,G`w,. ,r��:z..>aars:�^.r...,�,r`na t>.r,�r�^t»r:.E�t k,�.a+" 2'- Storage Length(ft) 200 0 0 0 c:�•.,gr .w. «<v,•v,:.T.¢;r" °t-.2 z�,a:'t..rk;'�tixu:r`<', ;.rrc;:r7,r„\`a, �;yz;.•,:V,aws.,,Y,� - .:C^' ....4AFi,Tr",F4 m.r-- ;;::rt:14,:.-, !e �,z, r.„„,;`9 :-;n,;�T a„ry"a�t;Y' .•}x'.A. :ry ,s5"<<"'�,.'FaY ��.:r,z�..` xeNr'y'Nr' -^�>= "A, b„'''�r'A k��f�h,`�, Jn.,.,, 'C,. v`is T , '�� -,. .. Q$; n4,;0 xr;•1 1P.w�*.,�.:`�U.R'. v 7,.&,;,, 'rfi'tY..,`a^71,,f: rA ^:5' I,.-en``�r`}+'4i1` c,u'•a'' `d'":.' z7t; rr X'� xi Ic t 5�„�i,�.�•>u...�>:�>,L`.arv..;n>,�::a..:lu�3�dn._tatYw.a.�b;+Y;dot,"s:,+.xa. ,.a.r.es`27..�CY'�1.�M�:ln:'�''�f?i�'.�%?;?� :'sv.43Y:r«•�:ti:nNtf.T��+.w�t,�4'+5?5 „:'SL:.ralaii`.,,U'��.s.�"'�f3::§�x�'.'�;:2�ffS.ud•ttT��F,'{�,A,�:�' 2'r�: Turning Speed(mph) 15 9 15 9 ASJ u'F;,i,�.',�+ qox^^,,°'4Y ?�',�{.?•-r.��U,'�F•i�' _',1:•bqt� •.r,�,. ..�. {,;} ,.r.S::,y4..n,j, „�,s "'o-`, `.:C y„�pvrJ`�-t;;t�..t,�.f,��sra,hrz:s'�,.;gTn�'7,'Jp'Ca'.'?•'�.,}J,�..t ry +Y`.a,�>•t'a�lf'1"a'7,*'� F uJ' e`.�,Y� {n,fi r "�lI.,� ((�t 1y-r ,,..rzt��[jp < t., ih. 0,:i Y'+4 i':'.A%. .wf"i.....,'t:, ' , .. 1 ��. lit t�l�; ,ri. r;?3> p, i� YJX t.'�. .40;1:.,Y."'S;d'e�;!• .Hri�w, t „%F=:'I::ll.V,a r`:'•IM.f,+Iz"%: ':', •,. 4s r,¢• `?:. ,-#', .hti .u'1R5�_:sn.r.,s '-, }�1 G�.aruw.^.."v.w`.:,.��::.a..r,,.�•uZ`�caC'a�.�,ilw.�....:T;.- RV .,,c�;,tr,c.7t}i'��!S'•.�'rsiu3.n..w,.w.:£n�r.,_-f...+.:,'FK�St.•C kn-s,.r.fT:Y'�"•""c`�t�' :.:..k.•,�:�..`I�,.�.Sbrr.��us..'�..07ae �.'Xtc�rt!3wa Frt 0.979 0.973 ,:ar>•rsex��uh•rr}ry;;<,j,:,e Tr r.a"." ".r rma �;;`�i�?T'' "? e "Y,�'.,-'.. .aF. -p ,r+ "r�i�^r^ar i. �^;';;'', i;q,.;!k.-v $`r.. ?mzFl '.Y x; ft r.'}eted•7 ng�.�wiwgaf 4 gwter ,,rr,: a4.;,�� .- �,,L `�jt,pl try-<;.,� a r `.t ar ,�,�,y�yp, c ¢.:r,. " ..ma:a47.a„..a.,.,,,z.,». 'F.u.,a,::.,:r.§ '4•sY. , ,/;! . .,:.a.'„).%.tlr,.'r`x.'ite';, acxca,*',1 :4.$Frx: ig.' u',1,eitir24.,S.,�i`��•1,S:,,k,Vs.ilS4 s ..' $�,,.L2,. ., ..L-- 1 s Satd. Flow(prot) 1770 1863 1824 0 1545 0 g >4n e • „ N 4 a M I N f1615 �.�r rR^ rs l l � tk ;ti2l A rv1 it-,./.+}•yb0a vs in3t .,s�;c,, r. .ti S atd. Flow(perm) 1770 1863 1824 0 1545 •utyr 4. R 'n• ,.ty �>� � -sh».s -�. ..� y�� ,S'- -'-rC' 2swac.�n��.�strr-^��,�,vr-. .-'�'�'F"�'a;�?�fi; ,'.R j ,�^� O mq -IT„ N rtC+7• S ti '. �Y?'x'c•-1. 5, :3, s L •t�'•a;w°'e't ,, F-.,i �'f 1 Te. .,,, 9h 1„PA �.1. ,: ? 1,.� aQQti r,:,; !iL�Oh ;i:00 :,,,,,r:,: t>? :' ` Ir 4 e,.� : j',,i?i, ;. ,, -�y `' .,' .,.' . ., xt s b.,S.,sn'v,.�� .„„ �,,��;. �i'F�'rt«a'aA�.,�.,.,kU:. 4,.�:.€a�.�{.Ava-1..m`. t.Y�i '• ,�" Link Speed(mph) 25 25 25., -a:;-e ;rms„^,:', NT-w„x ••�,Ri?,;u'�'•'srr .rt..;,?•,' _t P :?k r •s ^r6 ii- ar 7r�'! '':°m ,C.'s.r, ,3..��,;,Z . 3 rw.. ,e,: r,,y�ti- '4 t`t•.� 417i'P` r: H, k r+=•-, F.,*r�``� a"'=,-Lc a 'a"&d2, 1,-,N�r_'.. ,1„,'r.„'-'�"�i>Z;� n- Y.i1'I.'..�.L„�P��r°��rY�i1a��,°insvie'..� ."� '.e;.a:?�':• �:.tr.,v,:;41Ca'Sr�J•tr".�'�u;�'�w�;iX.r.�'u�"M.�"`�S�°-�. '�:2t.iJ6,.�.-J,>l2',1��.='":.',$ir`�i.§:'sfirsf.h"aa�r'.:l'�r'F� ssc"..^�s`9"v'33�riTtS.x,S' Travel Time(s) 36.0 7.9 36.0 ROIDY : ' tafi ig �r S 7f M uERIreAR ,' : 117w y Peak Hour Factor 0.84 0.84 0.96 0.96 0.68 0.68 C �v�g[ib iffiV N b - aT Z„ rA :VIS5tw I „ _A r 5 .E DIWO,A,. ELi, � I • Adj. Flow(vph) 14 189 314 59 53 13 _ - .z-"-^ f..,x- x;:.-;.,. ;�z^•.:r: ,�a ,,,;x;;, -•txr,z*- "'/:' ;t.fi1;;5:'4.!'>'�'� .."�. "ti>'+�fi��,*�=e8 ::� �a ,.:zr.srrr>z t'e'.; f"'!.; .3° ":?�<: "i. ":`i n `.s': ,-.u+�' 'vi;-Sp,P.. ^�rb�e' r?".' .,:�T' WV,p,r,t.,,r "f+r'?t;`:2', =`.f'"' .,,w-�'='i"` .'5i*,r :srrr'�:''�` �..� .vim',.'.:+„m, /�p,(� 'Gy,�p7l��iv?.�//► ��-.,.}$:,;---`f4�:��;4,,j,R.gr�.',y.�,"373rF;,::-rv�„%::�0„ �T. ,66,;rµ:�,x„=1m��'�:.x'=ram,.�. .`.�.•.�:, � � � �.;,,.:�a��>� ,{�t"k,"1�'�:�4Y.��`«.»,wA�f:l.:•��q5fi:bxa� 1':`-`.f..Jk.:..a^:.srL�c.sT..:.�3�';>`�:3a,^:.L.,.�t:r`?>,:.-.,x.....^ua,,;?rv`3h.,<:.,i,..,.,..�...Ar... Sl'i�.ti...{.d'�•$:sx.,..,...vz:�.'i;o*^�s�>},....T+.'->��`,z:Yw`�`c^.:~:++'3 a.:n � Sign Control Free Free Stop w.F xsry�x;' ,t%.�: F sl e .m?i m c}',..^1;: T y« a."k«r; .?5"'iX.. .v yF'.w !D,r' 'r•�'? '�Y.•t�iA'S.;n %:-rs•'''•^T'a.' y, d.� `aF.m r.:: i • ^,�;^.� '" �",'`-'!; 'A�% '�iz .'nfts'm?..F, ^=un�'s,:1:,�1�',N'•d`F.'' spa' 'ti: z� ,ri:<s',_fi t,�°'v,,t wer";9^'Cky,' a xw'u..,,,„;,,,k F' leis xJ!!!LI:;!tial1.�'�!n'b, i�U .isi:FA SOU.:w'��'.' .,<wrn.,„,.:...;s..1�`'.:;i ;•.;;...r,,.t6,..:=...i^..a...•r..m-,t',.,,....b3.'r°S.'�'..,'�.n t�5i=*.�Ct;tn ,,.�m5',Y-�w....•.•�.,.�d7, ?f:".,.., :�,. xv:�.r,r`,r'�, '- '�F+;*., z f. Area Type: Other {i • _ � _t�fi....^�S:Y:�f`•,�,r« c,y.,..>?N'py S.• :t3Pr.,,,T(�i :�l�s}+1Tl:t ^,"; i'?", •`t'!`YII?•" t'Y=P:.. 7U:y�•, ,:]'t'.•v, '-Y^'.i :rm:4- w.,:C�,•k.:'b`, h. 7' 'CA.. t}:� "ti-� i,e1' ,.Fiu;`; }� •'.,r�:: .,rh;:;•t,,;x"3t:,m.i /' .rr'G>'rtt tW.Si. ,fir: D.. .�. ..�, :, EN IZ fix. A .'tz�,}+r".::' ''•�r',�l i, r"h,Ii,F'F.a b.Ti .r' 2 .�. /� cI �� 1 �'.,t.t>i, t:` t: :,Y;, 1,.,rri::�s.",';:>,.�,;;:..., .:a� r''�:t.F.t'n';re,.'N;:�r �•:.:�,�-• 5�''S:}�,�,-fix.,;fir.�<•'n>s'� V� �QIt��=d�e:5:'Vn�'c.7.r`�4��'z,�Ua,,�,a4t:.x:1 �'cY�t�;'^.'•'F'��r........%:..;exh:�Jr :ts,r7:=.`i{•, r,��.._a,+s.<u..�^.,J>.u�.�s,.;�dC�Jfs-.i.'�'aas�..,�,.,a..e_...>t,"�i�"F.tu`.`::a�.L..,..4/,.-..u•�W',iaW�=.uri� t.,,.t.,. Qs,r4 Intersection Capacity Utilization 32.2% ICU Level of Service A t I It��r 1� 41 ; 1Lf ` F1 i Ca L,,, . .,---) E, I ..__, Li• l __' �...T3 r•^I 1 n Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 l BVL Page 3 a - ,r HDRENGLVL7-FF51 0 - 2: Lake Washington Blvd & Ripley Lane 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak r_ 'S=•'m�rnf+ts:+u_m:.:':d-�'""'e�4...�,�..< _anyv,',- r,.>(.rm'�__-_' __ ^.S`5, _ ";,.7`1y;• " .Ti!ereft?F'3.;i �-✓Tt's ��'; ,_;.. .•'Ir,ry, !::•f";L' :ti. .r'P +:;'' p "js, t-fii .e. A�",i:.'.,..a4 `,.'''sbr's"'7',:_7s` s:r:.a..gr.• ,,. ',;;5:�' LL:`r" ±i t {/ .rx,�' rfl..^xz. L4"�={.:'.f: 6Y,+.;,': :B-}l raJ,>. C7.p, �. p 'x:»b ni'S� ,. ;•."% r„? '�.5 S z a�, +.ct, ,._. :sG•, :�,.� t'-'. 3�':. {Vlp.$�.@I��;,��i,<,�.�5v..,.dK.d,,,.. ..,.�` ;1..+ � �i':''.,,�.,.. 4•!�,,: Y.:.,+:, 1,k..¢$:u:;�:ac"�,7.�!•',u�5",'n:'��.,x `'s 'xF!:,:ru..1a', ). Lane Configurations II 4 1 V _, ...q,,"., .k",y^,.�3'I.2^ _,Y,i .v _.;nr,f`.i,. "✓'Y -' :: - _ _ rJ:ie47-T-,e,';:.:l,: R:,,-+R. ';•R_. ji LF,r".: w:t:,, -<f"Tsr-ws i - '-'L ":rc` =��J.,t.• ''.,r';k`" ,v:;:+ ,�.•y,.,;,;.•�7., 8'r";.,1 F r:•' _ .�,,. ,�>;C,°{t:'r�a,.,r<5',3.'-y,T�+!..,`.',�.,. »r'�,r=.� '=:�'7 .,x"*r..=: .t,,, : ;i1 .a, '•{'h_, i ..:,c.,s:g.:,;. :., .,,, t._,�� .,, :'#=.,:,'s. "`FFL,'%t", o-gc,.,f , it i•n��C"""�t�'o14:.f., >�cY•, �. >Fre . Free�n •.<a..M 'Sf(`�n .-,v.:,:�y.,:.,><:, Mrs' ;�,>-'t.�f�.�,. .'.4,:,' „�: `�,��'�F':.. "�'�`, �.�.:",e.,,,Q�.,.�.,,,.,r15.`w.w,7L:tti'::«;413:: *�yi�J,'ri:kW�,ax„'3 ra�::•.T,;;Ir"x:1rFR.>n �a;rct:,:,,,,:dx,tiSS44.Mf..:'.f,^.•.1';•it'„�:....w..r.-w....:,'a:.z_Jir.'SY3t'.,.,,..t�,i,t.k,u17i,8.:3Y,Fs�'.ui�,_w>la'>'�'E.re?}ru.ha:>�.,f..:',r,..•,wt:s,.e::.:;•�.r; Grade 0% 0% 0% r•7m <:n'r,«'rr<-.-e:. ,'-'-1,'.�m slrt:ag:: 'i•�:- Z'f'•AJ.y..,_.; .::" _ .•;'r§-y:,!'„^„'ive .i sM-4,/,-3_,,,vr,:�-'r`>7.•-.,§:47.r T+w,,.iN"^,,,,,, .Ln' &'4',3„< =iPr:. ...,t, e'r4:: e::F, -f:'r,. 'a;`�i':.v,. >'r` .ar�'. 7' ._fx ;:1 ,:?a.a;..,r'z. ;}�'ic,�.' �•r..+++Yt ':i.. a 'e.G:4i5�, E.,, :,,,a cam} ,'ne ,N.,,i•'.2 s,,, )?.,- , - ,2s}.: l.;*: el IUry1"�'7 ��h, r.:�; .A-_. .y2 ��;`j:` 9`�<« �;s_301«. ..w<';��SZ`�'";�,. :�6 .ri=r;::9...; €• . ,� >t- >: a�-,�';:�::,::;�,. f V�?.a n?,,,(yeh,� ...., ,. �:-vJ•ra;, .U:z,• :�ssxrt:`<:..�.c :akr r;k. Y:<«ZN,,«. S r� z::xo13:X':�::A�..,u�.s..,e:.:i�r°.^ td_'r.�s„i:'�r_.,,:Hv:�._hzcc.�_. &�F4 a�v'a,L.,.x::::,J:$'�.,. n;�: ..6. r �,a•a., :..�.:.,. .rr:,�,. :,''�.'�.'e"n �"i�:.. 'r+,'v<�e...� 1 „� Peak Hour Factor 0.84 0.84 0.96 0.96 0.68 0.68a • - 'r:,.. .)k+4: - ...37_w-, 'r�<:"$:y's - >,Z,:y., -s:f.�•C F,.{... -,$.rw�•rt :4":'v v:.�tr2v 'mil :3,• .11 '=r "a" :;�: - s,ItT•'... .;..i:. ''%; iie,:d:if. i`y,:"'�-,� i"i•^•.�'�r�''s#, t- %.�':i,'. u,L•. p;� ;�It.. t;F ,.� 4,,�q v..tl..n<.e`:;:="::;:';y,`�:?.. ^c. .,k, r. `L�F= `3'h'a.. xl S '::a�,.yft,`„�.ts,�c-,.r`:71,,,:`z z .l ,:,7 °•ouFl�"�`,flb�"/ pt ;".-, r,.r,. a'4. r:�:;� 8.9=:r ��••:ff:r,r<,�9,�t{r{,�, '�5, �:��. <,�' �' �_ �,rF^ ' 1 ;�,v� ::u1S�:.,t•�',75��.2:`„aS.:4,!siS� :sF�:`��..aai7a?rd«�i�u'#,,.,xrn�w.�._t:f<=h.-,.�,�_,.,ro..:-.-I,a�:..:.S.;,Sv:,?+uk,arear.::.,,..w.Y.,vx�;:+.tfju.il:;ith,...rtl�w'��v.>.rar:i4rra�:.,.tU;nW31.:�•',J�,"w�:h."J�'1.iSir,7;.n'�Ni,:,%?�k.��'.ird.2..'�Y��.1 Pedestrians r_ '=N'(+,'h'' iJ`{ci ,;,J`„m •.7�.,�._,!;3 tla/.r•:171 r: i.S.v - c.-f�;,m„yr2,ytiRiw ^m `.a�%'S.S:• .),3^.'- 1 ,},"s'lr ':�3 Q':Vv- •tiT G' if t' "��.7i • ..E,. �.,• eir-ar "`"'t,+y-'4-„'w,. ,,,7vr..y ?'(: '.;,4' f. d-g, +'i ,rZi't"•3 •:e-; 4-:f�(. •>y: ttS Y,';:, (:. ,>:s'r. ,R: �i „a'.< .r:2s, .,,i. ,,12"�';;c: ,4•:tl,,,,f -:r;,: ,ur. � �rr , Via, .o'+s:,r<.a r:,v,:ri"»<:,,n;.,,S`.si,d t I,t{.,�/��++ (�`',j� FPry""l'r ,.-1nC -,F•- �•k::'^ -.=S•5..:i�. r'1t"* !:'(,4•(;a.N ?iM :,, %14`.:'=7'4.:,. . /'a ,iJ, ,�. �a4'..G:}.^�+.�'(t1�1.'1,�'1� �es t+arA'tii�'i3„>` f� •:1.1 r..k,. �.{ .D'C"•'x t;7�f��Y^ .'r. y�'- .trs}:� t :r..rv,::e[^',.>.�..,/�;"sis•.r.x:,.f, 'RSi:.,,i,t;/.�.,, d r,,.,,.c r,.r, c#G'�iaR�:.Yt�.N'Y'�;.n,,.«..,,t«�,,...F�4.F`e,':.,:`3,>..'ia>;^,1:3;:isd.)4&'L•^;,,i�;y,r4�,.tt,,,.,._.eG1�t'.Y�.,<,S2fura�at.5r,s3.._,...,d.:, F'4rcct°,tt:isaz)t.*uw,.�u,.rh:Js�S•:::«a+1 Walking Speed(ft/s) �••� a•._ - ^*t`;•"1rvn ,.,�.. .�'_.,t:.ra�:";" •"c:':.'.:7','FY••;Y-.ry...4-.�^I:, xA':a- tax?^ ,..�y ::y' .^,t;'r:':rl'<:>'.�.. �.?.:Y'"`ns"tii"v,.,.,;�..,•*fry. .x'z'?'.u>;^ ,'ti �++„yt:•,a p._.;�- ";r:� �.- u;.�<",.h,.= ,..rc�:'r `�°-75-. .,.?i y'�'s; ±'>z.:.,`�'-fir„, ,�..f<.�t": _ ,_?t G� ��,,rrr r, r .n":H"^'t., ,,,?,+ ,.ff, {i,; •;�: .'!;;r.'.E•, ,pr;:t"fM",n.Y,{« 1":,.4s, SGv,,;`."•;x`.; ..r.',-r'„Hnc.xrt•+a.,.,., N <.7<d T�.ercenti).r cka e.., ,_ ,.:�.� ,1 ., gi .fit {,> �«r,; : • ,r',�.;t•��;:; :�,.,,, ,t'',. I .3,�,, r .r: n,,raY �•�E.. .. _ .:,=:�:,r: .;..,7,n:,�A •sr;hx.,.,.+�cww,.c,.,._,.;�..'isi:,:�.r,.�C�:...+.r:r _....>.:K.War?+,5,.':�°e�';:,.i..,r„i.i�„w.,,..,.rn......,...:..,Nc3e,,.mot,Pr.':+»,Sr1�it:.".s~:'`.'.v>„...,��ss,_..u:t,.�a.<t:,�t7.�4.,,.,�.c.: :r>:.TEaY«�z,.,,has.,�:,c,...,w.x. Right turn flare(veh) Mdrarni ge n Ir;a.5. c:Fr F rfr5� i1 G -ara[; VOw Y :.a. ;t:SS:'_,,? �,r f{;v= ir x'f.1.1 r:,Y: ,p,rn,r=q;`1.1.� .-.3: .<r.�- r wt.> : 4 „ �..,%-4ic:� •�r , : :a. t¢h.i,:ia :arc•.Y: v': k1 C5 „.i^uusx� ;{r;i,ic wF»�N��KaN. ..,tFe*�Gi.o_ ,,p'; 14 Median storage veh) a �M •,:;rr.as-•r-� .r;..m�•_ s'rfI i,_- r<:rn.'S-va:�:-i"'r::L"`�t..v :raL,. 'r=x•: r2r-K u:5t'C'.T' „^.;sf^ . .,.,gr, ^;'^P,-•, ,':`-'�a c' �'''e:',,t. `F�-.F(,,S -i' ^'T, �-r,. ,. ;`,',• .;.r<,;.i`R ": 5 W . 1 .°, 1 ,pCPri,;,.i5r:.t':=,<r'.v,( ..;.. �, r, -.r avia?re r.,«/.4,•?'r»�,{.i.,•+`c,;y;�al .n,^, ,f,,,, +,a.a.:.,= x.<1':"7:�'.., ::,,, ,., gib, 't: iCi .Cotaf'C+lj(In'17.�-1,,:,mp .s,l�<Nr., .:378 a:, r F,. a}., ,�.. ��'�.:..5.61":;s,.,.,,��^'u�''„.�_.,,w ��-r}.. :� .-#r,•,-� r F�-;:r :.t, .;K- t. ,F.� :.'y',� ��'.+.-lr...I!�u9;s��.-�,�%»z.',wi>ir..a•;§{��..,-.c.,,.h'^au'r;`t�>R,R:of�fi,Lw:?,ij7'g;."�:��':.,:'rh='�":isex�n5,c:i,.r..r•s,si,.,f.fiS+J,�.-.,..«�'.tt,.,.awl+kr,`T.':�•«xiic!r.e,F.:t,dait:lirw,.i.'<.a3,.tNr.F3�iY...ss..,..,�.a,T.n,Kt,anY:A°,,N, vC_ 1,stage 1 conf vol �fFh'." .,,� °5'-" f,a`=: ✓3 ..=rdr. .h.<'n:.i�:•r ;a..•�•.,,,.rrs. y(-�J� j��'Qit-,','•,��:�'�{/Dlx, ..yP .j.'•'t_�t.,' :.ram::r... �-r�' ,�:;N:',*r'rt f.}'.'rf.t.�_., ..^,v,: x•s"• .r:-. • w�.'�Z..,t.5,`1.,:,�:�t�.:,,,...wn....,«..,.rr.�r<t+�:kw,:,'J.'IG�:=;:rz'.:}F._?�,v_,.+,..,., .. ,...;'o�...w,.:,.e:.Y:^:sib:,'.'.a Rfl+Y'dt.�;;':.,,._, yM'i.:r;r)'.i.-u..�,ti�l-�c,..�.,.t1:'�..,....t.�',",:i-`�i,.f9..�,...«3Y�;......Y.ti':,.,uC:r,.d�s,_,,."}..E+:....:.z,:.+A7 tC,single(s) 4.1 6.5 6.4 :K^ .rn. ` 7M i'li' -Y,,.�'•' !,' Yet.' •.?'.r%i,:' ':10•2 j / ) -f.' ff ..f� r i " .aYM1 �-R�:" tG,<2; to : >r .�?�,,:.,,r,' � 4 �..,�•r:p a; �.A' .�",rc.:�;,a-,a7„�.,rl.�:...'T..._.,�.-.,,.eu,.,.�.I.L s.�.:.,,:>Y le#...«.,_.,,4w,...+....n.. ,.:'�,r'.,. ,r..:,.�.i,.�`i5'�� ..'3:7:'•t'fj:�i.�Ct�'.`Y�I+Y.�-'..W^P,.,:�15:!•::ii.,...la�a C..,J. «�Y 1 tF(s) 2.2 3.6 3.4 _ -•ry.`.y _ -•.?i', .,y.., _nifv - :tea:r%,a'�- „_`.x"i^, __ 7rr;•c "Y'+_8`•Tr:� �?Yi.:',�"°-'-':� <'d '!� .PO; :'3'7r'n ^,�l' .f1 „cz?:�.�'j.: .v.'a.-drr'� „E �i� �='%'�nC•"x.--..,5 e '4?�-%"�'. 'N�+-''.+,., - F. L L,� .'S","N.r�,t,<'F ,?.. ;'.'`i.. ..,I.^:.d'•' -,f r' .r- ..F..- ,Z: �.P,,:. a'k'r<r_ 7,. ',:x�.>-:,y, �Y. �.'},�., ',X:piFt .zf•- ..:'f::. ;;1.�:5.;�9;,x .�, S.w, :t. .',,x,.'.�.!„-.;i.� r<E�+?.7,4.. :�F' :.' ;t,.«.,4 F"oiyy.��'ei}lf3,ff'B.,.Y,/o:�°',t <,. ,,~..:9$�ws� �=�-.,,':, -..7�« ,r;��;':,'a3 :�, .r,.:, ,�>J.�.�•,, �:.., ,��.�.,, .�,tr:.,.«��r...,.,�,(i... 1 � ,T1,U«,...",."e.>,�`..n• ��'d�+-`_•":r,3.£..ra3:i .w ,-.,...c,a'.F...,..c5��s:,:s:'1:':...,«.,,.::�r:_�.,.... " ,_�.:...� 'Y.t...es..,,,>..,.>ar�X=S�i3:';.i>:2,..,r_•a�ir<"r,..�-r>.k,�r _....„f 3,'v� cM capacity(veh/h) 1186 462~ 671 - - -_ - '<;":tq5: '>''-•^yc"'.�x':::x•Y't'.'- rccc,'^- ,N'�:• J�""�::SS��x,*;�nai g"3: 'i:". ry;�^,''s.';.h r ,x'c<' �•«h FY'- ,�ysca J„ ,.C.FZ:.'':..v w '!.s r:r• ,1.,�'..ta Y f Rb l if r aF, ^7{ +':l W±+"`x.^, `-'•Y�.- e..A.I ..f; .`.,,,, rhi.:S�".(:4v�"«., � �t '� {Y .-„� �$3'«yte�a t ,'��"' �...5: p t.:j:«. '.ty. '-�,ri �.�,y yy�SeF� +,y,.,} .rVYa,'-',: it .y{ �i!el"if,d.' ie: ..sA ,,:u? .�13_'', ..0 .rlA(n .::�' 813..1,,,a�?;sj"�,7J�''IH,:�t:l;'�+,,-,:'',:,Y i�s'..",'�i�l'liE.�yY`� 5-.c..i.'.':e.'S'V,.!�:,C+vc.�ti4e'iiS x.� ��>. ,.,�t�f�'.r,�.,, S#,{.Y<rM'�Y.�(i��+i - Volume Total 14 189 373 66 rtr`••- ,f., •;i^';+ +:Y'. - `:FPS^: :?�C=^ .^.'r^'r'FS+: -'tii:`S,l'L:•i-,.Trn p�;..�rR M Fr� F.-. 1 . , y t � .1.,;7-�,�,�._.w:�� ..,sa4.]iL^>~�,e.._•:�.`•,�"_a'ci=.}:, ...a�.x:t:�iy.c,.__,o_,.,., ....';.�J,na ...,>•....::•r•_„__....,.r^..�.•,,.c...c:s.,..,,. ..-:,�_rr...,..,,_.,ax=.: F,`':":13.�};�^,��'•"'v�'-"Fs�sa.«.�.,-,a'Y.`rv :.'';:::::s:.;,.::5,. Volume Right 0 0 59 13� ar: v'nC ` <r 7, ... .:1'i, �:Yf� ..4^ 'i ':j::- ro.1.-" d. a, �;:si�4:1$"6`'r;'� 700_.' 0 :'t4 2`:� ':rr ':u`': �:�.�, -, .,,. +L;,,_ ,._..t::'�§"� ,,.+_,�.w,.......,-.._��3::;is>:,.:_.:;1`:a}?Fvi�w',•:h.. ..5�'�N';:�1z'...„.a,•....,..?�k'+�,. d«f° r Volume to Capacity 0.01 0.11 0.22 0.13 {,J .1 afNr^ ( c:Y.- .y- - .•�:re,cw :_Jy'"U.'s r{t,r:,•^f�L �ue' yen fh.'ft�r r.0 .'8;: 0'...1. _�,« :, .,...,.....t�:•;�,, e•1,.�:c,RaS!.�..w.,sl:,.... ''.,S':i.._.. + ..,,, ��":,! r..:-';.. ,-_.,,:.Fre:t� '. ..,, . ..%''ze,;t:.`."�"�'t::"';�>''';;'•. Control Delay(s) 8.1 0.0 u 0.0 13.4 t-.rr^'- -' mr- ,e:P •+t 3c,Fti 'X:'. ,} -'s,: .T, r;?ta.',rs i7.i.T. t: `7:,!fr.F.-^7.;. „S.n,r,S-F..{.� .,;fir. r"s'ryc•-rr�,, - ';c;j..T' 'c... "si.•",- .";s£w,:• .:4,c--:.'�(., '-;[.d,,.' ',�'1�:..+.. '::Lt: rod. ' Approach Delay(s), 0.6 0.0 13.4 _ cra. -^r' S '-r- ••S O J.,. ..des ,j:�: ';Y:, ti:F:Fe`;''-I`.:'.:.",n yLtt'i i 9; ' ti'" `: as-'.,. ,a, A'1'�nroa h°�0 .� xr =�:�^ ,'.�`=srµ„ �.•,r,.� ,.,r4�. - 'i awl'�G�A�,,,-....E.,,r�,•.r:__�.hs'u✓�3ct{':ruwr�:�:��'•:rr;`,:�;..«.:ii:•:,...ir,.._,._K,-......a;�;?cl.`_;.Y:L.'''..s....,.,.,....«,>..:;t.,.._1,..^..:J,��:'-::s:_",�:....�r:�rr,,:::i�a;,..=�uti_....c"„�l.u'`'7v:.+o;n�;' '--�rr~,.�c&::;a;•«k°:G�'i AEC c'�.,,,.. I _,c3:•.� ..xs.'.- - -- .: -,.r.ra='-•sx'x ^.:': .��,. .,,xr. t->g;•r �=sq, --+:lr-' mnsrt.� - a.'s:.:_v-s7.ti. - it r- _ ^;'.'�,5,. ...�y-,'_2'.' - .«:i.,,.,.Y 'g?t,? Ec _•+Si+`"' ,:e.:,.c" .1, -,.�;rr •.F.i - '' -'';`3«::=`'i'x-» _ _Pi,wiz^ 4E1 ',:'rt'n * h-•._::t.'CR KR F.+.. i:t"{:*,': , '' `k.; ';;t;,s .yb�':`" cSi ??,. °<•,,h''':' .) .<,_r, r'':!: .eelr'.Zx:^:'_. F ,r r ;+...r'a !3. ,.r'r+^ fr14�.r��B.C-M.Oh,` r�r�'.�3.I'�/.:.AzS�9-r,,.:�:�;s�^5h'c��.?=, '":P.:�-;7'_;tr'sz,t ,-.,i!� :>1.,:..s��'.;F,;m.:F.r ff�'e�"?�.x c„�:F_`s'��rx;,,,FK�,-.'"';b,s,:„�.,,.};`i,,:rt'..Nr.e.err.,..,,iw=Tfi^,r,.t'}.°J,aa..;o, ...�•+'t,�._.,..r .,. .,'n x,a..,,-. ... 2 w::•,,,,_,.,Fs9.:,.....,,r-S �e.'° ,r".fi.;"� •::i•e'�;i`.%S'.,!.i _....._. .,,. ..t ^,.. ;s:,X ,.,.. 1 "d;,';v,�c'. `'7,n,-, zaP >'s,.. 41 y;Y.`,,,,• ,s;:St7"=v" i':sE.,S_:$rrt' ,:a r,;,r-'r:- :'a:;'r.g ', -., ,z, ..,.(i �{.. ..gi-•'.«v -�°tx+, 4`a':'" c-,i ASrer�geaD�la,Y'�:�.�,.�;�,�„�,:� .."<;��=:,ea:'.�>.-..;��%;:ia`�_p., ,: .�,.i.e.�/:• � �i.. �< G;'x'•�r�if:-t-+,:.£^.?° re._;:,'',ru:�. :�'u:SzF;,.,.;�..r.-cr?_•;.��,5'uw��,.t,.:Y�,,S �.w,.°° 1 Intersection Capacity Utilization 32.2% ICU Level of Service A corr='-= :N•ns,r.ra*:., ,-�•",r-,. ra :'••�_.:+,:,' >r, :.b,., r•:,-c::.: _ ^1.....,SV.r,:.;;tn:�.;:'t;. 1:..•- �•4i2+g^_-« - - �',:r^a�..-r;:. .--..+_.o. �'7+.,F+C?'. ..s• ris,. � ,1'S. sr4: ai, .n'7r -,°�;K'�:Gr:�`,.':'^ ;.•.t•,.'�:,':,�a'''`%,�✓�,e., �'.:��'a�' i:.'i'�cs.�3:i`n•:�i��'i+k,, `.-.,i�i2� :'=;,,,- ,� ..r1(&.a< .t,'-:,g`(.-Cr .. -Li -r ;'•,r;^.s. „tiL:,: aa;. ..ak,?Z;;9. {.> -Liisi a<, .. _.&;51`}rT,,(.';;i:_s.,,,, : r,;. „,k&(t-.,. a"%:;-4,,:n-=-l.;.-,k;' ''$ ',,. -r,.«,... ih ,+'a"I+,:':;'- -`',:� ,,b..r.Zr:.l,�, s r.'u't•-.- :5f r`t-` ,..• - r,:...ff. k,�5,�«..�: r.,.". 7t.- ,�-:.... t _ ,.:2'3 ��z- 'r`� '�d,:�, .�. _ ;� '3Y F�5�"-=.'tn;'�i .`_^::vS '"�az. ,?�c.,,v_�-... ��.., tca �� ;..._.ur ...l_ylv<n...,.w._,,,KiL•,�h'.:.........:....�v.F-,._...�..YY.:.c..,K.-.,.«,..n.-.G.Lfr., ..1t+.'fi.. .......,.C...r.«.kY...............s....._..S,t _L•S.r:-'-r.'aY f. • - J,:..f.:Y a+.e D • Fr-, yy' t/ •'.4 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 4 HDRENGLVL7-FF51 . : . 3: Lake Washington Blvd & 1-405 SB Offramp • 2005 Action 9 ( , - - Barbee Mill Property#11735-001-002 Timing Plan: PM Peak --fre -I. .4\ t P . \* 4, 4/ t, aiTitaiifificMIMWMNfieattiaVaTrigalliONOWSWOMMIAITAN$E11,03.TOIMSOIMIST3117:43,40=710811 „.„. Lane Configurations i+ ) t 4 , R.1.0114WOMINAIERAIP.051..011.9MA.,034745.1.0.0020440:6510,00:RxTMOSPI§ORRTKORIWYMMOTATTO , Storage Length(ft) 0 0 200 0 0 0 0 200 ' _± viy gtokikaraaviC,4,77-(0.0.-.06±±5WWiinfo44,iligfik±fe,Va.±:gizlii:V±i±brq./67(fRFA ±TiNrr±±4-171V-VV.iflig,W,Ifix-5-wir“.,pr., •.,..,.,,,,e.W.,,:!..t:s Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 , Vis.„±J.,,,t1±,Alfirdillielaitgim,3061SF,±4J-J-„---,146,,,g',,41Q,!,i,V.F.± ±±.-..±,±'-&10.s'''''!„,g,4-4.-,1,!.6....fitaklifigigg,±±Iff'1'4,:-.,1:„.:41411.-31,filittlf6.200,1-0-47V471*.3PRIBY,c-15... Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 100 1.00 ._. pe,15,wasstegewpipeewstriviwarzato,,,,,,,;::,ii,:1,,,i.co,vxm5p,g:F,„,vva*,,,,,r,:,croziwi,,woce,owtxfotwa..x,wrazw,5,7a,va,st,_,„ .,...,......... _ap,...„.,,,,a,,,,,......4.,...,„b„,4,,,,„ ,....„..,,,......,,„.s.i.,„,.,,a..,els.,,,,414,.:6.6..„.m.k,,,.:„..24,,,,,,,s_,,,,,,,,,a,,i,,..,„w,.0.vseekazdv,. .4 ,thwAtIrwsremzy,i,...,:ym Flt Protected 0.950 0.954 .0470frOW0T6irre,MARVA1PardAsty,e4W;onktwAilli d3iffgakkizW±6t7dotimamEtrimmo„,,±16±-±rre.3.9/ftyTem±4±.±-qi-mupwiwgittf3-± , Flt Permitted 0.950 0.954 ± -b-,±A±-.±-,44-e-iway...-c.-;,:givrgestwwwimpay.431466.6-±-6-7,14,-eggqiivi.:N±.,5*±tw;_pf rmai-±ift.:±3..,,witrzmwor 7p111,±Pcrr.:±v,,,..virgrraw-giA , ,ra-6-7.3 .: -/kazgiae ?km,5,,w ,-.±±.±itAii.d.4ottimtwywhav,E.±P,91±? Right Turn on Red Yes Yes Yes Yes g.VgIFSIMMOIWAREMBEFEIgNEIRTMerThW47i*WftWT";g"fV51!"±±rrli''77K "Wrf5rIc4W±zWirg-6-$ L±± Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 ailliWirelilitiVrtZrY/M7}...,?:-!-NT±f0 .V.:Wi-Ktipm-±±-±±2±Wflyof.-±rf6T57-±-rmliowisiw,47,tgv.,-. -disver,,,,gmap,7,),I,1-.7, Nf i T,/ 4; „,„„., ...,..,„, .,..„ ..;,,i41,,,P i:•,,xd„,4.,,,00,,,,,S0i,,,,,,,,,AL.,„%,,,,,,:,,tg,;:i.W,w,,,,4!..,,,,A„A OZ,?r,,A,,.....,,V,k,•,`1 .4„,,,LI:45,:kgit2,0,,d,,T,,UraWY-Ki.cta.4M,"4.alawndltalVAWridtster'EA Link Distance(ft) 288 572 1320 1319 VaiellififtWATWAWrieZeRWQ;gy.±7§7,4:±z±-4:Mcf.mgf:-T,m±±74.;q97-6-4re:Awi7±7±g±,±-,,at,lic-Favl-smeztweil-Kwr,r-,,mr,q,,z,5,4:„.,p,,,ot±„F.,6747-wv-4,-7,7,3„7.,±s,,,,,,,z,,,„:, ,,, :, o-±AN,I,w>y,,,,Y.,L,./da:±±46P4±i±1134±±±1ga...t-Nt.C.9..M.-vid'glitgrikz Volume(vph) 0 171 23 197 154 0 0 0 176 6 194 1 ± '110M.ROWEiRgittifiNEVAPPIESP.V241gg.11210.1"eginiird:PIVERTKIENOVIENVENtit1612.02:017#976: v • Adj. Flow(vph) 0 209 28 270 211 0 0 0 232 8 255 ±,ff CiagiiniciiiiftiMMW1±:-roXSVOrfa:r-±4irif3±Ar±:t16-.V..c4finnyi.g;.±.±±#±-7.,±-3,78F,odzgwrinb7±,:±±y.Agreq-r±sip,qs:tardwr--44674-),±z.±±7igg .....--± ...,-.,&.1....-..-2...,..-.±,,:,....±±,-.:A ,,±±-,:±±,-;,1.±.±-±„iev6.....A±:±5±;:::,&-im,..aeig...,..w...44(saavkez.lie,:!;±fiA,...a;.".......q..-t..,;,-A±,±44m,±.-:.4-7, Turn Type Prot Perm Perm [ C' Rkte§,A±OlgillikOMig.Efitagi.±L±Nergiik.W.±EVEIAMICKAP:VI•WW -5147.'± 'Iqi-MW±-ig-Ceig,±±,'Wv,srp.,±-,T.mixv±:±4±±x,/±,,,±75:1:74 ....,,-„Lu....;,±f±w.-,-.a.-±1:AA±,±;(2,± ±,..,:>±•.-±agRA.*,-.....iAit.±-z,.1- m±,,:s...ehk1±,v,2-`,44±1,1(...,At,.%&±±±.±.±,±1-Az9-44,.±411 i.'..0- Permitted Phases 6 6 MI:§rgtf:gqfitelTdE-gar,EtrB2,±?;;f4.±O.'r±;Kggt-tgntj±facJtg±WE.T..41±:M::rgrg.ERE4Nre.Xfg:E±P:A'gar1gt$ -I 1, , Total Split(s) 0.0 26.0 0.0 29.0 55.0 0.0 0.0 0.0 0.0 25.0 25.0 25.0 11 i VitgiiktforafgledatrigilliWIRIP..7.4,M.SAMM64 :ZilBegiN:Pgd119MIEVARTAIRTARK°:41,440-4 Yellow Time(s) 4.0 4.0 4.0 4.0 4.0 4.0 4(0:4116:40)N-WER-;:-. ,.P.::•.',:,,p:.,-sAmtio:,W.,;*,''P;-.":.,:ir-,...Y.,:....-:f',i?,61:'',',Cifr-c'-aItA!g:.:r::'..,g:::,1%::,R',EF.Ilk:,-.:t73:'i2;!t;!EfPRREP"FgfiSgVcv,:florjffal Lead/Lag Lead Lag ; E.6•04.irwolififirieffyi.riRr:-,, ,r,c-,...,2_':.,,,,gwei-6,:*•go,;??,. .,,,m.,4selgr..,:,,,.1rKs: , ..,47gAripzirammarv,p_.,ww.mo i:lf ,,,....r.. ..- m.„.,.......,..,,,, :tr ,-,,.i,4,-,--,,, tr-.,,.":, 2,..,,1:'-1', :',..':'';'.!";',"%. `,,,....L.:.4.6--V.A..C .i%,,X)ig-:4-4.,:1,1`,:'..,,'1',"',,',ii,.C.:'!i',11?',1,,la.-4g,,h16",,,,aZ;`,A-1,2{6.[,:".. aki:r.-,..'We...!gSteii.F,;. .0:- .;;V!..4-2.,::: Act Effct Green(s) 21.0 24.0 50.0 20.0 20.0 Kjf*4bt0_StEESWQAt:lg:Ai26ZMfN;Min.o:kit.0'63'tS'S:EdtgEFRZFZER:ft'MSr4SgeMgrala A i 1. 1 v/c Ratio 0.49 0.51 0.18 0.54 0.43 t, ; Wititak0:04:0015;211b0:4**14:4P:11-4.1.-`4.grgl.NriagirMARINdifititiltailiPargIfigS307012110 Delay 24.6 13.2 2.3 26.7 3.7 •-- ± WgiteMiginggiaggIMUIROMNSAWatieirtf4RfireignEtanyltligija ENfarttEMIPOTORA 1 ± i )Approach Delay _ ± _ 24.6 8.4 14.9 4140104.2±liggigtaggfaViiagiArg±§giVingaN-ttniNfialVgalrileiniagEtiVERIEM. nilattagigla iTitiFiWaiWgZiriiiii4&175m-74,57M7AiraTageTMINMAZIP:7.MTEMEMMTCUMMITC2WAIWAT#74•1 .. ( 0741.. s)15142.40WROAVIRAMICENtraittitteriSMOWASERIttWiagRtattititgrAVI-T4Y Afil . Cycle Length:80 00.44tATIff°721SANTOTON.iiggli4#47640ITOgraNatOffidrifungt-ViERRISSPIDIVE-WAMEZEMMI Natural Cycle:45 ± 4 ± oz-ogavfmokto:msgvoa\i'xmy,sgrmzgqxs.,gggEzusnttt3frosm:4Nzawsztttcvrwi,-,E Li Maximum v/c Ratio:0.54 fraigeakiiitittigt-TIVai.ifitTaling;r:41rgg.A.,±W±tRATX -ibteitoctotto$•.13144-7,0:4,,,yor..A.A.i.-± ,4,k.d.,,,,vA-N.,:.±:,4N,34±‘, ”,,,e .......,..-- ±..,--.±.±....,,,,±‘,...±.....±-4.---... ±.„4.:±±:--,1±-4±±±.±-..;..± ±,.<±±--,-±.,.v:±h±....-±,e:-.±-±,,w,.-±,±±,e..?-a.v..6,--.:±,-..±....±±,,,,.,,..±z,±...., ,±•.±.;-,,:sz,,,,, ±..i.,.4.-.±,,,„nz,,w,I.±,±„...i-g?..4,:.",,,47,1-,- ,,,,,,,4Ad.4,, .4,.r.,..e, ff,;:r,,V„F ui Intersection Capacity Utilization 53.4% ICU Level of Service A Splits and Phases: 3: Lake Washington Blvd&1-405 SB Offramp L c 03 ., f'Z',IriOntigr ;:.1 I i 1- 08 t-j ItS0e.--AWAVOWAti,:',--fl 1 , L-' 1 ! Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 t ± BVL Page 5 HDRENGLVL7-FF51 : ± 'L.3 J 4: NE 44th St & Lake Washington Blvd 2005 Action Barbee Mill Property#1 1 735-001-002 a Timing Plan: PM Peak r. J _-. -\, 1 4-- ` 4\ t P `► 1 4/ Mina. ,,,av,:.r,::.-^xu.;c �y - x±ra',;f;, y_�. «..nA;k'.- '��r,y •.'.t:f'+F'" _?,i°_�:t�1 •t'� r.._ `5:�,'vnC-_:.,p..,.-, ^f:' 9.a '::5•:ifi''''+Fds;�, k'F 5:s: R F °^ •I {``Y'}�_ b.7 .:$ L'.�*.Q4 �: r-t„c 70 :, >, - ,- ,.€�.. r>�Bls. _DEBT,,.',?,,s::EBEI�.,•nVl/(3L`--<<.. �31`��;�'W[�.R,.;��,.,'��1�3L�s�:,:...N�)'rs,.,..N��'.l-�,�•'.,,.,,$ ....�.. Ts�.� ...., i� Lane Configurations ) I 'rS 1' r 4 4, J-- teV,ggN(qg j ;h c: ntso9 �:soo<gr ,sootf :1 0 90PsgM .g" :? 04xgtgP.ZS?9Q 9Q c 90P2N " � ,09 Storage Length(ft) 200 0 0 0 0 0 0 0 r- SxCCelaBSYinE z e f; s [ ��t^: sa fi� csar Svimn � RIN2" RA Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 ':r- ,:r *i,, .,+s r .,�;..;'•c :'S'r<t3`-'a.•`,:D=`>�::rj.' ersu_-,��i��ep;�,tr,-: �:r- -xmc' .,�:y... .•�.:; .cf•,•' v Kit:' :=H'Y ��' s.,� yt�;�„.rrL�''s J. 'tf�w".s ta,. ~'R%`'� i.:zi;i- :�[. rY.. rv"' c1' .}.•,a:i.7 •�",•''t�sxv''.:`>{;- ji Y. ,.a.` '1.'7:5 b<.-2.. -Mi"�.:.,x .„r1.�s3 "�>~ -:9s<- >:y`9': ..�',.:.� $:.>s,�. r�1 �..4 .,,,r 9,:?' S'�,:�,':,::' rrGrB - ��Gtriin•is'�eed� '�., ,�'�. �1`�P:"(,.,l; r .i: ,rir,:;'•i; „�� ..- -.'irr „.,,,.c.,,c�rv,.v,„n_..a.,,.1Y7.'.r._3-a,,...4�,>c:, ..W..Y�:�r,_,r.-_"�,a::Fu:.r.n...n Lane Util. Factor 1.00 1.00F 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 ...,,.-_...,,.,,�.,.,.,� ..., �•..,.....�..s...�,_...,.-,..,_::..n'-..on•R:'...,-,;...:.>�v,.:,,-,,.-�.,.;fr:�,.�,,::a-..;Mz^:.:;f'< ,,,f- rit';.-yn. "".t sFIQ$r':1:+' :rY•YfiK t, •"�,'r'�E"}'y!E`.3 ;.l.,g,g. . .t(,;>s i7h,_•rp•,.., j. f. .4Y.<a',Jrf:f. �t:, ,tra•,c? :"�'.,'L'�nn a ,1. •:F; ^�«.. �ff P.,r�r ;.i, , .Ft_+.,X'�4`r:'t:r..l�'',,A�n ;r.,;rC.,.z;�, r '?`, ,..',.,C_.,,J-,et':, r't'i's '::s-r,:; ':>f ,,J,:'r.•gr,fr<$"_- .$, .1*1'/: 5' vY,s a.-+a•Oir�.6-=1 . g,gg,h:t', ,ij,.uQ:7lJ�t,x,. _,;i�.j�a-„}g:v`rpt: �`�1`"f::. .y Kr,t„ :>s 4 ... w0'.06`��,+.,7 r' +fit ',r3u;., !„ a � �. ,..,ry R..u,.1. ".�,-;::i.,.• ;: s,.r:..S�..,4�,vai�.:xk�:::�••:f..�':,7"b__ �:A-;,-e "t..Er'xl�.,en rtW.w:',�'d:,z;':r,:�3:':v.'>•!:.°n.:..�r.-_,.+1::5�,'t',:.r-«.. " i€:S'✓,.3s:u�t,�"X>.*�. �_�,:r,-a:....,.,.nr.,n.�...:r S'Ls'fe, Flt Protected 0.950 0.950 0.999 0.992 ;s[•.m•'n ::.ns•.^ ..Rt^:," 'r,' -,5: 9,t-.. ,.7= ':7?o-1, ..�,.=,:,:t_ ..,;>'�3 �>r''.r,1a`• -�:W.:r'" <. � r;.t:'. F.. F:krt.,> '"!ti,;Jtzr"' a,•r.:7i ,j 'rr,"a._ .:.i,;", ..`7;' f�., �i.r; r� .f,7:°;iKYt-�:�,mu-,., ^,r��,,'',{,,',,..,, .:� rJi`'r:• ,:C'><.0•. ,0>•.;.v',�1`8�� 1�83., -�:0 �ir7fiQ...,�..{,�. >?:' ,;,,,0 ;�, - Saftl''Flow� 'r'otN=��aM�,:,�.� . ..�`�,��7Q,��x.��M7�sti,._yN�,..��.�::::'�:.��:�f�..�:y�,,..f,..�..�a�:....:�,:,..,�',:�;�;...,��„ate .�..�,,. .,��:,�_,..:�:...,��.�'�_�:�,,:,<.;a•.,�,��,�,,, Flt Permitted N 0.950 0.950 0.999 0.992 _ Scf Q.2WP -�'L _,+aa :. �T ll :�uj 96:`1;'%4 F 0 0 ,1-B fi3 n,, ti,a , t r� 1uf 60y;.> 70: �Qx=� 6fi 5tir i �� . s. : • aSzi::wr.o�:�^Fi3'�;a,W :.a3>vvc..^u,- :,. '„,.. ,'a.uwt.. ,a.,.,.•a,+,,:.�, >., e,,. ...yrxaunsfra,+,,.n.u„ 1 : .f��:�,r ..w.., tc.�� ,a Right Turn on Red Yes Yes Yes Yes _ - ...�.n�drn v-"4�.J"r'; ✓3';.n nrW:'xr.��Y�-;-.s .K�1`- :t:'+'.'K ',',�irY.. 4. ,to:'..pr.:�s`N'r'i2:•�',s.�„F,'� "'+:"�[s:."•^t"rtii-55.. -+ti: .,'" � i PL {, �:;. - `,geq •04- ,.,t, t,._, ;+:" .,r-,a,•,fi (r ATG <� .-, fi=%:;.•' y wt; ':1,'3 ;,- `='r - fi-r7±. eflafv �i.'�tro:sY;✓,;: ,,t,r,Y-,r:,. !,'.i a. .,z.,,..5'�,'�Y,,'ii,..,Z 45ra ' .: „Jr1 J51r ,- _ a}}cli :.lo"- 'pR\��; `�.�<�":,i?•�=• .ar�ri�,.�„�..,. �r`��;: :>�.� � �, '.. �:<<��9��;��;;err,�i•��,�,��tw.~✓...�G� ..r.:.��.�ar��:.M,.•_�, �t�..�� ' �..::k�'`>�,:.:.�>}��i„u<.xJ.au..a�.,.L,K'�,.•a.at'.a'�,.x"k.,i,...:._,rr >n..> ,.sr4�,rr....a.'„s, t�`uq, C, r ' Headway Factor 1.00 1.00 1.00 1.00 1.00 41.00 1.00 1.00 1.00 1.00 1.00 1.00.0 0 Li2kSPA@0511,61J .y:e,xgit< %��LW2 . "O " • + :n,72, i: A 113x52g, : I � P "a3:02k n Link Distance(f) 572 1320 1320 1319 7, iavruJecc ;FiRM _ =i ,hi� iu y+rg _ .„ _3 _ St- r - rgP. >ms7g7 : Jir�ru < E wM Volume(vph) 69' 212 66 69 132 32 12 • 245 170 48 27 208 :'y5:iYF.r:Y.,..Hc+,t^,Y„r., r�v.1.;_�,�tc.,+ _ ,.�,,,�. M(;,�_ a;,`:,t+; ,:�;s•, •a.y�.'-%. 1�fv��;' �S:,Nfi"' �df�. •_„�^F5♦ "';^��.'y Y. 'pay s .r''.5T' �: ��.,,J�im.. ::•tr, ,,{.,„j .'.N, 82 4`,- ,y. a�„y Cpp...t;.o-J,:,';pr�>'di.x. six-p'`t t i.. err' ;3 1�. ';:p' ,e�.. �i.�`UG t,` „�"J g µ:j G'e^,r• '�:.4Y 'I�:-Ji f::..OiOg.e. a 4 . G.5".,,YcPig:�;, T,V,:IU[7J.., .'OO..n,J,O.T4U Y ,vp.g QNZ ,h _ t�eak�o�rFactor:;rJ,��.:xr�m'-�ti�0=88<�..:.�J.�3�,_,.,.xi�8:x�.:.:�.. ,. ... $. _.,,, ,., ,.f,>�_. -, ...�-t�.,,..<>.,,._:.G:..,:.......,_.r„z�;�:u,W,,.�?;..:�.�,f_a., ,�:,.�. Adj. Flow(vph) 78 241 75 84 161 39 14 278 193 59 33 254 _,...... .....:..._.,-n,-,r_,_...,,,.: ,, ,,.,,,,..,�,v tt-•.,,.,,.,svr,r,:.- v r 'Fr4;:.: «ra'.n',•M1•' „fi•. �:,:F' ,Ar ,.; - '-h,n rta:i�i x I�r.?t+'n"„s. �.i�v'i,7+.:. �,�.^M,<r;;..- a y r >,12. ::-J.[� �:.r, jh", v. .h',.wi", ,_4.: „ffr;., .,•,n,,,aJ.-�i. �.. <�� s:�=' .�: .'��84,. 1�' "39,,F,,.,�,r .�":0::,.-',"+�`n48. ,,t,0is;. ,t.346�tr,..>•.,...0 _ Lane��Icbwpri;Flovd:(•uph),,._.,,,,.'• 7g:;w 31�6•::,� p..,��. ��c> ..,,-z.,....e. .� �_u,�,...,, ..�...�, .,:. _.._».:..,..-,...e.:,r" �':�r. .,.:�.,-,... ...,,._,.''c.:'��. �,t.,.>�.. ?"?��'�4 r:'y,":,-:.-.,r,.,.)»:. ::.?i r:,•, :.:a.:z-,2„ .,..r,,,... -..,:,fir � ,.3... ,t rn,r. Turn Type Prot Prot - pm+ov Split Split - .P. ,•Xr,` ':V'." r:�,, L�� vsy,L:P�=;il:',!,4_"�-a^Nr" i2:.: ::E::�F�'«„•!s- r.c w. ,�'� ,?,-tr.,J..,y.7'. ;cy'.ccf <','�3• •:tri „-: •( "; ..__ f:r.:.:,lG :J:i:.,.,n:�.:♦ .:�:�,':` �:'f-i: '•? ;ss• .::'.^IG... ::4'f"., ;'.'�'y,�:„f„ 1i'i..;y S .r;J;,` n�.V,: r4 ,'. 4?. ..t:?J �-rr: ,,...,:p.:.g:;,�_..EIS::,f��zaL'tr.,u.��:;.<zE:,.r u...-�..,,,,..('.,..t,.ct.4C''•7 '' Proie�.ted��a es��.;;:a',�°°m,�: s:�;'t; 4.xro"�:: _ _,- ,:>, „ v:., . ., . Permitted Phases 8^ . - Ml n munS ds yaF ;r. : ,_.� 11:0. ..':'10:0 5� `485 ?�8� a ".-�:12r tg25�� ._ 1 -5- _ �_�� Total Split(s) 11.0 20.0 0.0 11.0 20.0 19.0 30.0 30.0 0.0 19.0 19.0 0.0 • , !: �v},• O, O� :,.0,` O.. O O ,,O.,;�-_.. ,.O,,>u,S TotahS Ili} ) ,'Y c �'! ;1.4,,,/0 :.`'25>/Oy "s. ;0%;;'.•1,4/o>r:r: 25 ',;,,: 24 6,�(.:38% ,...38/0- `.......................................................... Yellow Time(s) 4.0 4 0 4 0 4 0 4 0 4.0 4.0 4.0 4:0 1� ;T e,s' ..,,f;, - �,1,Or 0`;. :,; < �,1.._r- .,�,... .,.., ,.,. -1-,-,... t{,�_:�:�.�..-�r'e:;-iK�r '� aragfr.._�,:;:giik.t Lead/Lag Lag Lead Lag Lead 1 a zr-S 'vl 1' "'J'' lftil.'�� • '-t 4`14,r ��',. l-r.F.S 'J�_ .:O' I �e�.•..Y':r ''G.4G� . .c._ ,.., h.•:2::`::,':"+.;s i.:�Sr,i Lead'yLag„ Bt n? r~ .. :�„ `=.::y:- v + Act Effct Green(s) 6.0 15.0 6.0 15.0 34.0 25.0 14.0 • a. N4 r.S b..r ii /j�'�a`ivat•'�d°��`.G�Ra io,', �,;��a. 00 .1 >,,;. :,.`>� ..>.,,. ��?,_c!,.,:.�....:-.• ;.�-:�.,:,.:.:�:�.:::>:�-,._.�.,,�w:nef,�:.,..,,;>��:h.,K...,.,;� vA: ,, v/c Ratio 0.59 0.90 w 0.63 0.46 0.06 0.84 0.83 - ,',7':..,- ^t-,^.::T '.,,ti.: r:C-e •:'1''�„ f,y1,J., i,:-d+ •e'... u t.1,-,,. ,�-$:-v •aj3rN �x l:'`t' ,.:`,�" �r-f''�;,`"J-'=" '.tFif�'� -t'�3..,-_ ice,' ><W>,N:'pi`c+•: _•F• ysla__ ,.3^ ,A,�`:;, si.�', ,'�fr' /.6•��`�-<:r, �:9: `5==,,.�t,:-;d0.�2 .,:,�,�->-::s:'r'>'23:2.- �r:� �;:�,.. :',v ,�.., ��rj �Ifo�, rAela` '1,,:n:�,a,, :35.8- ,.3.' O�i'i:Tc.,� �.�r«-s'135' .�,>,:20 ,� `�,>: �.,�,�;t�5�c_��..>,,,..r,.r,rr.��;�;:..._ .,.:�•T„�..y��,.mow•„�..-.r';t�,,;W�d :`.C',,,.4,.- ...s,�,<•,.,.,_r.0 .. .,.w ,r.rtr.�„., �,.11.:.,�::, -. -,.r�'M;-si��<:%�:�,,,-.. 1 ' Delay 34.2 36.8 46.4 29.5 4.9 29.9 _ 27.0 - 'Ji'r' �'rrc:.. :st;", ;,u>7 a;:+i'„s' -+v,-^':a[k'J.x'"r •',iF,:r::f ;•,^r:�>'r-v�er•.:Yr'7"-:-ri: t;t .{, t„1, .�Ys.S, //++ .. ;� .P.,._-,Fag;:>.,.% ::"k�:...., ApproachRDelay 36.3 . 31.1 29.9 27.0 A''oachOSR ' � n �,� �i" _414F - Wu A ' i T;S_T, r Y ^ yw:3 r {V rM th nt8$8fprt u? 1.,�b,a - Aess> 3 nT x- h A : ,1 " . M ; Zx, ;fi $ `..J 8^$na-T 2 Y�k,,r� vMe: Ot�@fca i Ofi7? . �" i„ ir w"�i% iy':� ^N=E CFauE v N , Cycle Length:80 ..__..s-. ..,,,.v.,,-,.... ..�.,_.,. �E?x:-f,'se-,.,...tsiw:.��..,t•,... �,rr,":-�,;,..'.,>•_a,_•w;Ji',,..�:�. r.PYi: i!Y,". ;,•�Y .<�R"L`..,y.Yn, �4a)„ -^a'.:.!:,GV X`•r- -v_�p_" .�;.c,,x';l.S' .« O. , 0 ., - �fl�r:',.-:t .a; ,,'n''Z,# „t .,_- "=`�x:;t3 ''1"rTr�,s $'t.s':� :� µx n. dH r enr'S mac.r`-=t =<, .,;1�'g't?,ar.: ;:.'"�.ie=:i"?.i�.�f". �. +". - �t::u��r'" 'i•.. .. Ofi(se��4f(S/oJ.�,Referertc�,d,�oxptiase;�:N�TL, ta�.t�ofiG e.,,._., :y.<��• v,. , �_�. � ��' � �'��.. Natural Cycle:75 °,x•r ;,:"..�t,•�rf-:.'. •y�. ,;.;r.:;:';:,��F� �.rr'E, •K:A�•r.-{.i3�•.a'x.7"+a.r^,..:;zi?.:' ia' J:~.": .:rr,. .,;,r,L,. - ,,,,,„ s.'elR;. •-�:r, nnr i�, ."'�>,,:1� :�,�,, ,..i{.';'t ,t".r:' `,.�, ::,ti' ''kis YQ:., ,sk •"r4 "e!. i +t':J ,rf G» :L�'- y` :l ,.y:- ";;"ru, ?,:j,:: e•r e.,. ':i:c .,f:` :�'f,. ':�'ryr �..{, fi:.. •;-'i ro+:,!, :r `;ai,. a.e p<?ey;, ':v k`x': .�,. 5 r •.`✓n. �a.:r. t `. :•,,:Y .,:irol��• `�=�"re m'dd ��> .,,,r'�� r.,..,�,.s ,L,- - =�`-�_. . y�a': ..�� .��`�: G>~.-_,_�:�,..s��:_.,.�.��..�._�:�,__�;f';,:_�:�-...�;:;�.�r� �o t..:r='�YP_..:,`. „X!. ..��.,.. ,_ . �:`�'.s..,..,.>,:-,_,. :sir-'y_>_..u,..,.��•.� _ >%�.,..�:�^'._ : � � . ,o . Maximum v/c Ratio:0.90 .-:,_- yr:•:'-:�'.sw's;...,_,r;�,.:;: ,.:... ,.q„w ,,-n5x-.s,+'•:•'v,,'. ,,,,�,.�;.., "-x;,.f'S+" _ XtL#;.0 r+ti:", ::5%+F�. M:t•: ..v;- :q. i{t.:,„,_ .it=:: 7,>{� ^- "<.Ycx„J :v,. ..5`�5. ',:,t,At-..r,F/3J.nci`:.:'Yrb;'•"."s: .5�".. .,C "tr` -Y ", . `> ,Y�=:r,. 1 ;',I►0• e7se't10,=L1),$, S'', E uf.a.»,'�,r:,,,"....p Ji.J;+, ;z, 1;' r,R'°?„ :g,. .'M,• , l''riersecora, gna(DelaY,<3ir ka:r .:.;: :,.v ., ._:,n., �.„_w.:� , ;,.._ =a..rr;... ,,a'__k` ,:..JAY «:„ Intersection Capacity Utilization 86.4% ICU Level of Service D a Splits and Phases: 4: NE 44th St&Lake Washington Blvd Y 02 $ 06 -* el 03 . 4i.;,s ;. r..a. 4± '- 08 07 217� �i "WO 1144.<_ I'' - ♦] ':,'1 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 6 HDRENGLVL7-FF51 � Ei Lake Washington Blvd & P O �OUGAoUon ' ' Barbee Mill Property#1173S'OU1-OO2 Timing Plan: PM Peak 'A� LSOAVRIO ~ 7e Lan on j at o -!71.9, � .. S"d' ' o~ ` ON MAY FM | Link Speed(mph) 25 25 25 [�_| '`~`~'Time WOO � U~ / Control � \ ' _ - -� ` ( LP' K�U| Pmpo on_P��oy0 Gyoohm5Repo� oanuuou ��'-------- ` - - � BVL Page HDRENGLV[7-FF51 � | , ^= 5: Lake Washington Blvd & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak t 4-- `. d ^.sYS:, .Yt.S•ew n•,T, +'i^:,L+rs,tepa:w.. _yz',•{:U �e,�,«, ..f,yt«q:R.7 nvYtr��!!5ir .>:: .Wda,4,.Y u':;,.^}q:.R"'1;1:er,;`ti'i't1.".'}•.'^'iA:i.' e:g1� "'r i:;i�;,.?=.l eY'sny �,•M•:'-,i (�/�/��(��{ '�1, ';mf4ra., p''�... f:��/ !.�''� ;��j�/''F.r�••� :+"r.: �+ `")�Pa S.!: 'Y:.,;, w:P,:":: .d,;�p �y«'_�,�J4. j ti.4V: r.Ci!`.Sr'Yr20.�E:��r'a�`t'"�-:1-.1t'�y�{tF`.:i'�,,}�{�'i�.Nr�Y,,...,.':;F�BL•ST�s.�.t,:, y�C7{',';; IY,V pil� .;•�,4•Qfl.;�k{�t;.�i,�pp",t.'4'Y� 4��:"')'Y).,r t,:Y 7+1,,:e� V'-vr..:4"nil?,.: €!i�.`*:i.4.4'�'.,:�t, J x- ;*'a� va, FY.ssY.. .ice. �P��,•..'-.'.,�. 3::3.. r•:a:>,•1r-�.,`S.xa=:..,. 'c:'r i, .tv:F7;�,i. .r--.�., Lane Configurations I x:^.<c•x - �;�< -.�=r - - "•::r :.F?«:as-'�" 'rx^::c:i-','`.ay •-n`�^^ar.'ic%�:h+ 'm.3's. ��.�.;,:.,,. '.:xz^::ss=T;rF.ti ^-:a'. 1,n,,-;'"" i".�.: .,d:, - `>a'.r Yi',<iti?, t t .kir .r}, d??r'. .�tN, .f}�g,�.-nv ._6'a•�`u""',:}:��`��—J l•Si °:7 'd-^'U'+(�" 1� f.rY n,� :C,,a,ff �v'fZ�.. ,J ..}.n;.Y{(..�iS`)Yn. ..'C'-c.::J*Y.... .�,I.R.,]^. .-T".rr`<' �,N`G.,•t ; 'r;trcy� .fi 'M:,t',-? •.-:-. ;�;~0. r.=.$to•-I,t u#�e:,*A., ,§101,'tr.."•,. :�S..Cy« .,�x•.G`.`.or *,,r3:c-r{Y,`X,r'r, .'.7�•nt.,t, va`'J«.',�5fn•.,va_, ,p,. ,.� �R9�?��O�nt,��•��:ar�.> ��' ;��,.,. ��;�.r �,�P.t�r�� ,;�, .. �;�;,,.. .:i?,., :;3w��.,<�:�x:,�:�•° -�,..G, ,,, �. � , � t::.�:.,,.�� '�z:r.3^..y,G ^u�,4:�,'i,w 1 .G�?f^. ,nW�.a, is.u, .4.a �x..:"s.�.,>,.•� Ir,ist....{n.::x:,...,r, ax.,,,i.i�.=.s1.c.a:.•:��._,.•...c„�r Volume_(veh/h) 1 162 310 8 4 1.4 � P ,,.zr -.--xr.: - x, ,•-r_.y...ayr..,gs•,f•_..��. r'•�;>.c'v1...r..,;.,a,:1:S'zX*._.,—_r-,.am.:-, ...,.,.�.-^.sa"T 'wt%:.X"�=i'^''S'h-:r7"�',::v:.w,:r,."•<'rf,-3"}= "`c•S»�'X+.;.-.,,�='T"`.,"�•,.=lz"n'-•••:rr 7r S_;:Fn,.x -'na+`kt- f.• :Mg` •,k .t.:" '�;:.;i al �f?r..,.-v;; fi',.s x+aw: •:::7¢;.;,�,: ._-o-F'�`E,S;'i•r<• k;,' ,., ...>F+JP �aleit�soi7';? y�to�>. �.,�:•�,�fy,.0:9�=.,, <�:�y,2r�+�,.,,.0�92-1. .�0.�2�=•��:-;'�Q92.,t,=�:�Q92..�� T..,'�J,:.��,,.�a.y �..,.._.�•-,�-�•t,=�:: ��..• =iw`, �.� , � t�" .,��'�`7:� y,ar.'.�`.rnik,:,...,y.:.,�,.,.,�..<. ,.,J:�rR,:.x�Jtz:,�. :,2..._„tt.tr.,:x�..,. .ter.{._�,-". ,...:.",..>.. _r.�..8:.';..._Lw.,>,<..z.,..-r:Jr:�.•+,..,•,....._....Vn:...s.'S.»�,.3.r»...._£.c�'-�.;:t:..,� :._..�:�rn+:^nfl Hourly flow rate(veh/h) 1µ 176 337 9 �4 �1 J Tt' •5:'" ,<,ai^;R'St 5.x •a 'r. °v^.+€'�,'§7:?g"'mC xg,:3 'r,zn:..;:;K';yC: 4 .n^;"-.,to as"Ytriri s ;-�k;c;,, ':i•['a.,........�+� ,,;�,a;.,,,�,��<m^ �.�,-;• .,rzs'Sj. :7. ._r; a•. n �'rs, .;.t;:r��, a+., •tit= {4u.,, "`;.',;. ,c.(T'E as;"w-pn ,c»?,.:ffc,,=,`1=•4Y:2.�. `rlt :�:::". .,;•,.. ...r•.; 'r•' r i ..'t F711.�+IOIltr4.1:2i1'1�@:,i#±�.'}.�"z�„tr.��:�.�.:=:5:';..,mE3�:��r'.`.r�U,�„2: •.7.0'r,"bt`�,;:',4�,,;r..:;... ... .�_ .:'�'.:f'..'`i(..o.t-,:..Sr:<.-:Y4.:L'v�....+"�-.t.��u'z.�'t£.;�k"%�i�.,*. ,. :1,A;��a. - n.�,.r.ri,r,%{�a'-i�' .a. Volume Total(vph) 177 346 5 nr• •a� - .:,zran •„:za ya. vvyn c°:x r-r s;o;,`•;**: ^1Yr s:ror_, xs r' ^*sno, cater r,.Sn, •-<•aotr-r f-- =z•v yi',,;''a:7 i<=;c.:•, •,.t,,.,'sx":-c7?"C � :I"� .S`,.�;;, :.�:: ;'cys;".rL". ":,e, 3? ��`�>'`,3.}•�"�"° �-P^;� '.'nr., "2 {'�` riS2 <;.-i�a•(�:,�•:., q,, � '$i��r'a:3r.v�`�1e.,r.�"k"��F-. r n.,4;ri-" ••f ."-ie^'zn-'• s>cf,;i„ !.4 ,r.,�� i�'ta,; r+i,,o-.a:.,tx:-C'sy�`+:` •uf+.,}' =?r.�f•','a.<�ti,±,„"{A:,t; 4. / S,Ert;'rr ^; �•rr 4IE 9i` alitµ,:,, z,rt,t.s�, ri.;t- ti.,•.,s,'.i , •(' ,ni w �%A1u�� .�� ,��Y: �;i��`ai.��; ��Q1?_�,"�4� dd u�; �� ::4t,,h' ,,� �,.,,y> � r• �"�"�>"' :r> ,n "1: nr.'�,E_•:s:b7;,.n,»;::.�.>�r,..k7,rv�,:%sS:f_ zi£'❑ �171.'�,tv�.t.r:r/ G.^:'r:.v� .�..ni..Jseru..M.c...'....r.,.m.nra�:�v.�:w,:.l�"'.�,!.1.tv_>d...x'�.,>xflt .i:�iwtF:i..n'��.,,.>�eti.x+:e..x,..i��s4V1'�� Volume Right(vph) __0 9 1 / .•c-r- �r.;,w..yn,� / .,1� .`T>' ,t ',rs' `':t;.;�' '�3.t.,s,u'^.i,Aif-.`.;•:7.+�-`t4"'X'�I.".` •2rpr^k-.. r:.?" �•t. z!,".�.?;-q:tx ;> �;;.ryr-;:c "T•�. ..>F.v F•�„Y' ri�,vc �.'x`ff�'`x: .'rr^o`,'yl�t�rlr'ir.,rt•'y1:. '71.�.`.:f. ,S:u :.fl >�'x:' :. :. "'T�-: �`(' :...J '=a2 ;;;f,y �".� nn- �j� zcz.G�. A nA 7" e` .af nr::.> .f•r. :."a. n'::'= -.f.',` f.�:. <<:te.:?.�t<..:a;' �i�5z7R37.>.,=. t.:,4:rifxr,.;}t: :. '•a4•'•aS`. :�a�-� .�,r`'IF�`�'�,+rt .,u.`.u`�•��r£!lJhh;'-,I,.��Vy,`��¢^��"-•©""1• rr�f=.,, a,,�P ibL":Y.S,y"x�r f7... �'et, ;27?-in`',?.,3}Xq_ �.., :��9.8:ZtnC n::3a'g'is#.!�}4;^w.•i✓.�.;fiS'"v^-'.v�'. ��.:.}��s1lc::xralGrSs��',�,..�.uJ::r.�,.,titau:.�,xs.::L-x...>.:f:.",a.�,,. ,:�.rr. w"t-�k:�;:<cr.«_.:;c`.iS�.u,..,,.�..,y,.dic,.�.,^.:`T .^.,..cr-.�.�t_.,nru..K.,.e<.a ,•ac�..,,��. --. Departure Headway(s) 4.3 4.1 5.0 ,•t,e:�.•...a+v.,cwc,w•h,:,, .....�.,,..,.r.:�s-x ,_raero* ,;;s;„w "•elf..l�E::+7ri, ,^Z';,n s•:>>^':t•,':: ;:'^`ay°a':,r'7,; '�"'tyie<!i,''-�';s''-�3�..^r . •{t;?,�yh;,�,r�-",y;j'c F'::. '. PN'i' ,F �'`.�,4 k:' �F'� ^',`.� .:.�o�a:Y �r:��=1 'l .4r �' "+•�.-�;:Y:,_-.•}`�'i:R,.:•'r+;�G wF,... .c a -y` c„":`=a..n, ryfr ,{;." .'7 `':,ta,.,;":* 'S b p� 0b°<:t= x.: r;i n.0:21:.�:�0'3`Q,:L,a�D )1 �'k,{., i"f,:i: ,.tii. �3y.XN .k•.+`Y•: >visc�... T., M1ir..Y ..�K � •Sr.;; ..�=�r;..:.�y J �i:"i;;:..ar:.;"':. ,i3„ •i�aEa•>k .,Ina. .r,F.';s:.' .. ...i.lr•±w=S�+.,'„�..L;.:.-_._.>e.ha.:�r...n.:,fP.-.w.AF..,Ssu:.��:>L:.:.�"x-h•a�..�.i,Jr.�a (�. ...t-...;'��*"_::��:v Capacity(veh/h) 830 861 652 .,s.,,l, ..,r-,--• -„+aa `•r•.ir.-»r., "a'ir•...,.c.,, l vr•�•. s^S'!':,rrr€;T,,:r tn;c „•:n,y,7g}:*,v� nr,:s,�74: .(',•ttr�-• �•9rr."-"_:,.r7,:zr�c^i„+�;'�cc:.X,.,�tr,. .w.7„" P`�•'*'r3•r.a - :f"7+a'�a>..."" ,.%�' ". :.w r.,t., ;d7,^t```,' •:':�1'��i:£.'i�,rJr.sr`ir3rc.. .::u, ,-,ss7^ z4.;+�•: ..:�'33:.,.' -cjst,P.t r Fd ..}•,,1..t, pp :'h'a:t., O^^77 cz*`=, . '.,, ,r.,i� .r r ..3, x.=...t(sr• ".*4S•-.�; ...brt','rS'E 'n5'i;'1:,,;•z}i,".e. r4 zx .�€�ki0.`t;.1:a_,.;i<.u..O:�r' �t<9:7.:ti,.,y{;8�':l�'t, Ltw. Gi= �.:i;c,',r,y: >aYi .. X.•��.2.,„c,.=�`f� =.Hf ,..zp• �.' .�c.. Gonfr�ol'Rela�:^ �w �' �lr�. .,,. > �::; . .....��. �:�a. ,..-.-....,� ,r :�._„�..,� .:s x `i.::�:..:.,;,.. >.�:'sr..�.. .,.,,r�„'uf'.!_�_.+„�..+.�.:1:�:..a..e.'r.J ::.'�9•'+,:bFa-..>4iw..nr _.r,. ,?,,,.#:);'.� ..,�, .t'.`r1.$'6,K..*rl.acc�.:sS,.,... ..�if..ai�:!n.:;r,.3•,c,t.�•:c^+•�:�X; Approach Delay(s) 8.4 9.7 8.1 N€::, "'I;G"-y- - ^.•t+rRS= >a"d`' :'.17= :.R': u:l:""S"^" `:i"cEaz::tiF,. f',':" i'A�'„';::1',,•,•;sl•°i'� ^4."r,�r.: ��',C=':t---^'4',�^v atiJn'..;-•s,.; 7n nv_:,,- °:Gi^c'r .+�i,. _ ,:,f:r, ,.;.I�r':<; Y.r7•"-;'t;=.'i:..t. .t..'rx`c. .4-a °`"5 T. {:"! ',n, :,,�„ .�I:j'�-1�:i'*"t. r.,,°.fiat, "'f'•.,.`_�i*; :;:,^na >r":ifi• 6-� _.ti., .r,... }' !tr.'$ `" to igic,.'t• ,. gn..•Q.+r,t,., •.-i,:rr; >'::z;i'i�' .. ...L;1;;;<:"•u,).:.+.,,A Yt,Pk:FtI J';;P: t#r'r'3 r :;h i,: .;r +f>!, A' r'�ac. `�" ,�";� r',� .,A:;y�;;;. �✓s :�,� r, ±;::-; �, .a,, t. ,.:.� t t.�•.,;�`,tclicrr:,n_,.'''r'"`� �'� .air"' .ScE�..,.._:,,:"::3�,. v.P„1�<.�..,�..��.��-�4��'err:�:�.,cr,;:�t�r;�..r::��r•r .. ,.r:;..R�.t.,r��: �.�'',h'�. ;.�.:ta:,;�=.��.z_ �.M�::a�•.,,..,r =;�.">,.r.��,=.;4�5..�:, .�<-...ate;,`�...e_.._t�,,:- � rz,:,r. :%.,n-t� 'w'":r•-.,�r..n}S:-">:,;:t�u ,-'L�d:'",�/ "m �•r.•"�'w,§^.r,.^,m •.e:xr:.iFY, �-a.:,.t.x.•,v,< nrA,.•w -:�•--T•'x, ti,�,.r nt ..2t1r•"" r.��: y��s• �t�p �•��k"•C '�w.:.�:J. •"gym b.�•z�`iFM: ,;•�kJ'•,, ,x3f•>';4e..�X i ':,yiY a 3•;•.�"frY'6� �`�'=�r;S:"•:,t•g.,a°'e �tr ,a�,,r;., ,,,�,�' z'ri:-:,a ,1I�1.�i' ��.�t7U�m�j,°�a� 2'.'.#'F',�:a'�.rr>ti,±e*��.^ � ,M .vf•.;?v:?='.'v4>x::r,[;€...p.:5�;:,k:ri:.rv..,M.•v;��,,va:�rx,+..±`•��r•",�<Is M.'�-.:G4.n•,.:.��>�;trr.. is"� 15?:31`i,:s��+'..•ek�!c. ..t-,: � v^-Yr g., h w'( -.-� ,�;,: ..,5• ..�:5+' .tip .^•tz'n'-ih^e+ i;y^� fi ems,; •-n:YN.. .:=2 +.X`^'"' 't- _ �;.j:..:m - :¢*L:::.-- i'i,`:%'-.a..,. a��a"eY' d"iR >>s-^ .,, :,.2k;; .Sa iin.- .a':':i i.,r-. .:trtr.:rr;~`.Y:fi t .Se. .h_,. .�,-.1..,.�- r�;:.•piste ii't� a..,t„ - - �'!':e�`..`7iv,:��t'.v':�',-?.;� -e�:�:,Z�{::rim:..;,�?a=,`ct.4i3�sr�,`s..�_.:zz:�.Uytrv.;,s �`._.._Y,.v.-�,.:,:s`:'!.'`:�.....,.�'�Yw.r=uy;�?....e:.:�}t;sat.:ar'�r;3:;,a.s,.:s>r,.,,.,•i.r.-,....._.,�,_....,,..:esx.�,.J..�..:m�...,s_r., ( HCM Level of Service A _ rf ,.yy=., ,.2,. 'rY.: +�a:a ,.es 5--- •:�'r ,r,�r, �.�.�'•9'�ytt�* •f:•'.r.7+_ :t. rr:�,dyM lt'•'t5.`��4 NV o wt ate '>z�� ,�" at•. h�.... ,:' f,t�,t ti- BIVIC2`�� ,.�*..- .�,:.. ilia. >`�:.•,w.r •�. ci ;"C1ti iYafo`r'i=<-,� ,295�/o..r.....•..�;P.FI:"lJ�:�evel.;of.'S. w��z::�>�.,, A�...,:�.": ,:�_.�:r. ��-w:€E'�,ti �nt�r�"ectigr'fiaPa.v.�!:�.�.•��.._�...,.,.�., .,<s,•:.•>',,,t;<;��:r.............�.........� :...�...s.,.,_>.:.�.,.w..�,.��...._r=��=:�....__.r�w..._��.>.,-•_�.....n>�...:,��,..."� _ , �-.z, ,m. y r- • rTh I t Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 8 HDRENGLVL7-FF51 APPENDIX B-EXISTING DAILY TRAFFIC COUNTS r_ 4 i • r- � l i March 28, 2002 23 Barbee Mill Property Traffic Impact Analysis r i Traffic Data Gathering 11410- 13th Street SE __ Lake Stevens,WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. 02-153-01A r. City: : Renton,WA 07/09/02 L. Counter: : 502 Interval Tuesday Begin AM -COMB PM-COMB 12:00 0 0 6 25 r- 12:15 0 10 12:30 0 8 ( , 12:45 0 1 1:00 0 0 10 33 1:15 0 6 ' 1:30 0 9 1 ' 1:45 0 8 - 2:00 0 0 3 13 2:15 0 1 2:30 0 8 2:45 0 1 _ - 3:00 0 0 I 11 3:15 0 5 3:30 0 4 3:45 0 1 4:00 0 2 5 26 4:15 2 18 4:30 0 1 ' 4:45 0 2 5:00 3 13 0 3 5:15 5 2 5:30 5 I r- 5:45 0 0 i 6:00 0 5 0 0 r._ 6:15 0 0 6:30 1 0 1 i-- 6:45 4 0 7:00 0 9 0 0 7:15 7 0 7:30 2 0 7:45 0 0 FT 8:00 4 14 0 2 8:15 I 2 8:30 5 0 8:45 4 0 -- 9:00 2 13 0 0 ' 9:15 1 0 . 9:30 6 0 9:45 4 0 10:00 4 27 0 0 10:15 6 0 1 10:30 9 0 10:45 8 0 11:00 • I 13 0 0 11:15 5 - 0 11:30 1 0 -_ 11:45 6 0 Total 96 113 __ Peak Hou 10:00 . 1:00 • Volume 27 33 l Facto 0.75 0.83 DayTotal 209 r Data File: 0215301 A Page: 1 Traffic Data Gathering 11410- 13th Street SE - Lake Stevens,WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. 02-153-01A City: : Renton, WA 07/10/02 Counter: : 502 r' Interval Wednesday ,' Begin AM -COMB PM-COMB 12:00 0 0 6 15 12:15 0 2 i , 12:30 0 4 12:45 0 3 • 1:00 0 0 2 17 1:15 0 0 +` 1:30 0 5 1:45 0 10 -- 2:00 0 0 7 11 2:15 0 3 -- 2:30 0 1 2:45 0 0 3:00 0 0 10 31 3:15 0 14 - 3:30 0 2 3:45 0 5 4:00 1 2 4 21 4:15 1 13 . 4:30 0 2 - 4:45 0 2 5:00 2 11 4 6 • - 5:15 6 2 5:30 3 0 r-- 5:45 0 0 , 6:00 0 5 0 0 6:15 0 . 0 6:30 2 0 6:45 3 0 ' H + 7:00 0 17 0 0 7:15 4 • 0 7:30 5 0 7:45 8 0 • 8:00 1 7 0 2 8:15 2 0 - 8:30 2 0 8:45 2 2 — 9:00 0 2 0 0 I 9:15 0 0 • --' 9:30 1 0 • 9:45 1 0 -- 10:00 2 9 0 0 ' 10:15 2 0 10:30 4 0 10:45 1 0 11:00 7 40 0 0 1 11:15 14 0 11:30 8 0 11:45 11 0 Total 93 103 r i • Peak Hou 11:00 3:00 Volume 40 31 Facto 0.71 0.55 DayTotal 196 1 Data File: 0215301 A Page: 2 r Traffic Data Gathering 1 11410- 13th Street SE 1- Lake Stevens, WA 98258 Location: : Barbee,Mill Dvwy off Lk WA By. 02-153-0L' i City: : Renton, WA 07/11/02 -- Counter: : 502 Interval Thursday Begin AM -COMB PM-COMB 12;00 0 0 7 - - - 21 - 12:15 0 2 12:30 0 11 _ ' 12:45 0 I 1:00 0 0 I 4 _ 1:15 0 3 ' 1:30 0 0 t-_- 1:45 0 0 2:00 0 0 0 16 2:15 0 6 2:30 0 2 2:45 0 8 `- 3:00 0 0 3 6 3:15 0 0 j-- 3:30 0 I 3:45 0 2 I\ _' 4:00 0 . 0 1 17 4:15 0 11 4:30 0 2 4:45 0 3 5:00 1 5 2 2 5:15 0 0 5:30 1 0 r 5:45 3 0 , I , 6:00 0 13 1 2 - 6:15 4 0 6:30 4 1 6:45 5 0 7:00 7 33 1 3 _ 7:15 11 2 7:30 10 0 7:45 5 0 ' 8:00 7 19 0 0 l 8:15 4 0 8:30 1 0 8:45 7 0 9:00 7 23 0 0 9:15 6 0 '— 9:30 ' 2 0 • 9:45 8 .. 0 -_. 10:00 17 31 0 0 ' 10:15 3 0 �_ 10:30 3 0 10:45 8 0 11:00 1 14 0 0 ' 11:15 4 0 • 11:30 2 0 11:45 7 0 Total 138 71 Peak Hou 6:45 .12:00 r Volume 33 21 Facto 0.75 0.48 DayTotal 209 ' Data File: 0215301A Page: 3 Traffic Data Gathering 11410- 13th Street SE t_` Lake Stevens, WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. 02-153-0IA r-- City: : Renton,WA 07/12/02 Counter: : 502 Interval Friday ' Begin AM -COMB PM -COMB 12:00 0 0 6 28 - 12:15 0 9 12:30 0 6 12:45 0 7 1:00 0 0 5 9 1:15 0 1 1:30 0 2 1:45 0 I -- 2:00 0 0 0 11 2:15 0 2 2.30 0 3 ! 2:45 0 6 �_ 3.00 0 0 0 4 3:15 0 1 f- , 3:30 0 2 3:45 0 1 4:00 0 0 1 3 4:15 0 1 4:30 0 0 4:45 0 I 5:00 0 1 0 4 5:15 0 2 5:30 0 1 --, 5:45 I 1 6:00 0 1 0 0 6:15 1 • 0 6:30 0 0 -- 6:45 0 0 7:00 0 4 1 2 __ 7:15 2 0 7:30 0 7:45 2 0 8:00 6 16 0 0 8:15 3 0 8:30 6 0 8:45 1 0 - 9:00 0 1 0 1 9:15 I 0 __' 9:30 0 0 9:45 0 1 -- 10:00 5 12 2 2 10:15 0 0 _; 10:30 2 0 10:45 5 0 11:00 4 10 0 0 11:15 4 0 ' 11:30 2 0 -- 11:45 0 0 — - — — r -. Total 45 64 _ Peak Hou 7:45 .12:00 • Volume 17 28 . ' Facto 0.71 0.78 DayTotal 109 . Data File: 0215301A Page: 4 Traffic Data Gathering ', ' 11410- 13th Street SE i.,_' Lake Stevens. WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. '02-153-01 A City: : Renton.WA 07/13/02 Counter: : 502 ' Interval • Saturday __' Begin AM -COMB PM-COMB 12:00 0 0 1 3 12:15 0 I , 12:30 0 0 j 12:45 0 I 1:00 0 0 2 3 1:15 0 0 1:30 0 I 1.45 0 0 i '- 2:00 0 0 0 2 2:15 0 0 2:30 0 2 2:45 0 0 3:00 • 0 0 0 0 3:15 0 0 ,- 3:30 0 0 3:45 0 0 ' 4:00 0 0 0 1 • 4:15 0 0 4:30 0 0 4:45 0 I 5:00 0 0 0 1 - 5:15 0 0 5:30 0 1 5:45 0 0 6:00 0 0 0 0 6:15 0 - 0 6:30 0 0 6:45 0 0 ' 7:00 0 0 0 0 • 7:15 0 0 7:30 0 0 _ 7:45 0 0 8:00 0 0 0 0 ' ' 8:15 0 0 8:30 0 0 8:45 0 0 9:00 1 . 2 0 1 9:15 I 0 • 9:30 0 0 9:45 0 .. 1 --- 10:00 0 1 0 0 10:15 0 0 10:30 1 0 10:45 0 0 11:00 3 3 0 0 11:15 0 0 11:30 0 0 -_ 11:45 0 0 Total 6 11 _' Peak Hou 10:15 .12:15 Volume 4 4 Facto 0.33 0.5 DayTotal 17 - Data File: 0215301A Page: 5 Traffic Data Gathering 11410- 13th Street SE Lake Stevens, WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. 02-153-01A City: : Renton,WA 07114/02 - Counter: : 502 Interval Sunday _ Begin AM -COMB PM -COMB 12:00 0 0 3 9 12:15 0 3 ' 12:30 0 2 12:45 0 1 1:00 0 0 0 2 1:15 0 0 1:30 0 0 i , 1:45 0 2 2:00 0 0 0 0 2:15 0 0 j 2:30 0 0 2:45 0 0 -- 3:00 0 0 (l 0 3:15 0 0 3:30 0 0 3:45 0 0 4:00 0 0 0 1 4:15 0 0 4:30 0 0 4:45 0 I 5:00 0 0 0 1 5:15 0 0 5:30 0 1 5:45 0 0 6:00 0 0 0 0 6:15 0 0 6:30 0 0 6:45 0 0 7:00 0 0 0 1 7:15 0 0 7:30 0 I 7:45 0 0 ' ,• 8:00 0 0 I 1 8:15 0 0 8:30 0 0 8:45 0 0 9:00 0 0 0 3 9:15 0 0 - 9:30 0 2 9:45 0 .. 1 10:00 0 2 0 0 ' 10:15 0 0 10:30 2 0 10:45 0 0' - 11:00 0 0 0 0 11:15 •0 0 11:30 0 0 11:45 0 0 r Total 2 18 -- Peak Hou 9:45 • •12:00 -, Volume 2 9 Facto 0.25 0.75 DayTotal 20 Data File: 0215301A • Page: 6 i Traffic Data Gathering 11410- l3th Street SE Lake Stevens, WA 98258 Location: : Barbee Mill Dvwy off Lk WA By. 02-153-01 A ' City: : Renton,WA 07/15/02 Counter: : 502 7 interval Monday Begin AM -COMB PM -COMB •12:00 0 0 7 24 12:15 0 4 12:30 0 10 12:45 0 3 1:00 0 0 6 17 ' 1:15 0 3 1:30 0 4 1:45 0 4 2:00 0 0 0 13 2:15 0 4 -_ 2:30 0 4 2:45 0 5 ' 3:00 0 0 4 16 3:15 0 2 3:30 0 6 3:45 0 4 4:00 2 5 1 . 32 4:15 2 14 4:30 0 13 ' . 4.45 1 4 ' 5:00 I 17 2 5 5:15 7 0 5:30 5 2 - 5:45 4 1 6:00 2 7 0 2 6:15 0 0 6:30 4 0 6:45 I 2 7:00 7 15 0 1 7:15 2 1 7:30 5 0 __ 7:45 1 0 8:00 II 18 0 4 , 8:15 6 4 8:30 0 0 8:45 1 0 9:00 5 . 6 . 0 0 9:15 0 0 9:30 0 0 9:45 1 0 V - 10:00 1 2 0 2 10:15 0 0 10:30 0 1 10:45 1 I 11:00 0 8 0 0 11:15 3 0 11:30 0 0 --_• 11:45 5 0 Total 78 116 ''. _ Peak Hou 7:30 . 4:15 •Volume 23 33 Facto 0.52 0.59 DayTotal 194 - Data File: 0215301A Page: 7 MICROFILMED Barbee Mill Preliminary Plat Draft Environmental Impact Statement Volume 2 Appendices B - E Prepared for City of Renton Renton,Washington Prepared by Parametrix 5808 Lake Washington Blvd.NE,Suite 200 Kirkland,Washington 98033-7350 (425)822-8880 www.parametrix.com August 2003 Project No. 554-1779-017 APPENDIX B Floodplain Analysis Technical Report FI I�t I ' Barbee Mill Preliminary Plat Draft Environmental Impact Statement Appendix B Floodplain Analysis Technical Report 4 � + I ( Prepared for City of Renton i Mq � 1 Prepared by Parametrix 5808 Lake Washington Blvd NE,Suite 200 Kirkland,Washington 98033-7350 (425)822-8880 www.parametrix.com ti August 2003 Project No.554-1779-017(01/06) TABLE OF CONTENTS I. INTRODUCTION B-1 2. METHODOLOGY B-3 2.1 HYDROLOGY AND STREAM FLOWS B-3 2.2 GEOMORPHOLOGY B-3 2.3 SEDIMENT TRANSPORT ANALYSIS B-3 2.3.1 Historic Sediment Transport B-4 2.3.2 Sediment Transport Modeling B-4 2.4 FLOODPLAIN ANALYSIS B-5 2.4.1 Hydraulic Model B-5 2.4.2 Floodplain Mapping B-10 3. AFFECTED ENVIRONMENT B-12 4! 3.1 HISTORIC DELTA B-12 3.1.1 Channel Morphology B-12 3.2 CHANNEL AND FLOODPLAIN SUBSTRATE AND VEGETATION B-12 3.3 100-YEAR FLOODPLAIN B-13 3.3.1 Hydraulic Restrictions B-13 4. IMPACTS B-14 4.1 ALTERNATIVE 1 —50-FOOT SETBACK B-14 4.2 ALTERNATIVE 2— 100-FOOT SETBACK B-15 5. MITIGATION B-16 6. REFERENCES B-17 ATTACHMENTS A Hydraulics Support Documents—Results B Sediment Transport Analysis Support Documents ti t_" I City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-i August 2003 TABLE OF CONTENTS (Continued) LIST OF FIGURES B-1 Project Vicinity B-2 B-2 Barbee Mill Reach Existing 100-year Floodplain Based on Future Flow Rates B-11 LIST OF TABLES B-1 Summary of HSPF Modeled and Measured May Creek Stream Flows B-3 B-2 Summary of Sediment Transport Model Results B-5 \' B-3 Summary of Bridge Geometry B-6 B-4 Range of Manning's Coefficients for Channel Roughness B-7 B-5 Range of Manning's Coefficients for Floodplain Roughness B-8 B-6 Summary of Modeled 1990 Flood Stages B-9 B-7 Comparison of 1995 FEMA Model and HEC-RAS Model Results B-9 B-8 Increases in 100-Year Floodplain Depth with Setbacks B-15 c l 111 City of Renton 554-1779-017(01/06) Barbee Mill EIS—AppendixB-Floodplain Technical Report B-ii August 2003 i 1 ACRONYMS AND ABBREVIATIONS cfs cubic feet per second EIS environmental impact statement } FEMA Federal Emergency Management Agency HEC-RAS Hydraulic Engineering Center-River Analysis System 1 HSPF Hydrologic Simulation Program-FORTRAN �rl mm millimeters RM river mile USACOE United States Army Corps of Engineers USGS United States Geological Survey WSE water surface elevation 1 1p r—� a �. City of Renton 554-1779-017(01/06) ' Barbee Mill EIS—Appendix B-Floodplain Technical Report B-ill August 2003 i 1. INTRODUCTION This floodplain analysis was undertaken as part of the Environmental Impact Statement for the proposed redevelopment of the Barbee Mill site (Figure B-1) on Lake Washington to accommodate approximately 115 residential units. As part of the sawmill operations, the May Creek Delta, which is adjacent to the site, has been periodically dredged since the mid 1950s to maintain water depth for storage of logs in 1 + Lake Washington adjacent to the sawmill and to reduce site flooding. These dredging operations artificially increased the gradient of the stream and deepened the channel at the mouth. Periodic dredging is expected to end as a result of replacement of the sawmill with residential development. Ending dredging is expected to result in aggradation and delta formation at the mouth of Mill Creek. This 1_ floodplain analysis was conducted to evaluate the geomorphological aspects of the stream and the floodplain, and to estimate potential floodplain and flooding impacts associated with proposed development alternatives. Two different approaches were used in this evaluation. Sediment equations were used to predict changes in delta levels (aggradation/degradation)due to changes in dredging operations. In addition, a floodplain analysis was performed to map the extent of the 100-year floodplain under estimated future delta and channel elevations and flow conditions. r-' ti JI i I City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-1 August 2003 2 5 4051 522 0 DUVALL 202 REDMOND riA;, , KIRKLAND 4' 202 203 520 Lake BELLEVUE Washington sum - ISSAQUAH V r, NEWCASTLE ; : 900 RENTON PROJECT 405 SITE Parametrlx DAZE: 07/24/03 FILE: K1779017P01T14F-1-1-01 Figure B-1 �p Vicinity Map �i� Barbee Mill Preliminary Plat 2. METHODOLOGY This section describes the methodology used to characterize the affected environment and to evaluate potential floodplain and flooding impacts of the proposed alternative. 2.1 HYDROLOGY AND STREAM FLOWS The hydrology of May Creek is typical of Puget Sound Lowland Streams located in an urbanizing watershed (King County 1995). As part of the Current and Future Conditions Report (King County 1995), a Hydrologic Simulation Program — FORTRAN (HSPF) hydrologic model was prepared for the May Creek watershed. The HSPF model was used to predict flow rates for the 100-year return frequency event at the mouth. Some measured flows were used to calibrate the model(Table B-1). Table B-1. Summary of HSPF Modeled and Measured May Creek Stream Flows Description Flow Rate(cfs) Method Mean Annual Flow 25.6 Measured 1990 Flood Event 598 Measured FEMA 100-year Flow(FEMA 1996) 870 Modeled r Current 100-year Flow(King County 1995) 835 Modeled Future 100-year Mitigated Flow(King County 1995) 1,059 Modeled Source: King County(1995). Peak flood flow discharges have increased an estimated 30 to 50 percent in the May Creek canyon and mouth (King County 1995). As shown in Table B-1, the HSPF predicted flow rates under future mitigated conditions are higher than existing and historic flow rates for the same return frequency storm event. This is due in part to the ongoing and predicted future development and urbanization of the May Creek watershed, which results in an increasing amount of impervious surface area within the watershed. 2.2 GEOMORPHOLOGY Based on review of existing and historic topographic maps of the area and a site visit conducted in April 2003,the proposed alternative is located on the May Creek Delta. The May Creek Delta is a depositional area that extends underwater in Lake Washington approximately 3,000 feet and extends upstream to approximately river mile (RM) 0.6. However, I-405 and the railroad bridge limit the upstream extent of the delta. The delta has been building over approximately the last 13,600 years(King County 1995). The 1897 s _ United States Geological Survey.(USGS) maps show the delta as a wetland area, and historically the May Creek channel would have migrated throughout the delta area. The low gradient of the stream in the project area is influenced by Lake Washington. 2.3 SEDIMENT TRANSPORT ANALYSIS The frequency and duration of the increased peak discharge rates has increased sediment transport rates, which are influenced by the magnitude, duration, and frequency of flood flows and the supply of sediment available to transport. The May Creek channel adjusts to increased flood flows by bank and bed erosion creating a wider channel. City of Renton 554-1779-017(01/06) ar Barbee Mill EIS—Appendix B-Floodplain Technical Report B-3 August 2003 2.3.1 Historic Sediment Transport Construction of the Lake Washington Ship Canal in 1916 lowered Lake Washington water level by nine feet to its present level. This initially increased the gradient of.May Creek's lower channel, which caused incision of the channel into the exposed portion of the historic May Creek Delta. This shifted the main deposition zone of the delta downstream and further into the lake. Subsequent placing of fill material and the addition of streambank riprap on the delta further confined the channel, resulting in high ground similar to levees along each bank,with the west side being lower relative to the east bank. These levees concentrate flow in a fixed single uniform channel,and increase the sediment transport capacity because all of the stream energy is confined to the single channel. If a flood were to spill over the west bank, the flood height could only get a few feet deeper because additional flow would spill across the delta toward the lake. This, along with the relatively low gradient caused by the lake backwater effect(and the presence of bridge foundations), would limit the sediment transport capacity during flood events. Aggradation is expected where the May Creek channel flows across the delta because of the abundant upstream sediment supply, increased peak flows to transport the sediment, and the low gradient across the delta. Historic dredging operations have annually removed an estimated 2,000 cubic yards of sediment at the mouth of May Creek downstream of the lowest bridge,where a river mouth bar would naturally build (King County 2001). Aggradation at the mouth leads to a backwater condition upstream that controls the flow gradient and sediment transport capacity of the delta channel. With regular dredging at the mouth, the backwater effect would be temporarily lessened, and some short-term incision upstream would be expected. Without dredging, the river mouth bar would remain and expand laterally, and the channel would adjust by aggrading. In addition, the expanding bar would eventually limit (or block) flow at the channel mouth, causing flows to shift to either side and further distributing the sediment. Wind and boat-wake-formed waves would further redistribute the river mouth sediment along the shore. The waves would also limit how high the river mouth bar could build. The river mouth bar would probably not build much more than a few feet above the typical winter lake level, for this analysis it was assumed that the Delta would be equal to the winter lakes level(el. 16.9),which is approximately 1 ft higher than the existing channel bottom. Surveys of the May Creek channel on the delta conducted in 2002(Otak 2002)indicate that the bed elevation has incised approximately 2 feet upstream of the main bridge, and about 0.5 foot downstream of the main bridge relative to the survey conducted in 1993 (INCA 1993). These differences indicate the potential for grade changes in the lower May Creek channel. A grade control structure at the stream gage at the BNSF bridge controls the upstream incision, but lateral migration and bank erosion of stored alluvium are the main source of the gravel and cobbles present within the project area. 2.3.2 Sediment Transport Modeling Based on field observations, there is a transition in the bed surface substrate from sandy gravel to sand within the proposed alternative stream reach. Flood flows can easily transport the sand through the May -` Creek channel, until the transport is influenced by the lake backwater effect(lower bridge). However,based on sediment transport modeling and literature information(Andrews 1993), gravel and cobbles would not be expected to be so easily transported to this point(Table B-2). City of Renton 554-1779-017(01/06) - Barbee Mill EIS—Appendix B-Floodplain Technical Report B-4 August 2003 it Table B-2. Summary of Sediment Transport Model Results ( Mobile Particle Size(cm) Flow Rate Cross Section 4' Cross Section 9a 25 cfs(mean annual flow) 0.01 1.0 2-year flow(391 cfs) 4.8 5.3 589 cfs(1990 flood) 4.5 7.0 1,058(100-year flow) 3.4 12.0 Source:Andrews(1983). a See Figure B-2. The predicted mobile sediment size at cross section 4 decreases at greater flow rates due to backwater from the lowest bridge (Attachment B). During the largest floods, the gravel and cobbles move and form a layer in the delta deposits beyond the river mouth. This layer is typically covered by sand during base flows and small magnitude floods,giving the May Creek Delta layering. Limited surface samples and pebble counts were obtained in the vicinity of the May Creek Delta as part of this analysis (Attachment B). Surface samples collected from the upstream end of a channel bar are considered to be representative of the sediment that is transported in the May Creek canyon and delivered to the delta(Attachment B). Based on this sampling, it was estimated that sand makes up about 24 percent of the river alluvium. The sand is derived from the stored alluvium along the channel and from erosion occurring further up May Creek Valley. A surface pavement of coarser material is indicated by pebble count Sample MC-4 (Attachment B). The surface pavement varies across the channel and along the channel, but the upstream Sample MC-4 and the pavement pebble count across the delta channel are both considered to be typical of the surface substrate. When May Creek stream flow reaches Lake Washington,backwater effect flow velocity is lowered,resulting in a substrate composed of sand (Attachment B). This sand is typical of the lower river starting approximately 75 feet upstream of the last bridge and extending into Lake Washington. 1 2.4 FLOODPLAIN ANALYSIS The proposed alternative study area extended from Lake Washington (RM 0.00) upstream to the railroad bridge (RM 0.22). The floodplain associated with the future 100-year mitigated flows was mapped in this location to evaluate the potential for flooding on the site, and to evaluate potential setback alternatives. The 100-year floodplain is defined as the area inundated during a storm event with a 100-year return period, or the area that has a 1 percent chance of inundation in any given year. 2.4.1 Hydraulic Model The floodplain associated with May Creek in the study area was mapped using a HEC-RAS hydraulic model (USACOE 2001) and Parker sediment equations. HEC-RAS uses a one-dimensional energy equation to calculate water surface profiles using steady flow equations (USACOE 2001). The model has basic data requirements for geometric data and steady flow data. Geometric data used for the study area reach included river system schematic data, cross section geometry and downstream reach lengths, bridge data, and energy loss coefficients. The steady flow data included flow regime, boundary conditions, and discharge information. The basic data requirements are discussed in detail in the following sections. City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-S August 2003 2.4.1.1 Geometric Data River System Schematic The study reach included a total of 1,125 lineal feet of channel. The river stationing for the model started at the confluence of May Creek and Lake Washington(RM 0.0),with the stationing increasing in the upstream direction. Cross Section Geometry and Downstream Reach Lengths Channel cross sections define the flow area of the river. Cross sectional data includes ground station and elevation points that define the channel and overbank areas. The cross sectional geometry was developed using a topographic survey conducted by OTAK(OTAK 2002). Vertical datum for the mapping and HEC- RAS model is NAVD 88/91. For each cross section, the left and right bank stations were assigned to demarcate the boundary between main channel and overbank flow areas. The bank stations for each cross section were determined using notes made as part of the OTAK survey. The geometry data between Sections 2 and 9 were manually modified to account for overbank flow on the northern bank (Figure B-2). The survey data indicated that the northwest bank (levee) was the high point and that the land generally sloped down from this point to the lake. To more accurately represent flooding conditions, the cross sections were extended to the northwest at an elevation equal to the bank elevation. This reduced the amount of flood storage provided in the overbank area, and more accurately represents flooding conditions at the site. Cross sections were spaced between 5 and 188 feet apart to represent reaches with different geometric characteristics. The model contained a total of 22 cross sections(Attachment A). Bridges The lower(farthest downstream), middle, and upper(farthest upstream)bridges were modeled in HEC-RAS. Bridge geometry was surveyed in the field to a tenth of a foot vertical and horizontal. This information was verified using the results from a previous study(Table B-3)(INCA 1993). Table B-3. Summary of Bridge Geometry Bridge Opening Low Chord Height High Cord Bridge Deck Width(feet) (feet) (feet) Width (feet) Lower Barbee Mill Bridge 18.2 20.8 23.0 14 Middle Barbee Mill Bridge 40.6 23.3 25.0 4 Upper Barbee Mill Bridge 28.0 23.8 27.0 38 _i A new bridge is proposed for the site; however, no design information was provided, so it was assumed that the bridge would not hydraulically confine the 100-year flow. ,, Energy Loss Coefficients The model evaluates energy losses using Manning's roughness coefficient for frictional losses, contraction and expansion coefficients for transitional losses, and bridge coefficients for entrance and exit losses. City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-6 August 2003 I / Manning's Roughness Coefficient Manning's roughness coefficients were estimated for the channel and floodplain using pebble counts, field t- observations, and the USGS methodology for estimated hydraulic roughness (USGS 1989). Pebble counts were performed at two sites within the study reach by measuring at least 100 particles for each site and are generally representative of the overall stream roughness (Wolman 1954; Leopold 1970; Bunte 2001). The results of the pebble counts indicate that the stream has a very course gravel substrate in the upper portions of the site and a sandy substrate in the lower portion of the site,downstream of the lowest bridge. I Overall channel and overbank roughness values were estimated for the model using the equation from the USGS methodology(USGS 1989): n=(nb+ni+n2+n3+n4)*m , Where: nb=Base value;channel substrate ni=Degree of irregularity n2=Cross section variation n3=Obstructions n4=Vegetation m=Degree of meandering The USGS methodology has subcategories for each variable (nb, ni, n2, n3, n4, and m) based on the general characteristics of the stream or floodplain. Each subcategory has a range of roughness coefficients. The appropriate subcategory for the study area channel and floodplain were selected using field data and observations(Tables B-4 and B-5). L Table B-4. Range of Manning's Coefficients for Channel Roughness Range Variable/Subcategory/Description Low High nb Very course gravel Pebble Count D50=32 mm 0.028 0.035 ni Minor Uniform channel in good condition 0.001 0.005 n2 Alternating occasionally The main flow shifts from side to side 0.001 0.005 { n3 Negligible Obstructions generally occupy less than 5 0.000 0.004 percent of the cross sectional area n4 Small Little to no live vegetation in the stream channel 0.002 0.01 m Minor Sinuosity=1.04 1.0 1.0 n Manning's Roughness Coefficient 0.032 0.059 City of Renton 554-1779-017(01/06) 1 Barbee Mill EIS—Appendix B-Floodplain Technical Report B-7 August 2003 Table B-5. Range of Manning's Coefficients for Floodplain Roughness Range Variable/Subcategory/Description Low High nb Very course gravel Pebble Count D50=32 mm 0.028 0.035 ni Minor Floodplain is uniform and paved and smooth in 0.001 0.005 many locations - - n2 na n3 Negligible Obstructions occupy more than 5 percent of the 0.000 0.004 floodplain n4 small The floodplain is paved or gravel in many locations 0.001 0.01 with minor shrubs and grass adjacent to the channel m na 1.0 1.0 n Manning's Roughness Coefficient 0.03 0.054 The high values from the USGS method for the channel correspond with the FEMA 1996 roughness values of 0.06, so this value was used for the channel. A roughness coefficient value of 0.026 was used in cross sections 3, 2.3, 2.25, 2.15, 2.1, 2, 1, and 0, because the channel is predominately sand substrate in this location (USGS 1989). The FEMA estimate of the floodplain roughness was 0.07, which is higher than the USGS value. The FEMA value was used to estimate floodplain roughness because it is more conservative. Expansion and Contraction Coefficients HEC-RAS uses expansion and contraction coefficients to estimate energy loss between cross sections due to changes in cross sectional geometry. The calculation is based on changes in velocity head. The study reach was modeled using a contraction coefficient of 0.1 and an expansion coefficient of 0.5, which are the values recommended in the user manual for gradual transitions(USACOE 2001). Entrance and Exit Loss Coefficients Energy loss is common at bridges that confine the channel and floodplain. For this reason, the expansion and contraction coefficient were modified at cross sections immediately upstream and downstream of each bridge. The contraction coefficient was modified to 0.3 for the cross section upstream of each bridge and the expansion coefficient was modified to 0.5 at the cross section downstream of each bridge. These are the HEC-RAS recommended values for bridges(USACOE 2001). 2.4.1.2 Steady Flow Data Discharge rates for the future mitigated 100-year return frequency event, which was estimated using the method summarized in Section 3.1, was used in the HEC-RAS model. A subcritical flow regime was used for this analysis, which is applicable to calculations for water surface profiles greater than or equal to the critical depth. The water surface elevation at the downstream boundary of the hydraulic model was estimated using USACOE Lake Washington water surface elevations (WSE)measured at the Ballard Locks. The USACOE WSE on the day of the survey was 21.52 feet, and the OTAK surveyed WSE was 18.43 feet. This difference, which was due to differences in vertical datum, is 3.09 feet. This information was used to convert the winter lake level to the project datum to accurately represent the lake WSE during a period in which a 100-year storm event is likely to occur(November to February). The USACOE regulates the lake City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-8 August 2003 +- ` level, and in the winter the elevation is approximately 20 feet. This estimated elevation was converted to the project datum,resulting in a downstream WSE of 16.9 feet being used for the modeling. 2.4.1.3 Calibration The model was not specifically calibrated using a series of measured data. However, anecdotal information during the 1990 event indicated that the water level nearly reached the top of the bank,but did not flow over. This 1990 event was modeled,with the model predicting similar results(Table B-6). Table B-6. Summary of Modeled 1990 Flood Stages Cross Section 1990 Flood Elevation Levee Elevation Difference (feet) (feet) (feet) 8 25.6 26.5 0.9 7 24.9 25.3 0.4 6.75 24.0 25.0 0.9 6.7 24.0 25.0 0.9 6 23.3 24.5 1.2 5 22.6 23.8 1.2 4.4 21.9 23.0 1.1 FEMA mapped a 100-year floodplain associated with May Creek on the site; however, the FEMA study did not extend to the mouth of the creek. The FEMA map begins at the upper Barbee Mill Bridge (approximately RM 0.14)and has a 100-year flood depth of approximately 4.5 feet. The FEMA map shows a 100-year flood depth of approximately 3.5 feet at the upstream project limit, which is immediately downstream of the Burlington Northern Railroad. The FEMA map indicates that the existing 100-year floodplain varies.in width and is located to the south of the Burlington Northern railroad spur line that services the Barbee Mill. The HEC-RAS model was also run with the FEMA 100-year flow rate to calibrate the results(Table B-7). - Table B-7. Comparison of 1995 FEMA Model and HEC-RAS Model Results Depth(feet) Width(feet) Cross Section FEMA 1995 HEC-RAS Differencea FEMA 1995 HEC-RAS Difference 11 3.5 6.6 3.1 50 36 14 5 4.5 5.9 1.4 70 52 18 a Depth in the HEC-RAS model was measured from the thalweg,which may explain the difference. As shown in Table B-7 the HEC-RAS model results for the FEMA 1995 flow rate are similar in width. By comparing the HEC-RAS results to the FEMA 1995 flow(using the right bank elevations), the HEC model indicates that the flood stages only exceed the bank in one location, which is due to the influence of the bridge. This may not have been evaluated in the FEMA model. Therefore, it was concluded that the HEC- RAS model accurately reproduced the results of the FEMA 1995 floodplain, and the increased floodplain extent is due to an increase in the 100-year return frequency flow rate(previously discussed). City of Renton 554-1779-017(01/06) Barbee Mill EIS-Appendix B-Floodplain Technical Report B-9 August 2003 2.4.1.4 Model Limitations Deposition of sediment and build-up of bars and bed elevations is a natural feature of deltaic systems. The HEC-RAS model did not simulate sediment transport and the potential influence this would have on flood levels. The buildup of the delta was estimated using the methods discussed in Section 2.3. Results from this analysis were modeled using HEC-RAS to simulate flood levels under future conditions. 2.4.2 Floodplain Mapping The floodplain depth during a 100-year return frequency flow was calculated for May Creek in the proposed alternative reach. The resulting floodplain width was interpolated between cross sections. The floodplain width on the north side of May Creek(right bank)was estimated to extend to Lake Washington(Figure B-2). Y I e I -I 1 i Ciry of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-10 August 2003 1,4, , ,„'_„_•',-_-•'.'-.,'.-.'-.'„"'-,/.- ...,...-,--"\•i ,I --- /L/.kc\I/M/J1,/T,•,,,S,,,-,--_,.-,.,.-F,-- --N--1• ..i1 , t// _ i _, , •11_145.„ r / /.. , OFLOODPIN, i //) --- A I', ___:, r-, • / 7 / ..._ iP / •I • / .{27 13) ;,,-'2,- die / i , //t_4/ ' 1 i ___„9-t-)--__ ,,,,,-;;;;/,',<.;•,-,/ iy / /7" v..-c-/ 1 \ r i/i Nip' '''.„,,,t4r; ,y„/ , I i \ RS 6.75/( ,,,,',,',,-'„. ,•••' // • ki • ' k• 10,11/4-•,•-• ,. ,/,'1.-- 1,• i ) '`''• ,,.. ....••••.•-•, -,- , / / / 1 ; RSf6. ••t„.7., rti 4 it /„' / LAKE I , i ) 1211\ill,Ai i''' ,Is 4'/ / / LIMITS OF / WASHINGTON i 1 / — "- Rs10-' I , I? i/4 / / FLOODPLAIN f,--- -‘1,1 t I, 6, A t.\ - , i fill: iji \ ''III i r; '/iv/ / /MAY CREEK I \\. \ 4it•A, / RS 4.35 ' \\•\ • ‘'li RS 4.25 ; 1, li ly ,%* 4,,.7 / " \ \ i I io i ,i, / \II ) I RS 4.2 1 1 I , •••/' , 7 ty / •_,„, f, , ; 7 , ‘1,1•,/ • ,,,,„ /7/i, , ,,' // / I , I?, #.. ‘; •iRB-4 4 ...• // si / _ -P 4444 .----- -27— . / "N, / / # ';:: ---•:‘,7- -:///;/ / UPPER BRIDG .,,„ , ,,,,,,,: ,..0 ':\ , , 4 / s,,,, / IS 2.15 0 " / '\ - W _ ' \,/ 440. ;AI .. \'. --"*,,r+v-OPA r.t4rf:„.•;;;....;•,•';4:••-='-" ,41,,wr, RS 2.g5\.' '• ' •'/1--- 7 Y / \. / / \.- • -(•;•••=-.....---'''•' ./- flA , \/• 4,4 -• ‘ 77, RIDG / ••:•--;;;'-- E\7 ---...,...,:::i 21 ---.41- /'1-- / • * f-,„,1 * - 7 / 1 1 . , • ' /I / . ---' '-'-'- ',..' / / .1_ ._ / j_....... _....mw—..... ...-.--.:-.1....... ,44,C4/ ---- N 40TH ST 7 _____ _________i___I .it:L.:0,, •,- ' 0,s LOWER BRIDGE sf 1 /7 /•Xce••:4/,•tV•7'-, Parametrix DATE: 07/01/03 FILE: K1779017P01T14F-B-02 Figure B-2 100-YR FLOODPLAIN Barbee Mill Reach No NO SCALE —•••—•••— MAY CREEK CENTERLINE 100-yr Floodplain RS# RIVER STATION IN HEC-RAS MODEL with Future Flowrates 3. AFFECTED ENVIRONMENT The May Creek watershed drains the foothills of Cougar Mountain, Squak Mountain, and Newcastle Hills. This study focuses on the lower portion of May Creek including the delta, from Lake Washington to the Railroad Bridge. 3.1 HISTORIC DELTA The May Creek Delta is a depositional area that extends underwater in Lake Washington approximately 3,000 feet and extends upstream to approximately RM 0.6. However,I-405 and the railroad bridge limit the upstream extent of the delta. The delta has been building over approximately the last 13,600 years (King County 1995). The 1897 USGS quad range maps show the delta as a wetland area, and historically the May Creek channel would have migrated throughout the delta area. The low gradient of the stream in the project area is influenced by Lake Washington. Construction of the Lake Washington Ship Canal in 1916 lowered Lake Washington's water level by 9 feet to its present level. This initially increased the gradient of May L-- Creek's lower channel, which caused incision of the channel into the exposed portion of the historic May Creek delta. This shifted the main deposition zone of the delta downstream and further into the lake. { 3.1.1 Channel Morphology r Subsequent placement of fill material and the addition of streambank riprap on the delta further confined the channel,resulting in high ground similar to levees along each bank,with the west side being lower relative to the east bank. These levees concentrate flow in the fixed single uniform channel, and increase the sediment transport capacity because all of the stream energy is confined to the single channel. If a flood were to spill over the west bank, the flood height could only get a few feet deeper because additional flow would spill across the delta toward the lake. This, along with the relatively low gradient caused by the lake backwater effect (and the presence of bridge foundations), would limit the sediment transport capacity during flood events. Historic activities at the Barbee Mill site have affected the geomorphology of lower May Creek by unnaturally confining it. In addition, since the 1950s Barbee Mill has been dredging approximately 2,000 cubic yards of sediment per year from the mouth of May Creek to allow the mill to continue its operations (Kind County 2001). 3.2 CHANNEL AND FLOODPLAIN SUBSTRATE AND VEGETATION Alluvium in the lower May Creek channel consists of cobbles, gravel, and sand. The channel substrate is typically sub-round. Based on field observation of the channel, in the proposed alternative reach, there is a transition from course sandy gravel in the upper portion of the site to predominately sand in the lower portion entering Lake Washington. ' The May Creek floodplain within the proposed alternative site has very little vegetation, as it is primarily covered with asphalt associated with the Barbee Mill. Some small shrubs,grass, and alders are located along the tops of the high banks. Trees,understory vegetation, and large woody debris,which are a critical part of the formative process for stream channel substrate, streambanks, and floodplains, are lacking at the proposed alternative site. City of Renton 554-1779-017(01/06) 5 Barbee Mill EIS—Appendix B-Floodplain Technical Report B-12 August 2003 3.3 100-YEAR FLOODPLAIN Approximately 1,125 feet of May Creek within and adjacent to the proposed alternative study area was modeled using the hydraulic model HEC-RAS (USACOE 2001). HEC-RAS was used to calculate floodplain widths and depths for the 100-year future condition flow rate flood event. In general, the 100- year floodplain width and depth are influenced by the three existing bridges, and the predicted 100-year floodplain would cover most of the proposed alternative site downstream of cross section 9 (Figure B-1; Attachment B). 3.3.1 Hydraulic Restrictions Hydraulic restrictions occur in locations where topographic features, fill, and/or structures encroach on the floodplain. In general, as the floodplain becomes more confined, flood depths increase and the erosive power of the stream increases. Hydraulic restrictions can be either natural or man-made. 3.3.1.1 Natural Hydraulic Restrictions Natural hydraulic restrictions are defined as locations where the 100-year floodplain is equal to or greater than the channel migration zone and the channel sinuosity is controlled by the valley. Because the proposed alternative site is located on the delta of May Creek, which consists of alluvial sediments deposited by the stream,there are no natural hydraulic restrictions in this reach. 3.3.1.2 Man-Made Hydraulic Constrictions Within the proposed alternative study area, three bridges cross May Creek: Lower, Middle and Upper Barbee Mill Bridges. The fill and structure at each bridge locally confines the 100-year floodplain. In addition, as previously discussed, the banks along most of the proposed alternative reach have been built up with fill and are armored with riprap,which confines the creek to a single channel. ' 1 i ! City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-I3 August 2003 4. IMPACTS �r— Flooding and floodplain impacts associated with the 100-year flood event would be influenced by many factors, including the erosive force of the river,the nature of the material protecting the proposed alternative development, and the extent of the floodplain. Potential impacts were evaluated by comparing three proposed alternative scenarios to the existing condition. The 100-year floodplain depths (as measured from the thalweg of May Creek) were determined for each scenario using the future 100-year mitigated flow rate of 1,059 cfs (King County 1995 — see Table B-1). The existing condition assumes the existing channel configuration, delta elevation (which is influenced by the continued dredging operations), and existing three bridges. The three proposed alternative scenarios all assume that dredging has been discontinued (thus allowing the delta to aggrade at the mouth of May Creek). The river mouth bar would probably not build much more than a few feet above the typical winter lake level,for this analysis it was assumed that the Delta would be equal to the winter lakes level (el. 16.9), which is approximately 1 ft higher than the existing channel bottom. The three proposed alternatives also assumed that the existing middle bridge has been replaced with a bridge that will not restrict the 100-year,floodplain. In addition, the individual proposed alternative scenarios assume the following: • Scenario 1 —No setback and no levees or fill; • Scenario 2—The proposed alternative is constructed behind levees or on fill with a 50-foot setback from ordinary high water;and • Scenario 3 —The proposed alternative is constructed behind levees or on fill with a 100-foot setback from ordinary high water. The proposed alternative within the 100-year floodplain is susceptible to flooding, erosion, and sediment deposition due to natural channel processes in a delta. The degree of potential impacts to the proposed alternative is difficult to quantify due to the stochastic nature of events that result in deposition, flooding, and channel migration. There is a strong correlation between development within a floodplain and the level of impact to the stream. _, Stream and floodplain hydraulics would be affected in locations where the proposed alternative would encroach on the floodplain and/or stream channel through the construction of fill or levees. Fill and levees 11 within the floodplain would impact the hydraulics of flood flows and could reduce the amount of overbank storage and increase water surface elevations,which in turn could result in upstream and downstream erosion and flooding. In addition, stopping annual dredging operations would result in bed aggradation, which r would likely increase floodplain elevations. Impacts to aquatic resources resulting from sediment transport, sediment deposition, and scour are addressed in the Fisheries Technical Report. 4.1 ALTERNATIVE 1 —50-FOOT SETBACK Under Alternative 1, existing constrictions on the floodplain and encroachment into the floodplain resulting from the proposed alternative would result in slightly increased flood stages at most of the cross sections in the model (Table B-8). The project would be constructed with a 50-foot setback from the top of the stream bank, and it was assumed that the development would be built on a levee that would be high enough to protect against flooding during a 100-year flood event. It was assumed that the project would remove the existing middle bridge and replace it with a bridge that would not restrict the 100-year floodplain; and it conservatively assumed the other two bridges on the site would remain with no modifications. The proposed alternative condition also assumes aggradation of the City of Renton 554-1779-017(01/06) j Barbee Mill EIS—Appendix B-Floodplain Technical Report B-14 August 2003 stream channel near the mouth (Attachment A). Increases in flood stages result in increased channel scour and bank erosion,which could result in impacts to habitat and water quality. Table B-8. Increases in 100-Year 1 Floodplain Depth with Setbacks 100-year Floodplain Depth 2(feet) Proposed Alternative Scenario 4 Cross Existing No Setback/ 50-foot Setback with 100-foot Setback with Section Condition3 No Levees or Fill Levees or Fill Levees or Fill 11 7.0 7.1 7.1 7.1 10 6.6 6.8 7.0 6.9 9 7.4 7.7 8.0 7.8 8 6.4 6.4 7.8 7.6 7 8.0 8.1 9.1 9.0 6 5.9 6.0 6.6 6.5 5 6.7 6.6 7.0 6.8 4 5.1 5.9 6.5 6.3 3 5.9 6.9 7.5 7.3 2 3.6 3.0 3.0 3.0 1 2.2 2.2 2.2 2.2 1 Future 100-year mitigated flow(King County 1995) 2 As measured form May Creek's thalweg. 3 Assumes existing channel configuration,delta elevation,and three bridges. 4 Assumes dredging discontinued and that the existing middle bridge has been replaced by a bridge that will not restrict the 100-year floodplain. The estimates of stream aggradation are based on the method discussed in Section 2.3. However, because the site is located on a delta, if the stream is prevented from migrating, potential aggradation would continue and floodplain depths would eventually exceed the above estimates. 4.2 ALTERNATIVE 2- 100-FOOT SETBACK Alternative 2 is likely to have impacts similar to but slightly less than Alternative 1 (see Table B-8). • City of Renton 554-1779-017(01/06) Barbee Mill EIS-Appendix B-Floodplain Technical Report B-15 August 2003 I I I 5. MITIGATION Potential flooding and floodplain mitigation measures could include constructing levees or constructing the proposed alternative on fill at an elevation above the estimated 100-year flood level (King County 2001). The model predicts an average maximum floodplain depth of 1-ft above the ground surface during the 100-yr I flood. Therefore,the levee or fill should be at least 2-ft above the existing ground elevation, to provide 1-ft of freeboard as required by RMC 4-3-050.I.3.a. More detailed analysis would need to be performed to evaluate a design. These mitigation measures could protect the development from flooding and reduce the chance of the stream migrating to a new location. Also, continued dredging at the mouth of May Creek could be combined with one (or both) of these potential mitigation measures. In addition, all existing bridges could be replaced with bridges that would not restrict the 100-year floodplain. However, potential impacts associated with fill placement or levee construction would have to be mitigated to reduce impacts to the stream. In general, impacts associated with fill placement and levee construction could potentially be mitigated by providing compensatory storage. To provide the greatest benefit to the stream, compensatory storage should be provided at the project site or at a location immediately upstream. This could be provided at the Barbee Mill site by removing an equivalent volume of historic fill adjacent to the stream at an elevation greater than the bank and less than the 100-yr floodplain elevation. Unless sufficient mitigation measures are implemented and maintained, significant unavoidable flooding and floodplain impacts could occur. • 11 City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-16 August 2003 6. REFERENCES Andrews, E.D. 1983. Entrainment of gravel from naturally sorted river material: Geological Society of America Bulletin 94:1225-1231. Bunte, K. and S.R. Abt. 2001. Sampling frame for improving pebble count accuracy in coarse gravel-bed streams. Journal of the American Water Resources Association 37(4):1001-1014. FEMA (Federal Emergency Management Agency). 1995. Flood Insurance Rate Map, King County, Washington and Incorporated Areas,Panel 664 of 1725. INCA Engineers Inc. 1993. May Creek Basin Plan Surveys for EBASCO Environmental,King County, and City of Renton. Job No.930120,3/23/93,by R.G.Hilliard and M.J.DuBray. King County. 1995. May Creek Current and Future Conditions Report. Prepared by Foster Wheeler Environmental Corporation for King County Department of Public Works - Surface Water Management Division and the City of Renton Building/Planning/Public Works Department- Surface Water Utility. King County. 1999a. Chapter 21A-24, rules and regulations of the department of development and environmental services, sensitive areas; alteration within channel migration areas. Department of Development and Environmental Services,King County,Washington. King County. 1999b. Channel migration boundary reassessment study guidelines. Department of Development and Environmental Services,King County,Washington. King County. 2001. Final adopted May Creek basin action plan. King County and the City of Renton. April2001. King County and City of Renton. 1995. May Creek Current and Future Condition Report. Prepared by Foster Wheeler Environmental Corp. Prepared for King County Surface Water Management Division and City of Renton Surface Water Management Division. Leopold, L. 1970. An improved method for size distribution of stream gravel bed. Water Resources Research 6(5):1357-1365. Otak, Inc. 2002. Technical Information Report for the Barbee Mill Preliminary Plat, King County, Washington. Report to the Barbee Mill Company. August 27, 2002. USACOE (U.S. Army Corps of Engineers). 2001. Hydraulic Engineering Center - River Analysis System (HEC-RAS) Version 3.0.1. U.S. Army Corps of Engineers Hydraulic Engineering Center, Davis, California. - USGS (U.S. Geological Survey). 1989. Guide for Selecting Manning's Roughness Coefficients for Natural Channels and Floodplains. United States Geologic Survey Water Supply Paper 2339. Wolman, G.M. 1954. A method of sampling coarse river bed material. Trans.American Geophysics Union 35:951-956. City of Renton 554-1779-017(01/06) Barbee Mill EIS—Appendix B-Floodplain Technical Report B-1 7 August 2003 Attachment A Hydraulics Support Documents — Results River= May Creek Reach= 1 RS= 11 River=May Creek Reach= 1 RS= 10 _ 07 . 06 < .07 07 — .06—)1r .07 34. Legend 34 Legend 32- WS 100-yr Future Mi 32- WS 100-yr Future MI WS FEMA 1996 WS FEMA 1996 30- WS 1990 Flood, 30 WS 1990 Flood Ground ■ Ground 28- M Bank • Sta c ,.28 Bank Sta co m 26- 45 4w .�. 2„ 26 Cu* s s .. w 24- • ii,, , 24- 22- 22 20 . . , 0 20 40 60 80 100 120 0 20 40 60 80 100 120 Station(ft) . Station(ft) River=May Creek Reach=1 RS=9 River=May Creek Reach= 1 RS=8 <—.07-��.06 07 <.07s� .07 32: Legend 30- 6 Legend • WS 100;yr Future Mi 1\1WS FEMA 1996 30- WS FEMA 1996 28- WS 100-yr Future Mi WS 1990 Flood•' - WS 1990 Flood 28- ■ Ground • • ■ Ground Bank Sta e. 26 Levee 26- s •�' Bank Sta W -, tv x* w 24, i. 24- .. w 22- r. 22 �,� 20 . , , , , , , , 0 20 ' '40 '60 80 110 120 " 140 0 100 200 300 400 500-. .600 Station(ft): Station(ft). River=May Creek Reach=1 RS=7 River=May Creek Reach= 1 RS.=6.9 28-f.07,oI .07 28‹.07daIt .07 > 6 Legend: 6. Legend 4 Y - Y Y ' - D" . _ V WS FEMA 1996 WS FEMA"1996 26 WS 100-yr Future Mi 26- ' a a WS 100-yr Future Mi K"'� • WS 1990 Flood • WS 1990 Flood • Ground - Ground `' e 24 Le ee c. 24- `- �•' A Ineff o_z. - s 4 a) -e• • livBank Sta > - Bank Sta N - ,, al 22: w 22- Y 20- i 0 I'l : \t c 18 , • . . • , i 181 . . r . , , . , • . • . • , 0 100 200 300 400 500 600 0 100 200 300 400 500 600 Station(ft) Station(ft) River.=May Creek Reach=1 RS=6.75 River=May.Creek Reach=1. RS=6.7 28-'1 O I( 07 )' 28 0I0 07 -7 6 : Legend:. I 7 6• Legend ♦ ' a WS 100-yr Future Mi WS'100-yr Future Mi 26 WS FEMA 1996 : 26 - WS FEMA 1996 \` a WS 1990 Flood`. ri a WS 1990 Flood • Ground ' Ground 24_ . 24 • 0. c `:-'.. Levee e o _ Levee A o •' - " Ineff" Bank Sta m • d w. 22,, ,, Bank Sta w 22 20- 20. 0 100 200 300 400 500 600 700 0 100 200 300 400 500 600 700' Station(ft) Station(ft) River= May Creek Reach= 1 RS=6 _ , . . River=.May Creek Reach=1 'RS=5• a • .07 07 .07 , 28 to C.6 Legend • 30 6 Legend WS 100-yr Future MI 28 M WS.100:yr Future Mi 26 WS FEMA 1996 WS FEMA 1996. ' WS 1990 Flood 26- WS 1990 Flood _. Ground Ground 24 Levee 24- Levee 0 • 0 m Bank Sta > Bank Sta w 22 2 22 20: 20 1 - 18- 1 18- 16 • , • , i i , i . i • i 0 200 400 600 800 1000 1200 1400 1600 0 200 400 600 . 800 1000 1200 1400. 1600 Station(ft) Station(ft) River=May Creek Reach=1 RS=4.4 River=May Creek- Reach= 1 RS=4.35 .07 d I .07 28 7 66 . Legend' . 28 .7 6 Legend 26- WS 100-yr Future Mi . 26 WS 100-yr Future Mi WS FEMA 1996''. WS FEMA 1996 24- WS 1990 Flood 24 WS 1990 Flood Ground Nor- Ground 22- Illr • Levee _ 22 MI Levee o .Q o ' A Ti Bank Ste foIneff w 20- w 20 Bank Ste 18- 18 16- ' 16 • 14 0 100 200 • 300 .400 500 600 . 0 100 . 200. - ' 300 . 400 .500 ' -.600 Station(ft) . . ' Station(ft)` , . _ - River=May Creek Reach=1 RS=4.25 River=May Creek Reach=1 RS=4.2 ' 28 old( .07 ' I( 28 0 0 .07 >1 7 6 ' Legend - 7 6 Legend A , WS 100-yr Future Mi WS 100-yr Future Mi 26 26 WS FEMA 1996 WS FEMA 1996 WS 1990 Flood WS 1990 Flood 24 • 24 Ground Ground „', C 'as 0 c IN Levee c 1111Ir Levee g n Al A 0 • Ineff 1-6 22 III Bank Sta a> a w Bank Sta w 20 ' 20 ri 18 18 16 0 100 200 300 400 500 600 0 100 200 300 400 500 600 Station(ft) Station(ft) River=May Creek Reach=1 RS r--4 River=May creek Reach=1 RS=3 ii 28 ;Id( .07_____________> .07 a cr :'6 Legend 34 7 2 Legend • 6 WS 100-yr Future Mi 32 WS 100-yr Future Mi 26- . VVS FEMA 1996 ' 30 WS FEMA 1996 WS 1,990 Flood WS 1990 Flood 24- 28 • Ground. Ground e . o s m - Levee c 26 Levee. c 2 22: II •• R • I : li Bank Sta it › 0 24 r: Bank Ste a 20- - _ 22 D . • - • • 20 1 — 18- 18 16 . . . . , . . . . , . . . . . 16 0 200 400 600 800 1000 1200 1400 ' 0 200 400 600 800 1000 1200 1400 Station(ft) - Station or) - 1 Xi.'S"r(,JL.$ t f,T[J 11c'hfr'-' MAY PI 2002 River=May Creek Reach= 1 RS=2.3 River=May Creek Reach= 1 RS=2.25 I. lc .07otk .07 24 12 Legend 24 2 Legend 22 i 6 WS 100-yr Future Mi 6 ;' WS 100-yr Future Mi WS.FEMA 1996 221 WS FEMA 1996 r WS 1990 Flood I WS 1990 Flood ■ ■ Ground Ground 20 CI20 Li c Levee C Levee •; o a Bank Sta ro 1neff W 18 a 18 Bank Ste 16 16 14 14 0 •. 100 200 300 400 500 600 0 100 200 300 400 500 600 Station(ft) Station(ft) River=May Creek Reach= 1 RS=2.15 River=May Creek Reach= 1 RS=2.1 ,c .07 24 .2 l .07 24 2 Legend Legend 6 6 WS 100-yr Future Mi „ WS 100-yr Future Mi y 22 WS.FEMA 1996 22 WS FEMA 1996 WS 1990 Flood WS 1990 Flood NI • I Ground NI Ground c 20 1 • Levee c 20 - Levee A 0 0 ineff y Bank Sta m i. m W 18 'Bank Ste LLI 18. 16 16 14 14 0 100 200 300 400 500 600 0 100 200 300. 400 500 600 Station(ft) Station(ft) • 6X►-i7ivrr:Co190)i ilcvq.s MW 144,7.cx; ' . . . .. River=May Reach=1 RS=2 River=May Creek'. Reach=1 RS.= 1 26. .07)1 < 07 24_4 • 07 026 07 2 Legend . 'Legend . 6 WS 100-yr Future MI 22- :r......... WS 1990 Flood : 24 ►, • WS FEMA 1996 WS 100-yr Future MI WS 1990'Flood 20 WS FEMA 1996 Ground .. 18_ , ` Ground Levee g •. Bank Sta 20 • o per_ wksr 3• y Bank Sta `> 14- 18 12 4• 16 ' 10 • 14 81 , , 1 i 4 i r , i I 0 200 400 600 800 1000 1200 1400 1600 0 50 100 150 200 250 300 350 400 Station(ft) Station(ft) . Ha.EC=RAS tPlari: Piari:17:`.R'iyei'May Creek, Re -':„ r , ach ;1: Existing.Conditions:.-Geome :01_ 0 I`:W v- ,hnl� Flowr>'�Ares: ,.11V)dth'•`_.nRver�Sta Gt;'i'.a�at� . �Des+crip$on''.: Nlir;;C}i`�E- , .S�.EIe , a_Depth�=:';=:11'et-C .. .. . . cis ft 'ft ft '- (ftls s ft Ft 11 598 199041ood ' 22.0 27:6 5:6 5.9„' ':101:5 :- .: :':'30 4: 11 . 1 059 . 10:0 yr Future 22.0 29i0 7:0 7.3 1512: .: ":42:2::. . 11 870 FEMA.1996 . 22:0 28.5 6:6 6:7 133:5. 36.2 10 598 21:4 26.7 5:4 6.3 -. 94;5 , 28.9:. 10 1,059 • . ' .. 21.4 • 28.0 6.6 8:0 •135':4 3,6.6 . 10 870 , 2.1 A 27.7 6.4 7.0. ` 127:1 , 35:1 9 598 20.3 26.5 • 6.2 -4.4 ` " 137.2 31:1 9 ' 1,059 20.3 27.7 7.4 '5.9' . .199.E 81:3 9 870 . " - - 20:3 27.5 .. 7.2 . 5.0 186..5 72.7. 8 598 ` 20.0 25.6 5.6 4.1 ..• . 176:4 77.1 8 1,0.59 ' 20.0 26.5 6.4 ' 5.4: . ' . 257.4 :110:7. 8 870 20.0 27.3 7.3 2.7. 652.4 • 489.4 7 598 - 18.3 24.9 6.6 5.4 . 136.2 . 36.7 7 1,059 ' 18.3 26.4 8.0 3.7 ' .744:5 .. 5583: 7 870 18.3 . 27.3 . 8.9 1.7 1:;262.8 600:0` 6.9 598 1.8.3 24.8 6:5 5.5 132 6 : `:;35:3 6.9 1,059 ' ' . ' , 18.3 26.4 8:0 3.7 . ..726:1- ':557.9 . 6.9 870 . . ,. 18:3 27.3 ' 8 9 1.7' ' i',262 8' 600.0 ., : 6.8 Bridged ' ' • , ; 6.75 .598- ' 18.4. 24.0 5.6 4.7. 137:6 42.1 6.75 . 1,059 18.4 25.3 6.9 • 4:1 • . :616 6 : :.589.7 . 6.75 870 18.4 24.9 6.4 5.8 171:6 1 ' 58.1 - 6.7 598 18.4 24.0 5.6 • 4.2 160:6, '42.2 ' 6.7 1,059 18.4 25.3 .6.9 " 3.8 647:5 . 5891 6.7 870 18.4 24.9 6:5 . 5.2 ' 202.5 5816 ' 6 598 18.4 23.3 _ 4.9 • 5.7 ". '122:5 50.9 6 1,059 18.4 24.3 5.9 7.2' 173.2 54.7 6 870 . 18.4 24.2 5.8 6.1 169.0 • 54.4 5 598 . ' ' 17.5 22.6 • 5.0 41 143:7 48:6 5 1,059' • • :17:5 24.2. 6:7 • 3.5 " 876.4 • 1,471.1 5 870 ' . 17.5 23.5 5.9 5.3. 188.8' `".52:0 4.4 ' 598 15.3 21.9 6:6 ' 5.9 .' 1.30.4 49:4. 4.4 1,059 15.3 23.2 • 7.8 8.0 297.5 `- : 560.6 4.4 '870 15.3 ' 22.8 7.5' 6.5 179.0 • 53:8. 4.35 598 • ' 15.3 21.7 6.4 6.4 • . 116.1 48.5 : HEC:=F.tAS:;PIa Pia -:17•;RRivr',:•May:•Cr : . .,:,,,, ::`-; ., .'�;r, H • ... ': ::. ,�. :,,..::,. . Existiti Ccitiiifians:�lGeaiinet� :0>1<'•' . ._ �_.�.. ;',. y.,•r,.,,r�,.>�.. . . . .. Y&°,.: -$ ....,..r'.i , .,� :,�: w • a<t`: ,g°: .-�i3;.4 -'.`:�'"'"a' irt:a P�°aa.: war, �.,..... ,:t;: ..� c} l io :C �.El W_S::.EleV .De th- : ,::Ve1 Chni 'Floiin a idth,:�:Rt er-kSfa;�.ne;Q. ta•,.,mw'. °:�©escript� „n: .lt?lin, ,,t , . .. . ° . °. .Are ��'ItV 4.35 1,059 :., '•- 15:3 . .. . . 23.`1 • .. 7.8:.:;: ,', 7 5'''::; `:j'.1:74:5 '.':....'•560:6= •• 8.70: •• ' - ; "15:3 22.5 ' 72• •:.''•,''.7 2..:•`' : ..,150:8 . , 52.5 4:35 ' 4.3 Bridge•" .`. . .. i 4.25 598 16:7, ~ 21.6. 4.9 ' : '.•6:2:•. • •.108:2 45.1 • - 4.25 1.,059 . 16.7 23.0 • 6.3 ' ,'.""7:4' ' ' 165:4 '53.4 . - •'4.25 870 16.7 • 22.4 5.7 . 7:1°. • 141:6.: 48:1 4.2 598 16.7 • 21.6 4:9 ". :6:0 116.8' . ' 45.0 . . . .4.2. '1,059 . 16,7 ' 23.0 • ` 6.3'..:: ,, 7:1:` `. '185:0.". ..• .53.3 4.2 870 16.7 - '22.4. 5.7 "• ::6:8 .' .. 155.7 48.1 • 5 4 598 17.5 21.1 3.6 6.0 • 101.1 3'8.4 4 1,059 17.5 22.6 5.1 ' 6.9 167.1 ,. . '52.5 • 4 870 . 17.5 21.9 . 4:5 . .6.8..,. 135.1. 43.7 3 " 598 ,. 16.3 • 19.9 3:7.: : •7.7 -; 79;3. • ;34:7. 3 ` 1,059 1.6.3. 22.2 • '5.9 . ,T:1.... .1.87:0 :.. . '55:3-• : 3 870. ' 162 . • 21:3 - . •.5.0• .7.4'.. ' :. 1:39:5. , . •5.1.7 2.3 • .• 598 ... 14.9 19.9 _ " : 5.1. : 6:7...,:. : 101:7::•. . 28.6 1 2:3 1,05.9 : '" 14.9 : .21.8 I. .6:9 . •8:2•:'. 157:7: • •32:7 . • 2.3 • 870 • • 14.9 • 21.1 6:2 , : •7.6 136:2 . 31:2 . 2.25 '598 - : 14.9 , 19.9 ..•5.0 ' ''6:8 -100 9; ' t. 28,6 . ' ' . 2.25 1,059 -14.9 ' ' " 21:7 '6.9. -. 8.2 .'156 2 • -32:6 2.25 870 ' , . 1:4.9 ' 21:1 6.2 `7:6: . 1.3.5:9` . 312 2.2 - Mult Open ' 2.15 598 . ' '15:5 "19.2 . .,: .3:7 ' 8:3 i "'80..1 30:0 i• . 2.15 1,059 ' 15:5 20.5 5.0. 9.9. . :121:6 32.3 ' '2.15 ' 870 ' . 15.5. 20:0 4:5 . ' 9.3. `. 1,05.3 • '31.4 2.1 > 598 15.5 18.8 . . 3:4. • " .9.2 .T1:1 " 29.5 •2.1 1,059 " . 15.5 20.1 4:6 . -1,1;.1:• - 107.9 31.5 i . 2.1 870 15.5 19:6 , • •. 4.1' . 10.4 . •03.3 30.7 i I 2 :598: . 16:0 18.7 2.7 7.7' 77.7 42.2 2 1,059 " . 16:0 • ' 19.6 : 3:6 . .. .. ..2 : •' ': 1.1.5.4 ` 44:1 • i 2 ' 870 . 16.0 . 19.3 " " ' 3.3 • . 8:6". . " • 100:9 • 43,4 • 1 598. 14.7 ' 16.9 2.2 1.4 ' 495.5 176.7 4 1 • 1,059 14.7 16.9 ' 2.2 2.4' 495:5 • 176.7 1 • 870 14.7 16.9 2.2 2.0 495.5 176:7 1 HBQ43AS';Plari:10 17 :-River Inlay:Cr a '- '"„salt-�Rech: 13 .k�. `;;.,';�,., 1Proposed:.Conditions,Aggredation`anitNoPMiddle:,Bridge•°Geoinet ,M1" 04,, >,=_r;' :. . ,,;n f:?%:^-rji= r:=>„To River:Sto QTotal . Description :<Mi 'Ct .EI W.S:.Elev. . �>Deph =:VVe.l Chnit" Fl±avi'Ai'eai'.y'WidthP,:� (cfs ;. jIt. s`;: rft ft' tls ' ':ft S ft 11 .598 1990-flood 22,0 27.6 • :5:6 5 9' s9:;:. 101.5:,:::.: 304 11 1,059 . 1.00-yr Future. 22.0 29:1 7:1 77.2 `: ',`.'1:53:2. 43 0. 11 870, FEMA 19.96 _ 22:0 28:5 6:6 6:7. ' ..:1:33:5. 35 2 10 • ', 598 21.4 26.7 5.4 •3.3 . ,94:5. 29.Q 10 1,059 , 21.4 28.2 6.8 7.7 :1442:9 ' 3818 10 870 21.4 27:8 .6.4 7.0 1272 352 9 598 20.3 26.5 6.2 4.4 137.3 . 31..1 9 1,059 . 20.3 28.0 7.7 5.5 228.2 ' 1.14.6 . 9 870 20.3 27.5 7.3 5.0 188.5 74.1 . 8 . 598 20.0 25.6 5.6 4.1. 176.5 77.1 8 1,059 20.0 26.5 6.4 6.3 258.6 482.0 8 870 , 20.0 27.4 7.3 2.5 685:0 490.5 7 598 . 18.3 24.9 .6.6 5.4 136.3. 36:7 7 1,059 18.3 26.4 ' 8.1 3:7 754.4 . 558:5 7 870 183 27.3 9.0 1.6 . 1303.2 600:0: 6.9 598 18:3 24.8. 6:5 5,5. 132,7:: 35:3: . 6.9 1,059 18,3 26.4. 8.0 3.7 : ,.736:5: ' ::. 558:1 6.9 ' ' 870 ' 18.3. ' 27.3 :. 9.0 . . 1:6 • 13032 .:600:0' 6:8 Bridge 6.75 598 18.4 24.0 . 5.6 ' 4.7 137.7 42:1:. 6.75 1,059 18.4 25.3 6.9 4:0 6385: . . ..589:7: 6.75 870 18.4 24.9 6.5 5.7 175:7 159.7:.. 6.7. 598 , 18.4 24.0 5.6 4.2 . 160:7 .. "42.3 6.7 1,059 18.4 25.3 6.9 3,7 ' '6693' . 5891 6.7 870 18.4 25.0 6.5 5.1 207.3 : 60:2 6 598 18.4 23.3 4.9 5.7 . 122.8 51.0 6 1,059 18.4 24.4 6,0 7.0 . 178.1 55.0 6 870 18.4 24.4 6.0 5.8 178.2 55:0 5 598 17.5 22.6 5.0. 4.7 144.5 48.7 5 1,059 17.5 24.1 6.6. . 4.2 . 687.0 . 1.470:9 5 870 17.5 23.9 6.3 4.6 358.6 : : 1470:5 4.4 598 15.3 21.9 6.6 ' 5.8 132.7.: 49:6 4.4 1,059 15.3 24:0 8.7 . 3:6 754.9 . 561.1 4.4 870 15.3 23.8 8.5 ' 3.4 ' 674:9 561.0 4.35 598 15.3 21.8 6.5 6.1 127.0 ' 49.1 E -F2AS'w`P'ta 'Plan°'17; ftiver: Ma":CreetcA 1r:V°". ` i vC � . =.. , . a. ;. .• . . .. . . .... ;sR� - ':_:-, r . <k Pro`oseliConii iors,A gsedation and 4o M►.ddle't8rid e10 .omet� �==g09,, £ i`,; •;; ,,,„;..1,:,, ; !,4, V ,. � Rv.RlerSta �' ;' Gfiota�= �:Descriptiiri� Milt 1ttFSElev m Depth � : . ouv�Aea d�; dt{i _ F fs , ,: ft ff <'• ,ft ffl . , s _:ft ,ft . • 4,35 1.;059..• 1"5 3:- ": 23:9 8:6 :`3:7 , :;: `:.`. 742 8:`1•.; .;::561 :1 r_.. 4.35 870 • 15.3 ,23.8 .` 8.5 3:4 `':664:1` " .`551:0 4.25 598 16:7. , •21:8, " 5.1 • . 5:6 .127.1 " " .:45:8 -. 4.25 1.;059 16.7 ' 23.9 . 7.2 4.1 ..624.7...: 1 555:6 '. 4.25 870 - 16:7 23.7 7:1 3:8 550:9. : 555:5: 4.2 598 16.7 . : 21.7 . 5:1.:. . . 5.7 124:1 45:6. • 4.2 1;059 '16:7 .. 23.9; 7:2 4.2' . . 611:3 : .555:6:: 4.2 870 .16.7. 23:7 .. 7:1 '. • 3.9 534:2 555:5 " " 4 598 • 17.5• 21:4 .4.0'. 5.4 114.2: 40.2 .: 4 '1,059 • 17.5 23.4.. 5.9 ' : 5.8 220.3 127.1 ' 4 870 17.5 ' . 23.5 6.0 4.4 364.2 1286:3 ,- 3 598 16.3 : 21.1 4.9 5.3 132.9 512 '' 3 . 1,059 16.3 " . 23.2 "6.9 . 5.7 245,:4 61';5 3 870 16.3 23.3. : 7.0 4.5 :254.61 , : ' 63:7:. . 2.3 598 15.9 20.7 .. .. 4.8 6.9 1:01;3, 1 :29:3'. " 2.3 . • 1,059 ' . 15:9 22:4 6:5 8.5'. 156:5:•.:.. .... 35:7- ' 2.3 : . 870 15:9 22:9 7:0 6.4 176.1 ` :•:45:9':; '". 0:0.: . • 2.25 598 ..15.9 20.7 4:8 7.0 100:2 :29;7-.•: : . 2.25 ' 1,059 15.9 ' 22.4: 6:5. 8.4 .15,4:5 ' . 35:7': : 2.25 870 15.9 22:9 7.0 6.4 175.7 `: 45:6' 2.2 Mult Open 2.15 598 15.9 19.9 ' 4:0 8.0 • . 84.9 . : 31:0 '. 2.15 1,059 , 15.9 21.2 . " 5.3 9.8 124.6 33.3 ' 2.15 . 870 r . 15.9 '20.6 ' 4.7 9:1 . 109.0 32.4 . 2.1 ' 598 15.9 19.5 . 3.6 9.2 73.0 ' 30.3 • i"-, 2.1 .1,059 15.9 ' 20.7 ' 4.8 11.2 . '110.4 . 32:4 is 2.1 870 ' 15.9 20.2 4.3 10.5 ' 95.6 31:6 ' 2 598 16.7 . ,18;9 ' 2.2 '_ 7.7 77.5. 41.8 2 1,059 16.7 19.7 3:0 9.2 115.3 44;0 2 . 8.70 16.7 '.19.4 2.7 . 8.7 100:5 .._ .43.1 1 598 ' 14.7 16.9 2:2 1.4 495.5 . 176:7 1 ' 1,059 ' ' 14.7 16.9 2.2 2.4 495;5` ' .. 176:7. 1 870 ' 14.7 16.9 2.2 2.0 495;5 176.7 , HRp;•= i;S•Plan: Pieri'•17: Proposed,Conditions,Aggredation ar cl?:Wo Midtlte°Bridge;'.50-ft:Setback Geometry ' x:�esc i fiari,i:Miiri�Ctit;t.;'UV: �El+�v: .�"de�yths. Vet=.Ctnl� low Arga:=i"o 11 598 ': 1990-flood 22.0: 27.6 5:6 5:9 :•'::: ':101 5:.-: 3:0;4:,:.;• 11 1,059 100-yr Future 22.0 29.1. 7.1 7.1 155 6 43.9 11 870 FEMA 1996 22.0 28:6 6.7 6.5 137.2 36:8 10 598 21.4 26.7 5.4 6.3 94.5 •: 28.9 10 1,059 21.4 28.4. 7.0 7.3 151.1 42.1 10, ` 87.0 . 21.4 28.0 6.6 6.6 136:1. 36.7 ., 9 598 20:3 26.5 6.2 4.4 137.2 . 31:1 9 1,059 20.3 28.3 8:0 5.0 246.9 83.2. : 9 ., 870 ' . 20.3 . 27.8 •7.6 4.6 212.8 82.8 : 8 598 20.0 25.6 5.6 4.1 176.1 769 8 ' 1,059. 20.0 27.8 7.8 . 3.6 370.3 103:0 , 870 20.0 27.5 7.4 3.2 334.3 93.9 7 598 18.3 24.9_ .6.6 5.4 . . .136.0 36.6 7 1,059 18.3 27.5 9.1. 5.0 362.0 126.9 . , 7 .870 18.3 27.1. 8.8 4.6 318.3. 126:9.. 6.9 598 18.3 24.8 6.5. 5.5 ' :1.32,7 ._ 35.3 6.9 .1,059 18.3 . 27.4 9.1' 5.1. ' 354.0 126:9.. 6.9 870 ' . 18.3 '27.1 - ' .8.7 4.7 312.4 . 126:9. 6.8 ' ., ''Bridge: 6:75 598 18.4 24.0:. 5.6 4:7 137.7 . 42.1 6.75 1,059. 18.4 25:5 7.1. 6:1 219.5. .. .84.1 6.75 870 18.4 24.9 6.5 5.8 177.2' ' ' 78.5 . 6.7 598 , 18.4 24.0 5.6 4.2 160.7 ' 42:3 6.7 1,059 : ' 18.4 . 25.5 7.1 5.4 256.8 842 6.7 . 870 ' 18.4 _' 24.9 . 6.5' 5.1 208.8 80-3 6 598 '18A " 23.3 .4.9 5.7 122.8 51.0 6 1,059. ' 18.4 .25.0 6.6 ' 5.8 236.9 106.8. 6 870 .18.4. - 24.3 . . 5.9 5.9 174.2 . 54.8 5 . ' 598 ' ' 17:5 ' 22.6 5.0 4.7 144.5 . 48.7 5 1,059' ' 17.5 : 24.5 . 7.0 . 4:9 . 276.4 . . . 98.2 5 :.870 17.5 23.6 6.1 5.1 198:2 ,53:5: 4.4 598 15.3 21.9 . 6.6 5.8 132.7. . . 49.6'. 4.4 1,059 15:3' 24.2 8.8 5.6. 272.1 : ' 71.0.. 4.4 870 15.3 23.0 7.7 6.6: 188.0 70.3 4.35 598 15.3 21.8 6.5 . . '6.1 ' '127.0 49.1 ., I �:: .s. .:��Qi, ;� �g�, . ter.::'•;ix':e;-,,� ..' . 17:: Ri. a a:.:Greek t Rsacii•1 , „;�iEG`=R�►S,,,Plari'�P1art ..,. a r:''M . L�£. " . ��,... :.t�F'.�:� ..-... �:��;�a r ��• ;__ tax . ;; :. (��: `�:'�°_ � :.. Proposed.Conditions�•.A `r'edation� n = - 5•' o :1 i.:::: : ,.�.:tl:,.;.;' ' t .,,,, ,., gg a d'No:Mid+dle:l3r�aige;�:58!!-ft`sSetoack�G'e..metry 0�,,:�>.:�,�°", � . :,,� ''xl°'•,; y� �..- ' ice':. R' L.sy tq �Eb' .,i2.;:iii Sta" ::: otal \pescri`tlo•'-: M ri:Cl ':Ei, v -S EIeY �'De""th`' Vet„Gkinl' FIow Area '1'• 4 : rC•. ...,{c s}.:. . > .. :� ..N.. . .. .;..{f:t},. . :( ) ,,, , ,':{ } .. `1 (. }`._�:��. sgft Kam... ft 4.35 1,059 A.. . 15:3 '. 24:1 8:8 • '5:6:'.::;> `:<:.269"3 ':?_..::;;71 Q" 4:35.: " 870 15.3 22:9 ' ` 7:6 • 6.4 ,.:: .;.'18.5.1` 1; 586 •. ' j 0:0• . . 4.25 598 16.7 21.8 :5.1 5:6 1.27 1. : : . 45.8' 4.25 • 1,0:59 • 16,7' 241 7.4 5.4: ::;269 5 ,: 79.7 ; 1 4:25- 870 16,7 22.9' - , 6.2 5:9 181:1' : -.52.4 " .4.2 598 16.7 .21.7 5.1 5:7 124:1. 45.6 . ' -'4:2 ' 1,059 :1:6,7 -'' .24:1 7:4 5:5 , 267 2., '79.7 . . _ : : ':. .4:2 870 ,.16.7. :.: 22.9• . .6:2' 6.0 • : 178.7 .51.8 " :". . • : 0:0 "4. 598 17.5, 21.4 4.0 5.4 • 114.2 40.2.. • ". :'4• 1,059 17.5_ 23:9 6.5'. 4.8 273.2 93:5. 4 870 17.5 ' 22.6. 5.2 5.6 169.9 53.2'. ' : . .,3 ' • 598 16.3 , 21.1 ' 4.9 5.3 132:9 51..2 . '--I ' ' .3 ' 1,059 16.3 "23.8 • 7.5 . 5:1 284 4.. 70:3 3 -870 , 16.3. 22.4. ' 6.2 5.5 202.7. -.56.5:.,. j . 2.3.- 598 • 15:9 20:7 4.8 6:9 101.3` . 29:8 : . 2.3 • ' 1.;059 15.9 . : :23':1 ' 7.2 : 7:7: H •. :.188.7 ;.. `80'0 ' 1- i '','," , ':', ".•, ,2.3. 870 1'5,9: • '•,.. 21..8`:: : 5:9. 7:7 ''137:3 • :32.7 ; ':..2:25, ; 598 ' 15.9 , 20.7. " .4.8 ' 7.0 1002' `.:29:7.. , " 2.25' •. 1;059 15:9 :.23:1 7.2 .7.7 185.7 79.6." ' , •- 2,25 ' . ' 870 15.9 :: 21:,8' 5.9 7.7 13.63.: : .:32.7 2.2 • .Mutt Open ;- "2:15 '.598 15.9 _ 19.9 4.0 8.0 84.9 :31:.0 • ' 2;15 . 1,059 ^ • . 15.9 21.2 5.3' 9.8 124:6 ' '33.3:, ' , ' - ' 2:15. 870 v 15.9 : 20.6. 4.7 9.1 , 109.0 '32.4. ,` I. 2.1 ,: '598 15.9 19.5 3.6 .9.2 72.8 ' 30.3 --, '2.1" ' ' . . 1,059 '15.9 20.7 • 4:8 ' 11.1 110:4 ' .. 32.4 ' ' 2.1', ' : • . .870 15.9 .:20.2 4.3 10.5 95.6 31.6 1. 2 - 598 16.7 18.9 2.2 7.7 • 77.4 41.8 - j .2 ` 1,059 16.7. • '19.7 ' 3.0 9.2 1152 ' .44.0. ;' ' • 2 870 16.7 19.4'" ' 2.7 ' 8.7 100:5 43.1 ' !. . 1 '598 14.7 ' 16.9 :2.2 1.4 495.5 176.7 } . 1 1,059 14.7 '. '16.9 ' ' 2.2 ' 2.4 495.5. ' '. 176:7 ' ;; 1 870 14.7 16.9 2.2' 2.0 4'95:5 . 176.7 ' 1' -- . I S 'f HEC.RA$ Plan:=Plan 22: •River: Ma`'.Creek?aReacti l' .;: ' " Proposed Conditions;.Aggredation.and;Nri;MiddleBridge;100=ff.Riversta. . Q Trotal` ;Description, =Mari Cti`EI.°•:IN.S_..Etev t 'e fh ::Vet.Chnl .< -KO Ares :•yTop.W dth . . .... ..¢:�• •V ,a t'. :'••ii 'ate; ft 11 • 598 1990-flood• 22:0 27:6 5.6 5.9::`.>: 101:5 • '30ti4:.. 11. .1,059 ° 100-yr Future 22:0 29:1 .7.1 7:2 • :1.53.7 43:.2 .._:. 11 870 FEMA:1996 22:0' 28.6. 6.6 6.6 135:8 36:6 10 598 • 21.4 26.7 5.4 6.3 ' ` . 94:4 .: .. ., 28.91 1:0 1,059 . ' . 21.4 28:2 . .6.9 . 7.6 144:5 . 39:5 10 870 : 21:4 27:9 6:6 6:7 133.5 362 9 598 20.3 -.26.5 6:.2 4.4 137.1 31.1 9 1,059 20.3 28.0. 7.8 5.4 235.1 114.6 : .. 9 870 .- ' :20.3 27:8 :- .7.5 4.8 205.2 89 6 8 598 20.0 25.6 5.6 4.1 175.8 . 76:8 8 1,059 .20.0 27.6 7.6 3.6 412.6 146.0 8 870 20.0 27.4 7.4 3.2 382.4 : 142.6 7 598 . 18:3 24.9 6.6 5.4 135.7 . 36.5 7 1;059 18.3 . 27.3 : 9.0 4.5 440..9 175:9. . 7 870 18.3 27.2 8.8. 3.9 414:4 1769 6.9 598. 18.3` 24.8 6.5. 5.5 132:4 352 6.9 1,059 .18.3 27.3 ..8.9 4.5 433:6; : 17.6:9 6.9 870 18.3 27.1 8:8 4:0 40,9:0 176.9 6.8 Bridge 6.75 598 18.4 24.0 . 5.6 4.7 . 137.5 : 42.0 ' 6.75 1,059. . . 18.4 25.4 7.0 5.8 261.7 ' ' 134.1 6.75 870 . 18.4 24.9 6.5 . ' 5.7 197.3 .. .128.1 6.7 . 598 n 18.4 24.0 5.6 . 4.2 160.7 . .42.3 . 6.7 . 1,059 . 18:4 ' . 25.4 . . 7.0 5.2 298.8 .134.1 6.7 870 . . 18.4 24:9 6:5". 5.0 229.7. ' .129.7 6 . 598 18.4 23.3 . 4.9 5.7 ' 122.8. .. 51.0 6 1,059 18.4 24.9 6.5 5.9 ' . 243.4 156.5 6 870 18.4 24:3 ' . 5.9 . ' 6.0 . - 172.0 54.6. 5 598 . 17.5 22.6 • '5.0 . 4.7 144.5 . 48.7 5 ' 1.,059 ' 17.5 24.4 ' ' .6.8 5.0 291.6 ' 148.0 5 870 .17.5 23.6' 6.0 5.1 194.7 52.4 4.4 598 '15.3 21.9 6.6 . ' 5.8 132:7 ' ' 49.6 4.4 . 1,059 15.3 24.0 8.7 5.6 315.7 121.0.. 4.4 870 15.3 23.0 ' 7.6 6.4 187:4 .60.5 4.35 598 15.3 21.8 6.5 6.1' 127.0 49.1 py'Cr:001‹,•:3;:•:R4.**00,:.',1 lo)1:1Width :f.:1001,P 435 ' 1;059 • - .15.3 , 24:9'; 81 57 3100 1209* • 4.35 870. , 15.3 22:9 • 7.6 : *, 1655 1, 599 0.0' * . •• • - '., . : 4.25 .598' • * 151 - 21:8 5.6 . • 127:1 • * 45.8 • •• *• :4:25 1,059 -:• " 16:7, : 23.9 • *7:3 5.5 • , 299.5: 129.5. . • 425 . 870 15.7 22.9 : 6.2 5:9' 1812 52411. 4.2 598 . 16.7 '21.7* :5.1 .5.7 124.1. • 45:.6 1 4.2 1,059 . 16.7 239, I :7.2 : 5:5 „ 294:7- „ 1295 • ' 4.2 , 870 16.7. 22:9 '6.2 6.0 178.7 : . .5t8 „ •: . , - 4 598 ;*17.5 21,4 4.0 54 114.2 402 . 4 . 1,059 , 21,5 .63 • 50 • 277:4.* 143.0 :** 4 870 ' 17.5 22.6 :5.2 • 5.6 169.9:, • 532 *1‘ 3 598 16.3 211, 4.9 ' 5.3 132.9 51.2 3 1,059 • 153 - 23.6, 7.3 5.3 ,.2702 67.2 3 870 153 : 22:4' : 6.2 ': 5.5 202.7 56.5* • 2.3 598 15.9- 207 : 48 6.9, 1013 • 2914 • 23 1,059 15.9 229- -7.0! ;;:s 78 1755: " 458 2.3 870 ' 1.59 21859 7:-7 137.3: 1323 : . „ ••• , • • 2.25 *.'598 159 "*: •20.7 48 7.9 . • 199.2 29.7 , 2.25 • 4,059' : • 15.9; :22.9 7:9 • ; 174:7 45.1 . 2.25 870 • . . 15.9 • : 21.8- - :•5.9 ,7.7 139•:3 '• • 321 2.2 Mult Open • • 2.15 598 15.9 : 19.9 4.0 '8.0 • ' 84.9 :"31.0 2,15 1,059 „ 15.9" 212 5.3 9,8 124:6 :333 2.15 870 15.9 20.6 . 4.7 • 9.1 ' 1.09.0 • . 3.2.4 2.1. . 598 15.9 ' 19.5 : 3.6 9.2 72.9 - 30.3 2.1 1,059 *15.9 20.6 '4.7 11.2 1104 32.4 2.1 870 . 15.9 : 20.2 4.3, 10.5 *95.5 31.6 • '-' 2 598 16.7 18.9 2.2 *; 7.7 1 77.4. 41:8, 2 1,059 • 16.7 19.7 3.0 9.2 115.2. 44.0 2 870 16.7 ' 19:4 -• 2.7 .8.7 100.5. ,43.1 - 1 598 14.7 16.9 2.2 • .1.4 : 495.5 176.7 1 1,059 14.7 16.9 2.2 2.4 495:5 176.7 1 870 14.7 16.9 22 2.0 495.5 176.7 • • Attachment B Sediment Transport Analysis Support Documents • • • l ' I May Creek Surface Substrate MC-1A Grain Size (mm) 2048 1024 512 256 128 64 32 16 8 4 2 1.0 0.5 0.250 0.125 0.062 0.031 0.002 i Percent 0 0 0 0 _2 19 30 29 11 3 7 0 0 0 0 0 0 0 Cumm% 0 0 0 0 2 21 50 79 90 93 100 100 100 100 100 100 100 100 %Finney 100 100 100 100 98 79 50 21 10 7 0 0 0 0 . 0 0 0 0 r-=- May Creek Surface Substrate MC•1A ' 100 90 801.--- 70 d 60- u 50 ti a 40'--- - -- 30 29 30— — -- -- 20•. --- 1-1 10 : 0 0 0 0 2 - 3 7 0 0 0 ' F i . . F-_...-..- 2048 1024 512 256 128 64 32 16 8 4 2 1 0.5 Grain Size(mm) May Creek Surface Substrate MC-1A 100 I w s w w �� , . I f i 90 `- 80 ` I 1 i ! I i I i a. 40 — 30 _ 1 20 1 0 r 11 I w 'i 10000 1000 100 10 1 Grain Size(mm) 1 I i 1 ' r May Creek Subpavement MC-1B Sampie"Date: 9/27/01 1' Volume: „:1 :1 1 Grain Size Retained Cumm.% Percent , (mm) (ml)" Percent Retained. Finer I „ MatGreek" ,k Sutipav"eme ', `} 75 `0 . '0.0'. 0:0. 100.0 50- .900 ' 40,9 . 40:9 . • •59:1 ''25 . ".640 . 29.1 „70:0 30.0 • ,. 12.5 " 270 . .. 12:3 82.3 17.7 . :I - 9.5 80 . ':3:6:. 85.9, ' 14.1 f ` 6.3 55 "2.5 ' 88.4 11:6 j 3:35 . • 50 2.3 " 90.7 9:3 , 1.7., . 55 2.5: :, ..93.2 6.8 :.1 1 •,0.85 . 20 ::0.9 . . " 94.1 5:9 . 'i t ' ; .0A25 :: `. ' . ' 25 . `.1.1 - • 95:2 ". 4.8 5. 0.075 " 95 :4.3 '"99:5 : ' 0.5 . " Wash : . ..".0.01 10 : 0.5 '"100.0 0.0 i! sums. .2200 . ... : , May Creek Subpavement MC-1 B 45 4119 . 40` 35 0 . 3 29.1:" 526 k t `; a"20.,: 1.• j 15: : . " >4 ;'.: a• :'12:3 . yy - k" �I 99_ .0.5 ? 75 50 , 25 12.5 9.5 6.3 335 1.7 0.85 0.425.0.075 Wash Grain Size(mm) " 1 May Creek Subpavement MC-1B r •100 y: 90 g:, 80 , 70 LL 60 :.:I " ".50 § 40 a 30. i; 20. 10. ,;, -i- 0 --rr 100 10 1 0.1 0.01 Grain Size(mm)' I ;II ,11 if May Creek Sample MC-2 Sample Date: 4125103 Volume Grain Size Retained Cumm.% Percent (mm). (ml) Percent Retained Finer May Creek Sample MC- 2 1:7 0 0.0 0.0 100.0 0.85 21.49 0.9 0.9 99.1 0.425 , 429.36 18.2 19.1 80.9 0.3 826.64 35.1 54.2 45.8 0.21. 655.49 29.1 83.3 16.7 0.106 :345.51.. 14.7 97.9 2.1 0.063 29.24 1.2 99.2 0.8 Pan 0.01 19.59 0.8 100.0 0.0 sum .. ;. 2357.32 Pan May Creek Sample MC-2 40 _ 35.1 35 30 29.1 220 182 � t I 147 5 - 0.0 � � 1.2.. 0.8 1.7 0.85 0.425. 0:3 0.21 0.106 0.063 Pan Grain Size(mm) { May Creek Sample MC-2 100 � • 90 80 70 L 60 m 50 S 40 . a $0 20; 10 d 1 0.1 Pan Grain Size(mm) IF I i I I Y S } , May Creek Subpavement'MC-3 Sample Date: 5125/03 1 Grain Size Volume Cumm.% Percent (mmj", ., Retained(ml) Percent Retained Finer ' 1 May Look 1 Subpavement '- MC-3 ':75 : 0 0.0 0.0 100.0 ::50.< 110 3.5 3.5 96.5 ; 25 : '.'1030• 33.9 37.4 62.6 ' 12:5 >.- .: 610 19.5 56:9 43.1 3 /, 9:5 120 3.8 60.7 39:3 ;; 13 136 ". 4.2 64.9 35:1 f 13.5 ' ' .. ''220 7.0 71:9 . 28.1 1 _- i1'J ' 160 5:1 ". 77.0 23.0 , 0:85 200 6.4. 83.4 16.6 ?£ ' 0.425 .' 300 9:6 93.0 7.0 0:075 ' 205 6.5 99.5 .0.5 " ° Wash:, : 0:01 : .15 0.5 100.0 0.0 ig sum - . . ,3130 i.4 3, Cr I May Creek Subpavement MC-3 t': a 1 ;( - `33.9 • 35 d f--a yi 30 ,: , 25 -ii m .20; 195' IL 15 *q 4 ;;. ' 96 11 10. . . 70 51 64 65:: ,f 5 --. 3.5 '�' /4 - 4.2 g , 4 "0.5 4{ I 0.0 , :'`� 75 50 25 12.5 9.5 6.3 3.35 1.7 0.85' 0:425 0.075 Wash - :4 II Grain Size(mm) . , ' May Creek Subpavement MC-3 ;II I. 100 ,'"190 - - aa. 'd. LL 70. 60 •. 50 2 40: s Cl. . 30 . 20• 10` � :, 100 10 1 0.1 0.01 ..'; Grain Size(mm) 111 1 1 1 :t :Ei 1 1 it May Creek Surface Substrate MC-4 Grain Size (mm) 2048 1024 512 256 128 64 32 16 8 4 2 1.0 0.5 0.250 0.125 0.062 0.031 0.002 Percent 0 0 0 0 0 13 27 39 10 '4 7 00 0 0 0 0 0 Cumm% .0 0 0 0 0 13 40 80 89 93 100 100 100 .100 100 100 100' 100 %Firmer 100 100 100 100 100 87 60 20 11 7 0 0 0 0 -0 0 0 0 May Creek Surface Substrate MC-4 'loot 90 80 ; 70 c 60 P. 50 39 40 27 • 30 ; 20 13 ::'•• ' •• -"`' 10 , 10 ; 0 0 0 00 , -**- 1 • ' '.—: 4 _ 00 0 ' I I 2048 1024 512 256 128 64 32 16 8 4 2 1 0.5 Grain Size(mm) May Creek Surface Substrate MC-4 100 , is Is5 • 80 ": 70 ", 20 10 ". 10000 1000 100 ' 10' Grain Size(mm) , APPENDIX C Water Resources I I Barbee Mill Preliminary Plat Draft Environmental Impact Statement Appendix C Water Resources Prepared for City of Renton Renton,Washington Prepared by Parametrix 5808 Lake Washington Blvd.NE,Suite 200 Kirkland,Washington 98033-7350 (425)822-8880 www.parametrix.com August 2003 Project No. 554-1779-017 C. SURFACE WATER RESOURCES C.1 AFFECTED ENVIRONMENT This technical appendix addresses impacts of the proposed Barbee Mill Preliminary Plat located in the City of Renton adjacent to Lake Washington, at the mouth of May Creek,as indicated in Figure C-1. C.1.1 Studies and Coordination This section of the Draft EIS includes a discussion of existing streams and other waterways, hydrology, floodplains, and water quality. These analyses provide a basis for assessment of impacts on wildlife, aquatic resources, and endangered species. This section has been prepared based on review of existing data, a peer evaluation of the technical studies provided by the applicant, and qualitative evaluation of likely impacts. Proposed mitigation has been evaluated for the potential impacts identified. Surface Water Bodies May Creek The proposed alternative site lies at the western edge of the May Creek basin where May Creek discharges to Lake Washington (Figure C-1). The May Creek basin encompasses a 14-square-mile area located in King County, southeast of Lake Washington between the Cedar River, Coal Creek, and Issaquah Creek drainages. The basin lies primarily within unincorporated King County, but the western ti and southwestern portions of the basin(approximately 12 percent of the total area)are within the City of Renton (King County 1995). The May Creek watershed consists of residential, open space, agriculture, and commercial land uses(King County 2001). During the past several decades,the lower portions of the watershed have undergone intensive residential development while the upper two thirds of the watershed have retained a mix of rural residential, small farms,and some forest areas(King County 2001). Currently, the amount of effective impervious surface coverage within the basin is 7 percent. Under, current zoning, full build-out would result in an increase of effective impervious surface to 12 percent (King County 2001). Over the past several years, annual dredging at the mouth of May Creek in Lake Washington has been conducted by the Barbee Mill Company to remove bark debris from mill operations and to remove sediment transported from the upper reaches of May Creek. The lower reach of May Creek flows southward through the southern portion of the Barbee Mill site (Figure C-2). Much of the bank along both sides of May Creek within the Barbee Mill property is armored with riprap. The on-site portion of May Creek varies in width from approximately 10 to 20 feet. The stream channel is incised approximately 12 inches; hence the stream's ordinary high water mark (OHWM)is only slightly wider than the wetted width of the stream(Raedeke Associates,Inc.2002). — Lake Washington Lake Washington, the largest lake in King County and the second largest in the state, receives its main inflows from the Cedar and Sammamish rivers. Lake Washington drains approximately 472 square miles. The basin containing Lake Washington is a deep, narrow glacial trough with steeply sloping side slopes. The lake's average depth is approximately 108 feet with an average water volume of 2,350,000 acre-feet. Most of Lake Washington's surrounding watersheds are urban in nature; 63 percent of the watersheds are developed (DNR 1999). The lake connects to Puget Sound via Lake Union and the Lake Washington City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water ResourcesC-2August 2003 - - -- .--- 44 520 '''' ''''''_'''''''''''..:*''''','''''''''''''''',''‘,-',.,•.''''.c.. '''''Yl.......:'142$14:::.• ...................'..: ••.''''' 4''''..'..''I'''. '1)5...7'.,,,.jr..'''''' c S CATTLE .Lake, <Nasangtga B • ELtEVUE 405 90 • a. ERGER a: aa _ 90, 1 V` '' • - e-'4 ISLAND • • • • 8 3s �sK -• ,z, SLTE: v� -1., :t,A' r - u . s4 i �t £ sa 04k, ,, 'as ! a 4 eek • €s.- f . # . r2 „r ;-c`'_r"'wA ^r '. ,0aS2 , mom" gz s . '!. - .., IF.-_...47 op '� . ,y AID Y' -z.;-1,,,,,..1:': ''-'" .\r) . y .�• "j j R ,i4ToN ,' , °•C<a-,ash, kt1..:4 m aQgS 4�i• iihit. . • 11*169 s Date of map,October 1998 Parametrix City of Renton/554-1779-017/O1(14)6/03(K) Figure C-1 May Creek Basin l , o 1 _Miles Vicinity Map SYMBOLS \-:,-; PASSABLE r BARRIERS-IMPASSABLE ..' 'I .. 7,) \— • li01,< 1 z`c •:_ \, , *'/...4 4,;$ .,.! 7,,,*:t.'''S''47.. • * OM ''. "0.- sF011S 761- " 7 C i -2Lta_ Casco d et 1.„,, . ..'s • 3 ... ../ 4V* Bernier Dares't:.:.'.'• .• c 0 74 -, . 1 ''.,,^•.;.,:',,,L,.. :.-./ •..,.. :144 ..... .... ..,,_ ,,,,- ,..',----.1*--,-S- Lag Jams .•''.`•-•-.-. ..:,5.< , 1,rn:e...•;y4ga.,....• 1 , • .n.-,s,..-:.4,,---,;" 4.t.i.,-;,,-:,......,-.L,•,.,4,,,,, ,,,sf., fATA.J.J. -• . .04 *4 . ' :7 Dams . ,C116f4r-nM4. ia `94.6,‘ t'.:, i ' .-Q <- 1, ' 'iii4'44T ' 0 4` w '.t.- ailtf4.07);', imoi Salmon Hatchery . „A:,,,`.., , E ' il.f0 )44140(Pk )'°' i W ti c Ofiek;;'''''''n-1,0;' • ‹..;‹ Fish Passage Facility l ?: tk!1., :,. .'' , • 6- 7 2, „.....-... - ) 'Stream Gaga " ,'.:',•""t, -."=Vietll :t .. , (1..0.. , ,-',.,',;f:),i'•.rs•W.„ ;,''-,',W70,a,-".„:„".4, :1..S, ' ( :. 0- 44 i!l),') .(—LNI Vk . r' ) .% ka1 Srewn 'Mile e h. : 'V L\I )r..- . 1, , •••,-W(._„...„, r,1 CV ts,. • ' r<•,,A5,,v**. • '3 lleference Point . -‘'..,',,gr,o,•04 ,-- 041 s'11.41.4tka'N Aft, ' ..7i c) ::':,,,V.,&,,45-2•S WC: T'S Cil Coa i ' I 9, , .-,• l'• 9...';1057;1:',:1 -, SITE • . • r ..1-W,,:i'•• • ' take , uL.Fe.o.rizi.,' .4:,'.art.bef Nt ) !-- 4,t,f,.1i,:2-1j,r-A,'"*,-;:./ 1 • ?,,zir ?.,., re-dti(A% )fify c:F, \tz A • ' .0f9 . litari '1) i . -sm u, C? 1) P ,..,•r 7kIZ-- N4 0), • ., ,..„. ,rs,.......,, , 070.Z.4,01..Li*,,,:\ ,..A. (5 0,1 9,,,, C • c•,- , .4) ,s. , '...R .•4!,,...v.".is,', .1.', , ,..to•..-,‘ ...1, --,'A rS, h'''S'''''.*'',17Xg:•-11: l'..1. at, .r4',,),0.1;,,,w.t.:,.•,1„ .•...,',4,, ' - ... , t l' (..5 . ••• . I 1/2Q 1 miLE •• •/40.44.* el .e *4%4VA 0 3 A NV044 SCALE: 1"*.t. I MILE I:0 4,11,W.,44,444, 14,..,• ,-- , . ... 9•*.04.4.. t 4.7 0+ +6, 4.#444.* ', A )4.a4/$jil 4.4:44:4V,• ...:' Renton SOUTH ,,,„ .4%.,•):4./.4....,..,......" dg. ,k,+0,,4.er,*V•A•04 v.,11,• LAKE WASH I N G TO N * •I 4."44,44V.V••• ...+.0•••••• iv g.q.,,r fr f a My':..er,1,144.4",„*.•..S*4.4i444, ::•:',/ .. I e •tv, ......44,.... DRAINAGES syyy I te 04•••••••• ....,,......„,..— . , Source:Washington Department of Fisheries(1975)Washington Streams and Salmon Utilization map,Volume 1. Parametrix City of Renton/554-1779-017/01(14)6/03(K) fig‘N. Figure C-2 May Creek Location Vri and Stream Type Map _li Ship Canal. The Ship Canal provides the only discharge from Lake Sammamish and Lake Washington. Construction of the canal in 1916 lowered Lake Washington's water level by 9 feet to its present level. On-site Wetlands Two palustrine emergent, persistent (PEM1) wetlands were identified within the railroad right-of-way adjacent to the eastern property boundary (David Evans and Associates, Inc. 1997; Raedeke Associates, Inc. 2002). Small portions of the two wetlands (less than 1,000 square feet total) extend onto the Barbee Mill Property. Both wetlands are managed as lawns(Raedeke Associates,Inc. 2002). Classification of Water Bodies May Creek May Creek is identified as tributary #0282 in WRIA 08. May Creek originates from the outlet of Lake Kathleen and flows westerly 8.6 miles to Lake Washington (Williams et al. 1975). May Creek flows approximately 1,000 feet from I-405 in a southwesterly direction through the Barbee Mill site and outlets into Lake Washington near the south end of the site. The portion of May Creek located on the Barbee Mill site is classified as a Type 1 stream (DNR 2002, Figure C-2), based on its size and anadromous fish use. King County classifies streams under three different categories. Class 1 streams are those that have been inventoried as Shorelines of the State under King County's Shoreline Master Program. Class 2 streams are smaller than Class 1 streams, and either flow year-round under periods of normal rainfall or are used by salmonids. Unlike Class 1 and 2 streams, Class 3 streams are intermittent or temporary during years of normal rainfall and are not used by salmonids(King County 1991). Lake Washington The project site lies along approximately 1,700 feet of Lake Washington shoreline. The Lake Washington Basin, known as WIRA 08, is comprised of waters funneling into Lake Washington and hence through Lake Union and the Lake Washington Ship Canal to Puget Sound at Shilshole Bay (Williams et al. 1975). On-site Wetlands The two small portions of wetlands located on the Barbee Mill site have been highly disturbed by human activities and meet criteria for a City of Renton Category 3 rating(Raedeke Associates,Inc.2002). Water Quality Classifications May Creek The water quality classifications of the tributaries located on site, as well as those downstream receiving waters, determine the nature and severity of the potential impacts and the type of on-site water quality treatment measures necessary to mitigate the potential impacts. May Creek is listed as a Class AA (extraordinary) water under State Water Quality Standards WAC Chapter 173-201A. Water quality of Class AA waters markedly and uniformly exceeds the requirements for all or substantially all uses. The uses of Class AA waters listed under WAC 173-201A include domestic, industrial, and agricultural water supply. Also, these waters provide migration, rearing, spawning, and harvesting habitat for salmonids, clams, oysters,mussels, crustaceans, and other shellfish(e.g., crabs, shrimp, crayfish, scallops), as well as City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-5 August 2003 wildlife habitat. In addition, these waters provide recreation (primary contact recreation, sport fishing, boating, and aesthetic enjoyment), commerce, and navigation. Any water listed as Class AA must meet certain water quality criteria for fecal coliform bacteria; dissolved oxygen; total dissolved gas; temperature; pH; turbidity; toxic, radioactive, or deleterious materials; and aesthetic values set forth in WAC 173-201A(MRSC 1997). Lake Washington Lake Washington is listed as Lake Class under State Water Quality Standards(WAC Chapter 173-201A). Water quality of Lake Class waters should meet or exceed the requirements for all or substantially all uses. The uses of Lake Class waters listed under WAC 173-201A include domestic, industrial, and agricultural water supply. Also,these waters provide migration,rearing, spawning,and harvesting habitat for salmonids, clams, oysters, mussels, crustaceans, and other shellfish (e.g., crabs, shrimp, crayfish, scallops), as well as wildlife habitat. In addition, these waters provide recreation (primary contact recreation, sport fishing, boating, and aesthetic enjoyment), commerce, and navigation. Any water listed as Lake Class must meet certain water quality criteria for fecal coliform bacteria; dissolved oxygen; total dissolved gas; temperature; pH; turbidity; toxic, radioactive, or deleterious materials; nutrients, and aesthetic values set forth in WAC 173-201A(MRSC 1997). Lake Washington serves as a valuable natural resource to all King County residents. On the whole, the lake's water quality is extraordinary for a large lake surrounded by urban developments. It offers good rearing habitat for juvenile salmon and other wildlife, provides multiple recreational opportunities, supports varieties of resident fisheries, and acts as a beautiful focal point for the surrounding communities (DNR 1999). Although the water quality of Lake Washington is considered very good, natural runs of Lake Washington sockeye, coho, and chinook salmon, and steelhead trout appear to be declining, however. The reasons for these declines are still not fully understood(DNR 1998). Clean Water Act Listing The section of May Creek lying within and adjacent to the Barbee Mill site is listed by Washington State as being impaired in the 1998 listing under Section 303(d) of the Clean Water Act for zinc, copper, lead, and fecal coliform bacteria (www.ecy.wa.gov/programs/wq/links/impaired wtrs.html) and www.ecy.wa.gov/services/gis/maps/wria/303d/w8a-303d.pdf). Specific information on the 303(d) listings include: • Zinc is listed based on two excursions beyond the criterion collected by King County Surface Water Management(KCSWM)at the mouth of May Creek at Lake Washington in 1994. • Copper is listed based on one excursion beyond the criterion collected by KCSWM at the mouth of May Creek at Lake Washington in 1994. • Lead is listed based on three excursions beyond the criterion collected by KCSWM at the mouth of May Creek at Lake Washington in 1994. • Fecal coliform is listed based on 27 excursions beyond the upper criterion out of 92 samples (29 percent) collected at King County station 0440 (May Creek River Mile 0.1) between January 1991 and April 1997. Identified Management Strategies The May Creek Basin Action Plan(King County 2001) (hereafter referred to as the Action Plan) outlines an action plan for correcting adverse conditions in the May Creek basin. It provides a set of actions to: 1) reduce the threat of flooding to homes; 2) make infrastructure improvements that will facilitate storm City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-6 August 2003 flow conveyance, stabilize stream banks, and reduce erosion; 3) protect and enhance fish and wildlife habitat and water quality in the basin; and 4) take reasonable steps to prevent existing problems from becoming worse in the future. Primary basin-wide recommendations contained in the Action Plan include: - • Establish and enforce requirements for runoff retention/detention, forest retention, and water qualities facilities for site development. • Develop basin stewardship and community coordination and participation through creation of a May Creek Basin Steward. • Establish a monitoring program to determine the effectiveness of implemented actions. The Barbee Mill site is contained within the regional subarea identified in the Action Plan as the Lower Basin Subarea,which extends from the mouth of May Creek at Lake Washington upstream to River Mile 3.9, above the Coal Creek Parkway S.E. crossing. Primary recommendations for the Lower Basin Subarea specific to the Barbee Mill site area include Recommendation No. 10: Facilitate Permitting for _ May Creek Delta Dredging. The Action Plan notes that sediment deposition occurs naturally in the May Creek delta, and that increases in erosive storm flows associated with basin clearing and land development have increased the need for dredging to allow the mill to continue its commercial operations. Dredging was estimated to be approximately 2,000 cubic yards per year. Dredging will have to be undertaken more frequently in the future to maintain adequate access for the mill operation, particularly - as a result of increased sediment transport as further development occurs in the basin. Furthermore,the Action Plan notes: "In the event that the mill property on the May Creek delta redevelops in the future, opportunities to enhance May Creek habitat and reduce the need for maintenance dredging should be explored. Although a feasibility study of this option has not been undertaken, it is possible that modifying the May Creek channel could reduce the need for maintenance dredging and provide a unique opportunity to establish an improved habitat area within the lakeshore commercial area, allowing the realization of environmental and economic benefits. Any major redevelopment project also should consider opportunities for acquisition and restoration/preservation of riparian lands adjacent to the May Creek Park system. Until funding for such a project becomes available, continued dredging is the only viable alternative for maintaining commercial operations at the mill. Such dredging has no downstream impacts, and the impacts on channel habitat are localized and minimal. This recommendation recognizes the need for dredging to continue until a long-term solution can be identified and funded, and that even a long-term solution likely will include some need for ongoing maintenance dredging." C.1.2 Existing Drainage Impervious Surface Areas Under current conditions, approximately 85 percent of the Barbee Mill site is covered by impervious surface in the form of pavement and various buildings associated with the mill operations (Raedeke +r Associates,'Inc.2002). Mill facilities and pavement extend to the shore of Lake Washington. An existing bulkhead extends along the majority of the Lake Washington shoreline owned by the Barbee Mill. A dock extends approximately 50 feet into Lake Washington from the shore midway between the northern property boundary and the mouth of May Creek. Numerous pilings and log booms associated with the City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-7 August 2003 mill extend from the shore for several hundred feet out into Lake Washington (Raedeke Associates, Inc. 2002). Three bridges cross the on-site portion of May Creek. The southernmost of the three bridges is a single lane wooden structure located at the mouth of May Creek. The bridge provides vehicular access to southern portions of the mill. The middle bridge is a narrow foot-traffic only wooden structure located approximately 200-feet upstream from the mouth of May Creek. The northernmost bridge is a two lane concrete structure that provides the primary access for the mill(Raedeke Associates,Inc.2002). Conveyance and Stormwater Discharge The Barbee Mill site consists of three stormwater collection areas and outfalls associated with the industrial activities, and non-point discharge drainage areas not associated with industrial activities(Loyd and Associates 2003). The following outfall drainage information is based on information contained in the Barbee Mill Stormwater Pollution Prevention Plan(SWPPP)(Loyd and Associates 2003). North Outfall The north outfall discharges stormwater collected from the north side of the Barbee Mill site. The north outfall drains approximately 40 percent of the facility's industrial activity area, which primarily contains pavement and storage buildings. With the exception of minor amounts of lubricants, no chemical usage occurs in the northern portion of the site. A petroleum product storage area is located within this area; however,this storage area is covered and bermed. A wash area is located near the east side of the facility north of the dry kiln. The wash area drains to an oil/water separator that is not connected to the storm drain system. The north outfall does not have an oil/water separator at the terminus of the storm drain system at Lake Washington, although numerous catch basins exist within the storm drain system that provide for settling of potential windblown dust and debris. Because the entire north outfall drainage area is paved, and industrial activity is minimal in this area, there is very little accumulation of dirt or debris in the catch basins. Middle Outfall The middle outfall discharges stormwater collected from the central portion of the facility near the sawmill. The middle outfall drains less than approximately 10 percent of the facility's industrial activity area. This outfall has an oil/water separator to trap residual hydraulic oil or other petroleum product (principally lubricants) from the sawmill area. Because the sawmill operates on an infrequent basis, the potential is small for oil and grease from heavy equipment to enter the storm drain system. The storm drains, catch basins, and the oil/water separator are cleaned periodically to maintain flow and to minimize the potential for oily residues to reach Lake Washington. South Ou fall The south outfall discharges stormwater from southern portions of the site. When the sawmill is operating, this area may have considerable activity. The south outfall drains approximately 50 percent of the facility's industrial activity area. The storm drain system consists of a series of catch basins and lines terminating at an oil/water separator at the south outfall adjacent to Lake Washington. The catch basins, storm drains, and the oil/water separator are periodically cleaned to assure that the stormwater collection system is operating properly. Because the sawmill is operated on an infrequent basis,the primary activity City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-8 August 2003 occurring in this area is the temporary storage of bark and wood debris derived from dredging in Lake Washington. Non-Point Drainage Areas Portions of the site are not involved with industrial activity and are non-point drainage areas (Loyd and Associates 2003). These include the southern portions of the facility adjacent to the east shoreline of May Creek, and primarily consist of facility offices and an employee parking lot. There is no industrial activity associated with the May Creek corridor. Wetlands The northernmost of the two wetlands on the Barbee Mill site, drains via a ditch that connects the northern portion of the wetland to May Creek. The southerly wetland seeps into ditch that connects to an _ approximately 150-foot-long storm drain pipe that flows to Lake Washington (Raedeke Associates, Inc. 2002). See Section 3.4 and Appendix D. Adjacent Upstream Drainage A drainage basin located in the neighborhood near North 40th Street between I-405 and the BNSF railroad drains towards the Barbee Mill site. Under existing conditions, stormwater is conveyed in a southerly direction along the east side of the railway where it flows through a crossing 24-inch diameter concrete pipe to the west side of the railway embankment. It daylights into a surface ditch that is approximately 4 feet wide and 1 foot deep, then enters a 15-inch diameter drain line which carries the water across the Barbee Mill site and discharges to Lake Washington(Otak,Inc.2002). C.2 IMPACTS C.2.1 Impacts of the Proposed Alternative The proposed alternative involves removing the existing Barbee Mill Company facilities, including all buildings, asphalt surfaces, and other associated structures. The proposed Barbee Mill Preliminary Plat would include the construction of 13.07 acres of new impervious areas and 5.74 acres of new pervious areas for a total of 18.81 acres of developed area on the 22.9-acre site. New impervious surfaces would include rooftops, driveways, walkways, and stormwater facilities. The proposed project would reduce existing impervious surface coverage on the site from approximately 85 percent down to about 57 percent (Raedeke Associates, Inc. 2002). This would be accomplished through the removal of existing asphalt and concrete surfaces and mill structures. New pervious areas would include residential yards, and setbacks from Lake Washington and May Creek. The development of the site will be governed by the RMC and the COR2 zoning which is designated for this property(Otak,Inc. 2002). The site plan includes 24 shoreline lots adjacent to Lake Washington and 40 lots adjacent to May Creek. The project proposes that all residential structures to be constructed along the Lake Washington shoreline would maintain.a 25-foot setback, as required by the City of Renton (1998) Shoreline Master Program. The project also proposes an average buffer of greater than 50 feet for May Creek that would range from a minimum width of about 20 feet at the Tract F roadway to a maximum width of approximately 100 feet. Setbacks from May Creek would be planted with native species to provide forest cover for the stream (Raedeke Associates,Inc.2002). A new local access bridge would be constructed over May Creek and would require the removal of an existing middle bridge. Installation of new foundations for the proposed bridge would be necessary and is City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-9 August 2003 presumed to include no work within the OHWM of May Creek. The new bridge would be approximately 42-feet wide and include sidewalks. One of the other existing bridges would be retained and converted to foot-traffic-only use. Stormwater Discharge Unmitigated development can substantially alter a natural hydrologic system. Typically, the most apparent hydrologic and hydraulic impacts are related to removal of vegetation,compaction or removal of soils, and increases in impervious surface areas, such as buildings, streets, parking lots, driveways, and sidewalks. These changes can result in increases in the volume, velocity, frequency, and duration of stormwater runoff. Changes in the hydrologic regime can result in increased flooding and frequency and duration of high stream flows, leading to erosion, channel scouring, and loss of hydraulic complexity. In addition, less stormwater may infiltrate,resulting in a decrease of groundwater recharge. The proposal would result in a reduction in impervious surface area,which should reduce stormwater run- off velocities and volumes from the site to May Creek and Lake Washington. This could lead to more stable flow regimes and decreases in peak flows during storm events (Schueler 1994). Scouring of the - May Creek streambed could be less likely to occur and could lead to an increase in stream habitat complexity (Schueler 1994). In addition, reduction in impervious surface area could increase the amount of stormwater infiltrating to groundwater at the site. As previously discussed,the drainage basin located in the neighborhood near North 40th Street between I- 405 and the BNSF railroad drains towards and across the Barbee Mill site. Under developed conditions, this bypass line is to be redesigned so that it has capacity to convey runoff from the developed, offsite basin. The line's outfall location will remain the same for existing and developed conditions (Otak, Inc. 2002). Impacts to Water Quality Degradation of surface water quality can result from new development when increases in stormwater pollutants, such as associated with runoff from roads and parking lots, or increases in erosion and sediment transport due to uncontrolled runoff, result in higher discharges of contaminants to sensitive receiving waters, such as lakes, streams, and wetlands. If not properly mitigated, potential stormwater pollutants from a developed site can include oil and greases, nutrients (e.g., nitrogen and phosphorus), toxic organics (e.g., pesticides and polynuclear aromatic hydrocarbons), metals, and suspended solids (particulates). In addition, long detention periods in stormwater detention ponds and water quality treatment ponds can increase water temperatures through sun exposure. Water quality treatment for the proposed alternative is required under King County Storm Water Drainage Manual (KCSWDM) Core Requirement No. 8 (King County 1998). Under proposed conditions, stormwater would be routed to stormwater treatment facilities before being discharged to Lake Washington. The proposed stormwater treatment facilities are described in Section 3.2.3, Mitigation Measures. Proposed treatment of stormwater would be an improvement over current conditions for the site as sediments and pollutant loads to Lake Washington would likely be reduced. In addition, the proposed reduction in impervious surface area (relative to existing conditions), and the proposed May Creek buffers,which would be restored to pervious conditions and would be enhanced with supplemental plantings of native vegetation to restore the proposed buffer to a forested condition,would likely result in an overall beneficial effect due to water quality improvements(Raedeke Associates,Inc.2002). Floodplains and Flooding See Appendix B. City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-10 August 2003 Maintenance Activity Impacts Landscape maintenance could include use of fertilizers,pesticides, and/or herbicides. If used,these could potentially affect biological activity in receiving waters if not removed by water quality treatment or otherwise mitigated. In addition, sediment removal from water quality treatment ponds could result in increased turbidity in stormwater discharges, particularly if the maintenance were performed during wet periods. Construction Water Quality Impacts Demolition and earthwork for the project would involve removal of all existing buildings located on the property, removal of asphalt, excavation, and backfill for utilities and water quality ponds, and grading --, for road construction. Infrastructure construction would include approximately 38,000 cubic yards of fill for road and lot construction and 32,000 cubic yards of excavation from the water quality ponds and underground pipes. Large earthmoving equipment probably would be used on site to clear the property. Soil excavation, grading, and removal of vegetation during construction can expose soil that potentially ti could be eroded and transported with stormwater runoff. Removal of topsoil and compaction can decrease stormwater interception and infiltration, which can increase rates of surface water runoff. On- , site use and maintenance of construction equipment, construction staging areas, storage and use of chemical products, and on-site wastes generated during construction activities can produce pollutants, including petrochemicals (e.g., oils, gasoline, and degreasers), concrete products, sealers, and paints, and wash water associated with these products. If not properly mitigated, surface waters can be impacted by the construction-related sediments and other pollutants. C.2.2 Impacts of the Continued Industrial Use Alternative Impacts associated with the continued industrial use alternative were assumed to be similar to current site conditions since the existing structures would remain, as would all existing impervious surface on the site. If triggered by new construction, appropriate mitigation measures conforming to applicable local, county, and state guidelines would be required. C.3 MITIGATION C.3.1 Operational Impact Mitigation Site Hydrology Detention ponds are not required for the project because the site qualifies for the Direct Discharge Exemption in the 1998 KCSWDM (King County 1998); however, water quality treatment is required under KCSWDM Core Requirement No. 8—Water Quality(King County 1998). Table C-1 summarizes the design basis for the proposed alternative(Otak Inc.2002). City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-11 August 2003 Table C-1. Basis for Stormwater Design (Otak, Inc.2002) Water Quality Pond Capacity Required Provided Treatment Design Standard Device Design Criteria (cubic feet) (cubic feet) Runoff Control KCSWDM1 NA Lake Washington 0 0 Direct Discharge Exemption Runoff Treatment Basic Basic Three Times Runoff Pond No. 1 Pond No. 1 56,902 Wetpond From Mean Annual 48,811 Pond No. 2 Storm Pond No. 2 11,026 9,523 1 1998 King County Storm Water Drainage Manual 2 Direct Discharge Exemption—Core Requirement No. 3: Flow Control The proposed alternative would reduce the amount of impervious surface relative to the existing condition, which should decrease surface runoff and increase stormwater infiltration and groundwater recharge. Decreasing the amount and/or the effect of the proposed alternative's impervious surface could potentially be enhanced by the following methods: • The use of porous(pervious)pavements on driveways,parking areas, and/or sidewalks; • The use of tree and brush cover in proposed parking lot landscaping areas to provide additional interception of rainwater; and • Infiltration of roof drain discharges. Stormwater Discharge The proposed stormwater drainage system (Figure C-3) is sized to convey the 100-year, 24-hour storm with the water quality ponds in their overflow conditions. Operation and maintenance of the proposed stormwater drainage system would be designed to conform to City of Renton and KCSWDM requirements. If mitigation measures were properly implemented and maintained, adverse stormwater discharge impacts would not be expected. The following brief description of the proposed conveyance system is based on the Technical Information Report for the Barbee Mill Preliminary Plat (TIR) (Otak, Inc. 2002). Appendix D of the TIR provides the preliminary calculations showing that the storm water conveyance system meets the 1998 KCSWDM Section 4 Stormwater Conveyance Standards. Storm Drains to the Water Quality Pond WQI Three storm drain lines (Lines 1, 2, and 3) would collect flow from the area north of May Creek. The pipes were designed to convey the 100-year flow rate without overtopping the rims. The 100-year design flow rates at selected catch basins were determined by using the Rational Method. The King County Backwater model (KCBW) was then applied to the storm drain lines extending upstream from Water Quality Pond WQ1 to catch basins D, G, and J. The backwater elevation during overflow operation in Water Quality Pond WQ1 was assumed to be 21.5 feet, 0.5 foot above the water quality surface elevation. Storm Drains to the Water Quality Pond WQ2 One 18-inch trunk line(Line 4)would serve the area south of May Creek. Water surface elevations were determined at selected catch basins using the KCBW program. The tailwater at Water Quality Pond WQ2 during overflow condition was assumed to be 20.5 feet. The preliminary conveyance calculations are provided in Appendix D of the TIR for the Barbee Mill Preliminary Plat(Otak,Inc.2002). City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-12 August 2003 Discharge to Lake Washington ' Following water quality treatment, water from each of the two water quality treatment ponds would be discharged directly to Lake Washington through separate 18-inch diameter pipes (Figure C-3). The discharge pipes would outfall to an invert elevation approximately 0.5 foot below the mean-lower-low- water (MLLW) for Lake Washington (Raedeke Associates, Inc. 2002). Discharge rates for the larger of the two ponds would range from approximately 2.5 cfs during the 6-month, 24-hour storm to approximately 8.0 cfs during the 100-year, 24-hour storm, and water velocity at the pipe outlet would range from approximately 1.4 feet per second during the 6-month/24-hour storm to approximately 4.5 feet per second during the 100-year, 24-hour storm (Raedeke Associates, Inc. 2002). Discharge rates for the smaller pond would range from approximately 1.6 cfs during the 6-month, 24-hour storm to approximately 5.0 cfs during the 100-year, 24-hour storm, and water velocity at the pipe outlet would range from approximately 0.9 foot per second during the 6-month, 24-hour storm to approximately 2.8 feet per second during the 100-year,24-hour storm(Raedeke Associates,Inc. 2002). Adjacent Upstream Drainage An existing bypass storm drain line would be removed and replaced with another line that would have a capacity adequate to serve the developed offsite basin in the North 40th Street neighborhood between I-405 and the BNSF railroad. The preliminary conveyance calculations are provided in Appendix E of the TIR for the Barbee Mill Preliminary Plat(Otak,Inc. 2002). Mitigation for Water Quality KCSWDM Core Requirement No. 8—Water Quality requires that runoff from pollution generating surfaces be treated (King County 1998). The water quality treatment is necessary because more than 5,000 square feet of pollution-generating impervious surface area would be created at the site. The proposed design includes two water quality ponds to treat runoff before discharging it to Lake Washington(see Figure C-3). Operation and maintenance of the proposed water quality treatment facilities would have to conform to City of Renton and 1988 KCSWDM requirements. If mitigation measures were properly implemented and maintained, adverse water quality impacts would not be expected. The following, which briefly describes the proposed water quality treatment, is based on the TIR for the Barbee Mill Preliminary Plat (Otak, Inc. 2002). The drainage area north of May Creek would drain to Water Quality Pond WQ1. The area would include the residential area consisting of approximately 4.54 impervious acres and 4.92 pervious acres (Table C- 2). It would also include Streets E and F, which connect the site to Ripley Lane. These streets have a drainage area of approximately 0.89 impervious acre. Approximately 48,811 cubic feet of wetpond volume is required per 1988 KCSWDM Section 6.4.1. The elevation for the top of sediment storage would be 19.0 feet, and the design water quality surface elevation would be 21.0 feet. Calculations for the water quality volumes are contained in Appendix C of the TIR for the Barbee Mill Preliminary Plat (Otak, Inc. 2002). The measured volume for the preliminary WQ1 pond design is approximately 55,900 cubic feet. Following water quality treatment, water would discharge directly to Lake Washington (see Figure C-3). City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-13 August 2003 / ff ,r j,,,,,,,,,(*.?V it _ �..._.........._..V _`. _h\. It 'k .--•-• 'Ait /' Vii h ' ''/7/1 / II a/ I— � - o I I I r- —1 71—►r 1 �_ /.� hwy. ' rlm �1��1-I 4 -,,_, „7/__-,,.. i1—II-1" I II . ��I,I I I - f i 1 LiL_ JL / //� , „in A ( 7- r . 7/// ////, 'x '21-7' / ‘sL,:\ki AV° "lit "j'7/, , r 1-s„, ':, Ill,'" ------,,->,---„,,.------\ \/ P 4 ' i1. /LL \ — /7/// '/ / , / ‘dlik \\! \\ '1 ti` r")),,_., • / 1.!,..*' .-\k\ ' , /WI,-r,..-, / gym - / , � fir.✓ /\� /�' /�� ' / • Oak\ pr < . .',) ,, \- V' P.' / / ' 0000&, _ _,4 71 \ .\\. \ ,,,,,,,... /2/7, /1; 7 — 1 f' ,/\ i; , ,,,,,,,,:---,--;-cori /i , ti'.7 I— .‘ \ '' Irt 4 • r / (y LAKE ;,.r '• �`y 1 {,J, � fli.r' � jgf` Ar WASHINGTON • ; • ` 40 I 1 • ,,,,#11 , \r/ ,,,a ,.1/ pr 1 .ri,- t .•/17j,///17//,t -- / 7-/-' :f?,// / I 'k':\ V ,;f74444.44;<4;44t--7' // / , „,\ ,, 4 ,/ ,41,,..,4,, 1:::,,,n.. . - ,l,• / :J`�r o /4ito Abp,44,1 A / \\ • ---:-..-r--„4,7;-5- ,,,.( AW -- A, ,.• -,' \ (*. y; w ` 'el' / MAY CREEK �� . DELTA + i � �k\ 4 _.. • O 1 & r[ � 'V '"� �V t LEGEND L ._ '. s r. =- r, .. ,�__— _. — Flow path .'__.�.._ ____ 41 :,. �L#/ f' -- ^,/,_ x... 1-N 40TH ST Basin boon dar Source: Otak Basins,Subbasins and Site Characteristics Map,Figure 3 Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-2-04 Figure C-3 SCALE IN FEET erAk Proposed Water Quality Treatment and Stromwater Drainage System n 100 2I o W Barbee Mill Preliminary Plat Table C-2. Contributing Areas for Water Quality Pond No. 1 Developed Area Impervious Pervious Total Land Use [Acres] [Acres] [Acres] Residential Lots 4.92 4.54 9.47 Water Quality Pond Tracts 0.36 0.99 1.35 Onsite Roadway 2.89 0.00 2.89 Offsite Roadway 0.89 0.00 0.89 Total Area WQ1 9.06 5.53 14.60 Source: Otak,Inc. 2002 The area south of May Creek would drain to smaller Water Quality Pond WQ2. The area would include residential areas, streets, and an access road to Lake Washington Boulevard North for a total drainage area of approximately 2.20 acres, 1.87 acres of which would be impervious (Table C-3). The required water quality volume for this drainage area would be 9,036 cubic feet. The pond shown on the plan sets would have a water quality volume of approximately 11,026 cubic feet if the water quality surface elevation were set at approximately 20.0 feet. Following water quality treatment, water would discharge r directly to Lake Washington(see Figure C-3). I Table C-3. Contributing Areas for Water Quality Pond No. 2 Developed Area Impervious Pervious Total Land Use [Acres] [Acres] [Acres] Residential Lots 1.07 0.27 1.34 Water Quality Pond Tract 0.03 0.08 0.11 Onsite Roadway 0.75 0.00 0.75 Offsite Roadway 0.12 0.00 0.12 Total Area WQ2 1.97 0.35 2.32 Total Area WQ1 and WQ2 11.03 5.88 16.92 Source: Otak,Inc. 2002 The possible increased temperatures of stormwater discharged from the water quality treatment ponds during summer months could be mitigated with dense bank cover around the edges of the proposed ponds. Mitigation for Maintenance Activity The water quality ponds would be privately maintained and would require preparation of an operations and maintenance manual for the final design (Otak, Inc. 2002). Maintenance would have to conform to City of Renton and 1988 KCSWDM requirements. Guidelines provided in the operation and maintenance manual should be implemented once operations begin and should be updated, as needed, on an ongoing basis. Impacts caused by sediment removal from the proposed water quality treatment ponds could be decreased if the maintenance activity were scheduled during periods of little or no rain. Impacts from the possible use of pesticides for landscape maintenance could be reduced or avoided with an Integrated Pest Management Plan, as described in the Ecology Stormwater Manual(Ecology 2001). This source control BMP outlines control of fertilizer and pesticide application, soil erosion, and site debris and includes the City of Renton 554-1779-017 Barbee Mill EIS-Appendix C-Water Resources C-1 S August 2003 use of pesticides/herbicides only as a last resort. Measures listed as part of this BMP include the following: • Installation of engineered soil/landscape systems to improve the infiltration and regulation of stormwater in landscaped areas; • Prevention of disposing of collected vegetation into waterways or storm drainage systems; • The practice of mulch-mowing; and • Disposal of grass clippings, leaves, sticks, or other collected vegetation by composting, if feasible. Use of the above BMPs would reduce and/or eliminate the need for pesticides, herbicides, and fertilizers, and,therefore,would reduce the potential for pollution to stormwater runoff. If mitigation measures were properly implemented and maintained, adverse impacts from project-related maintenance activities would not be expected. C.3.2 Construction Impact Mitigation BMPs for sediment control should be implemented according to the standards specifically outlined in 1998 KCSWDM, Appendix D. Impacts resulting from project related construction activities would be minimized through implementation of an appropriate SWPPP, including an approved Temporary Erosion and Sediment Control (TESC)Plan. If mitigation measures were properly implemented, adverse impacts from project-related construction activities would not be expected. The SWPPP should provide a careful assessment of the risk to May Creek and Lake Washington. The risk assessment would integrate site- related elements, such as slope, soil types, geotechnical stability, groundwater, off-site sources of water flowing into the construction area, and proximity of site stormwater discharge to critical areas. Specific elements of the SWPPP should include the following measures(Raedeke Associates,Inc. 2002): • Delineate and Mark Clearing Limits: Before clearing or disturbing, the limits should be marked. This element is one of the first steps in most normal construction plans. • Establish Construction Access: All erosion control plans should install a stabilized construction entrance (or other method of preventing sediment transport onto the roads). If a standard gravel construction entrance is proposed, geo-textile fabric should be installed under the rock. A wheel wash would be required for plans that propose winter grading. • Detain Flows: Based on a downstream analysis it may be necessary to detain runoff from a site under construction. A detention pond may be needed to construct and use to control flows during construction. • Install Sediment Controls: If runoff from the construction site occurred, sediment should be removed from the water. The water quality standards would have to be met. • Stabilize Soils: All exposed and non-worked soil should be stabilized by use of BMPs. Time periods of allowed exposure would depend on the season. Both temporary and permanent groundcover would part of the construction plans. • Protect Slopes: Cut and fill slopes would be protected from erosive flows and concentrated flows until permanent cover and drainage conveyance systems were in place. • Protect Drain Inlets: All storm drain inlets would require protection from sediment and silt laden water. City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-16 August 2003 • Stabilize Channels and Outlets: Temporary and permanent conveyance systems would be stabilized to prevent erosion during and after construction. Culvert outlets would require protection. • Control Pollutants: The plan would indicate how all pollutants, including waste materials and demolition debris, would be handled. This would include maintenance of construction equipment,fertilizers, application of chemicals, and water treatment systems. • Control Dewatering: The water from dewatering systems for trenches, vaults, and foundations would be discharged into a controlled system. • Maintain BMPs: The plan would provide for inspection and maintenance of the planned and installed construction BMPs, as well as their removal at the end of the project. • Manage the Project: The plan would outline how the site would be managed for erosion control. It would cover phasing, training, pre-construction conference, coordination with utilities and contractors, monitoring, and reporting. It would provide for notice of problems, revisions during construction, and contingency planning. One of the most important elements in project management is planning for contingencies based on the risk of exposure during phases of the development. Ongoing planning throughout the life of the project would be essential. Some specific BMPs recommended for this project are as follows(Raedeke Associates,Inc.2002): • Land disturbing or grading activities should be limited between October 1 and April 30 because these are the highest rain fall months when the risk of erosion is greatest. • In-water work for the installation of the stormwater treatment pond outfalls and construction of bridge footings should be conducted during WDFW's prescribed in-water work period for Lake Washington and May Creek,respectively. • The first cell of the proposed stormwater facility is designated as the optimum location for a TESC pond. Most construction stormwater runoff from the site would be temporarily routed to - this pond via interceptor trenches and berms. Later in the project, stormwater would be routed via permanent drainage pipes. • The area designated by the second cell of the proposed stormwater facility should remain in an undisturbed condition until the site has been completely stabilized. • Stormwater released from the on-site TESC pond facilities to downstream systems should be controlled and monitored during construction to ensure compliance with established water quality discharge requirements. • Soils should be stabilized at the end of each day based on weather forecast. Applicable practices include, but are not limited to, temporary and permanent seeding, sodding, mulching, plastic covering,erosion control fabrics and matting, and early application of a gravel base on areas to be paved, and dust control. • Matting, plastic sheeting, or other approved slope stabilization measures should be specified on the TESC plan for placement on all slopes greater than or equal to 3:1. Plans would make provisions to prevent concentrated flows from being routed over slopes. A monitoring plan, with independent testing, should be part of the quality assurance plan for compliance. The construction SWPPP should contain a plan for stormwater sampling locations, background 1 measurements, and a periodic reporting schedule. The reporting schedule should, at a minimum, require sampling during every storm event in the wet season that would generate runoff, as well as site inspection condition reports on the installed BMPs. The monitoring and sampling would be done in a professional City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-17 August 2003 manner consistent with current sampling protocols and reporting requirements. The sampling points P would be shown on a map and marked on the ground. The updated Ecology Manual(Ecology 2001)requires the use of grass-lined channels in place of unlined- ditches, which are allowed under 1998 KCSDWM. Also, the Ecology Manual does not allow the use of filter fabric alone as a storm drain inlet protection measure. The Ecology Manual contains additional erosion and sediment control BMPs that would help to mitigate impacts described in this Draft EIS (Ecology 2001). These BMPs include,but are not limited to,the following: • Limiting disturbed areas as practicable; • Immediate stabilization of construction roads and parking areas; • The use of polyacrylamide as a cover measure; • Erosion prevention techniques such as surface roughening and the use of gradient terraces; • Construction stormwater chemical treatment or filtration, as needed,to reduce turbidity in the site discharge; • Specialized concrete handling; • Providing appropriate on-site storage for fuels and chemicals; • Minimizing the risk of soil contamination during construction by restricting fueling and equipment maintenance to a designated staging area with an impermeable surface, spill containment features,and a spill clean-up kit; • Providing appropriate disposal facilities for wastes generated during construction; • Designation of a contractor erosion and spill control lead;and • Advanced budgeting and creation of a force-account for TESC measures. City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-I8 August 2003 I I ACRONYMS APA Aquifer Protection Area BA Biological Assessment BMP Best Management Practice BNSF Burlington Northern Santa Fe CERCLA Comprehensive Environmental Response,Compensation, and Liability Act CFR Code of Federal Regulations cfs cubic feet per second CMZ channel migration zone COR Center Office Residential dB decibel dBA A-weighted decibel DEIS Draft Environmental Impact Statement DNAPL dense non-aqueous phase liquid DNR Washington State Department of Natural Resources DPS Distinct Population Segment Ecology Washington Department of Ecology EDNA Environmental Designation for Noise Abatement EFH Essential Fish Habitat EIS environmental impact statement EPA U.S.Environmental Protection Agency ESA Endangered Species Act ESU Evolutionary Significant Unit FHWA Federal Highway Administration FRA Federal Railroad Administration I-405 Interstate 405 KCBW King County Backwater KCSWDM King County Storm Water Drainage Manual KCSWM King County Surface Water Management Leq A-weighted energy equivalent LWD large woody debris mg/L milligrams per liter mllw mean lower low water mm millimeter mph miles per hour MRSC Municipal Research Center of Washington MTCA Model Toxics Control Act City of Renton 554-1779-017 Barbee Mill EIS-Appendix C-Water Resources C-I9 August 2003 i NMFS National Marine Fisheries Service NOAA National Oceanic and Atmospheric Administration OHW Ordinary High Water OHWM Ordinary High Water Mark RMC Renton Municipal Code PAH polyaromatic hydrocarbon PCB polychlorinated biphenyl PCP pentachlorophenol PHS Priority Habitat and Species RCRA Resource Conservation and Recovery Act RCW Revised Code of Washington RMC Renton Municipal Code ROW Right-of-way SHPO State Historical Preservation Office SMA Shoreline Management Act SPTH Site-potential tree height SWPPP Stormwater Pollution Prevention Plan TESC Temporary Erosion and Sediment Control TIR Technical Information Report TOC total organic carbon TPH Total Petroleum Hydrocarbons TSCA Toxic Substance Control Act USFWS U.S.Fish and Wildlife Service USGS U.S. Geological Survey UST underground storage tank VOC volatile organic compound WAC Washington Administrative Code WDFW Washington Department of Fish and Wildlife WDOE Washington Department of Energy WNHP Washington Natural Heritage Program WSDOT Washington State Department of Transportation � I City of Renton 554-1779-017 Barbee Mill EIS—Appendix C-Water Resources C-20 - August 2003 APPENDIX D Terrestrial Plants and Animals Barbee Mill Preliminary Plat Draft Environmental Impact Statement Appendix D Terrestrial Plants and Animals Prepared for City of Renton Renton,Washington Prepared by Parametrix 5808 Lake Washington Blvd.NE,Suite 200 Kirkland,Washington 98033-7350 (425)822-8880 www.parametrix.com August 2003 Project No. 554-1779-017 D. PLANTS AND ANIMALS This technical appendix addresses impacts of the proposed Barbee Mill Preliminary Plat located in the City of Renton adjacent to Lake Washington, about a quarter mile south of the Kennydale interchange on Interstate 5,as indicated in Figure D-1. D.1 AFFECTED ENVIRONMENT Non-native vegetation and managed lawn areas dominate the existing shoreline and riparian vegetation in the project area. Shoreline and riparian vegetation on the site is limited because buildings and paved areas associated with mill operations extend to most of the shore of Lake Washington and in most areas along May Creek to within 25 feet or less of the water. The shoreline generally is riprapped as indicated in Figure D-2. A relatively narrow band of riparian vegetation occurs along the banks of May Creek as it flows through the southeastern portion of the site(King County 1995;Raedeke 2002). A revegetation plan for the May Creek corridor and portions of the Lake Washington shoreline was required in 1994 as a condition of Washington State Department of Ecology Water Quality Certification 94-2-00196. It has been partially implemented, as indicated below. The plan provided for planting of about 4,000 shrubs and small trees in an area of about 52,000 square feet, a density of about one plant per 14 square feet, or about 3.5 feet on-center. The majority of plantings do not appear to have established a stable vegetation community. The west bank of May Creek is characterized by a narrow riparian buffer, which is dominated by lawn grasses and non-native herbaceous plants. Dominant species in these managed lawns are non-native, i weedy species and include reed canarygrass (Phalaris arundinacea), tall fescue (Festuca arundinacea), red fescue (Festuca rubra), bentgrasses (Agrostis spp.), and a variety of herbaceous weeds such as dandelion (Taraxacum officinale) and seltheal (Prunella vulgaris). In places along the west bank, paved surfaces extend to within 5 to 10 feet of the OHWM and the riparian vegetation averages less than 25 feet wide along the stream(Raedeke 2002). Some trees and shrubs do occur along the west bank, but they are scattered through the managed lawn areas, are relatively low growing, and in general are too far from the stream bank to provide significant shade to the stream. Trees and shrubs are a mix of native and non- native species such as red alder(Alnus rubra), black cottonwood (Populus balsamifera var. trichocarpa), Scouler's willow (Salix scouleriana), Pacific willow (Salix lucida ssp. lasiandra), Himalayan blackberry (Rubus discolor), and red-osier dogwood (Corpus sericea). Large portions of the riparian buffer along the west bank are dominated by the non-native noxious weeds Himalayan blackberry, reed canarygrass, and Japanese knotweed(Poplygonum cuspidatum). In recent years,the Barbee Mill Company has planted additional shrubs and small trees to improve shrub cover in the buffer(Raedeke 2002). Species such red- osier dogwood, Scouler's willow, Pacific willow, twinberry (Lonicera involucrata), and red-flowered currant(Ribes sanguineum)have been planted into the managed lawn area along the stream. For the most part however,these shrubs are located away from the stream edge. Along the east bank of the stream,just below the BNSF bridge, there is a forested buffer of red alder and black cottonwood trees and a shrub layer dominated by willows. Small areas of alder occur south along the east bank. Below the concrete bridge, the east bank is also predominantly managed lawn with some shrubs. Substantial areas along the east bank are dominated by Himalayan blackberry and reed canarygrass. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-1 August 2003 2 405 522 5 e •. DUVALL 202 REDMOND - KIRKLAND _: 202 203 520 SEATTLE BELLEVUE Lake.•." ;r Washington `" 90 -I ISSAQUAH I NEWCASTLE 900 RENTON PROJECT 405 SITE Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-1-1-01 fl Figure D-1 Vicinity Map �iI Barbee Mill Preliminary Plat 1 I 1 7 I AA A k J OHW Ev : if /I I \ \ , , S. I y j ..„. , , ./ ®' /7/i//z y i ‹ c___ ____ t ,/•/ K . , , 1 PIER \, � / �yj/ / i ,"\/ ils ID. ••ail wm \ ' ;654----N LOG } i r RAFT l 1`? f / j c 1 1 C I ___. ."-V,. *, i , / 1 q---- -----7 „/ i .• ) _ l',:.4---1 .-\--"----- < --------- #./ .7/ __,,,„:;--,,,,--' ,x,--,/ -- / .i , ,r717 1 ) 2 7 '1 :.'" 01.?° s i/. /,mil LAKE • r,,O ,%' '\\\ � \ 1 _1 WASHINGTON j t'''r °" ° ,'�;\ij /�j'* '1 � ) '' I 1 -Of, 1 .,,,fil. 4/ blip/ 2 1 ' ' ;J,%try, / ' J. 7 / , `' f Ir Jf r ` r ! r, / '''',„ RC/ 4A-1\-47-----.•Z`-i,,--.:;-/ / / o a•er ,,,c,,,,,,, ?ce,„,,,.. t_ ,........._,, , , /-----,.„ , I_ .., • • e' \-,, ( x,jfil /•1 ...‘1 .ot ii i /‘\,,,..,:,-4 . / MAY CREEK #. r� /4 '— DELTA jI / __.---.."-- ,ir ''.: 4--'-' :11/ '.--7'''' i' �>.2 N 40TH ST , a I s II /-- -_______ / I % . ./F / ///"., Parametrix DATE: 07/24/03 FILE: K1779017P01T14F-3-4-01 BROKEN ASPHALT SCALE IN FEETfrNIN SHEET PILE BULKHEAD Figure D-2 lir —B— LOG BULKHEAD Existing Shoreline Protection o o0 2I o C RIP RAP Barbee Mill Preliminary Plat • • • • LOG PILES • • • • In general, with the exception of the small forested area near the BNSF bridge, the riparian buffer vegetation likely does not provide significant shade and/or leaf litter to the stream. The lack of shade is due to the presence of riprapped banks which prevent riparian shrubs from growing close to the water, non-native weeds such as Himalayan blackberry and reed canarygrass, and the large areas of managed lawn that line the stream in the project area. The lower portion of the west side of the May Creek corridor(below the first bridge) was designated for replanting in the 1994 plan with low plantings of native shrubs at the shoreline and extending inland consisting of a mix of willows, dogwood, and mock orange shrubs. The area below the lower bridge along the west side of May Creek has a relatively sparse understory of willows and other shrubs; however, a few red alder have established in riprap along the creek and Douglas fir recently has been planted at spacings of about 20 feet behind the bank. The area from the lower bridge to the upper bridge was designated for intensive plantings of willows in annular spaces in rockeries,with plantings of shrubs and small trees designed to reach a height of 25 to 30 feet. Surviving plants in this area are very sparse between the lower bridge and the footbridge, where new riprap appears to have been recently installed. Between the footbridge and the lower bridge, little understory is present along the streambank,however a few red alder have established in riprap along the creek and recent plantings of Douglas fir has recently been planted in the grassed area between the stream and pavement. The west side of the creek north of the upper bridge also was designated for relatively dense plantings of shrubs. Current vegetation in this area varies from riprap with little or no vegetation cover to areas with some overstory of alder and fairly dense understory near the stream. The eastern bank from the upper bridge to the BNSF railroad is the most densely vegetation portion of the site with fairly dense alder and understory adjacent to the stream to a distance about 200 feet north of the upper bridge. The west side of the stream between the upper and lower was designated for intensive plantings of willows and shrubs with a goal of reaching a height of 25 to 30 feet. This area is largely grass with a stand of very young alder near the footbridge and a stand of 40- to 50-foot-high Douglas fir near the lower bridge. The lower portion of the May Creek below the lower bridge and adjacent to the existing boathouse was to be planted with shrubs and vine maple. Vegetation in this area consists largely of grasses. The stream bank appears to have been recently riprapped. The Lake Washington shoreline in the project site also contains extensive unvegetated areas of riprap, which precludes the development of dense shrub or forested vegetation along the edge of the water. Most of the shoreline vegetation is managed lawn or disturbed area. Managed lawn areas are dominated by lawn grasses such as fescues and bluegrass (Poa spp.), weedy non-native herbaceous species such as dandelion,English daisy(Bella perennis), creeping buttercup (Ranunculus repens), and reed canarygrass. Significant parts of the delta consist of disturbed soils that have a sparse cover of annual weeds. Along the immediate shoreline, soft rush (Juncus effusus) and the invasive shrub, Scot's broom (Cytisus scoparius),grow in the spaces between the riprap rocks. The Lake Washington shoreline south of the log loading area, including a small area of public land waterward of the inner harbor line, was designated for low plantings of native shrubs consisting of a mix of willows, dogwood, and mock orange shrubs. This area appears to have been cleared as the result of dredging and related spoil piles dating from 1999 to 2002. j � For the shoreline and riparian areas, the Washington Natural Heritage Program (WNHP) database does not have records for rare plants or high quality habitats in the vicinity of the project. I City of Renton 559-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-4 August 2003 Upland Habitat Upland vegetation is limited on the project site due to the narrow corridor along the riparian zone of May Creek and along the BNSF railroad right-of-way along the eastern boundary of the site. Most of the project site is occupied by buildings and paved surfaces associated with the Barbee Mill Company operations on the site. Wildlife This section describes wildlife use of the riparian, shoreline, and upland habitats within the project site, as well as wildlife use of the adjacent open water habitat,Lake Washington. The narrow strip of low-quality riparian vegetation along May Creek, the shoreline lawns, and the small patch of upland vegetation near the creek provide limited habitat for wildlife. Species known or expected to use the area include killdeer, mallards,Canada geese,northern flicker, spotted towhees,white-crowned sparrows, song sparrows,house sparrows, red-winged blackbirds, tree swallows, black-capped chickadees, house finches, American crows, muskrats, and possibly Pacific treefrogs. The low quality of the riparian habitat along May Creek limits its value as a habitat corridor,although some species,such as deer, are known to use the project site portion of the creek to move between Lake Washington and habitats upstream of the project site. Adjacent to the project site, Lake Washington provides habitat for a variety of waterfowl, as well as potential foraging areas for gulls, and other predatory birds. During a site visit on April 8, 2003, wildlife observed on the lake included double-crested cormorants,hooded mergansers,American wigeons, scaups, buffleheads, and common mergansers. The limited human presence and activity of the project site, as well as the presence of the log rafts and pilings on the lake, likely enhances the lake habitat in the area, relative to other nearshore portions of Lake Washington where human activity levels are higher. Two wildlife species of special interest, the osprey and the bald eagle, are known or are expected to use the project site vicinity,as described further below. Mammal use of the project site and surrounding area can be presumed by studies of the May Creek corridor and other habitat in the Lake Washington Basin. Surveys of May Creek and other riparian habitat in the Lake Washington basin indicate a diversity of small mammals, such as voles and mice, which are common in mixed vegetation communities. These species provide forage for nesting and migrating raptors, including red-tailed hawks, barn owls, and owls. Introduced mammal species include the Norway rat, opossum, house mouse, and eastern gray squirrel, among others. House cats and off- leash dogs from adjacent residential areas likely cause disturbance to native and introduced mammals at the site. Small mammals such as mice and voles are most likely to be successful in urban and suburban riparian corridors because their rapid reproductive rates allow them to persist despite frequent disturbance. Aquatic species, such as the beaver, muskrat, and river otter, are less frequent in urban shoreline areas because their forage habitat requirements are larger (Larrison 1976). Forest-dwelling mammals, such as deer, are commonly observed in the May Creek drainage and have been observed to swim from the delta area to Mercer Island. Muskrats were observed on the site during field visits in April 2002. Osprey The osprey has no state of federal listing status but is protected under the Migratory Bird Treaty Act and the RCW. The Act makes it unlawful to hunt, take, capture, kill, possess, sell, purchase, ship, transport, or export any migratory bird, part, nest, or egg; and under the RCW 77.15.130, it is a misdemeanor to destroy the eggs or nests of protected species, including the osprey. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-5 August 2003 Ospreys are fish-eating birds that occur along lakes and rivers. The birds build large nests of sticks on snags or on living trees, and also readily nest on human-made structures including power line towers, light poles, and similar structures (Poole 1989). On the coast, osprey nests are usually adjacent to, if not over, water, whereas on inland lakes and waterways, nests are usually more distant(i.e., up to 14 km but typically within 3 to 5 km) from foraging areas (Poole 1989). The majority of nests in Oregon and California studies were within 1 km of large lakes and rivers(Zarn 1974;Vana-Miller 1987). Ospreys generally arrive on their breeding grounds in late March or early April. Pair bonding persists from one year to the next, and the same nest site may be used over successive years (Ryser 1985). Most migratory ospreys lay 2 to 4 eggs from late April to early May and incubate them for 5 to 6 weeks(Burns 1974; Poole 1989). Young fledge when they are about 2 months old (Burns 1974; Cadman et al. 1987). They return to the nest for feeding and roosting for another week, and can be found nearby for sometime thereafter(Cadman et al. 1987). The Barbee Mill site contains an osprey nest on the sawdust collection tower near the center of the site. The nest has been active every year since 1995 or 1996(Raedeke Associates 2002). During a site visit on April 8,2003,the birds were observed both on the nest and in the vicinity. Bald Eagle Bald eagles are federally and state listed as threatened, and the birds are also protected under the Bald Eagle Protection Act and the Migratory Bird Treaty Act. Due to large-scale recovery, the species has been proposed for federal de-listing and state down-listing to sensitive. Bald eagle habitat consists of open water areas with abundant prey (i.e., fish and waterfowl) and nearby large trees for nesting,perching, and roosting(Stinson et al. 2001). Habitat quality is also associated with freedom from human disturbance; however, eagle sensitivity to disturbance varies, and eagle use of urban areas with significant human activity is not uncommon. Bald eagle pairs arrive on their nesting territories as early as December(Stinson et al. 2001). Each eagle pair maintains an active nest and often maintains an alternate nest(s) within its territory; successful nests may be used over several successive years (Buehler 2000). Clutch size is usually two, and in western Washington, young hatch by late April, after approximately 35 days of incubation (Stinson et al. 2001). Young eagles fledge around 11 to 13 weeks of age, usually during early to mid-July in Washington. 1 Eagles nesting in Washington, as well as fledglings, leave their territories in early fall and migrate north to British Columbia and southeast Alaska, where salmon runs provide prey concentrations. Adults generally return to their Washington breeding grounds by January, while juveniles usually return several months later. Bald eagles wintering in Washington State generally arrive from October to December and leave between January and April. These wintering birds nest in British Columbia, Alaska, the Northwest Territories,and the Yukon. No bald eagle nest sites are located on the Barbee mile project site, and the two closest nest sites are approximately 1 mile from the site. Bald eagles may forage along the May Creek delta and along Lake Washington near the project site;however,use of the actual project site is unlikely, due to lack of suitable large trees for perching and roosting. Wetlands Two small wetlands(Figures D-3 and D-4)occur largely within the BNSF railroad right-of-way along the eastern edge of the property (Raedeke 2002), and small portions of these wetlands extend onto City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-6 August 2003 . , „ , / ------- __ _ _ 27,,,f,/,7 Tr .7 , , ,--- -alliiimmiiiii ill vii//7, [-Li. ,, 9 0 / 4 I Si iiiiir i///' „,- ., 0 7, if N. .._, /i ,-- e i 1 , 7 1 ) , fs, ,i _,/ _____ _v.- _____-• ------- 1 ( ii / 1 , ; 9R RERLY _._.--::::::::-.----_-:--.-_-_-:---;,---;:- k, i . _ - IWO '7// ETLAiSib•-• '''' --- ,------2---:::--===:"------\ 1 r ,- / 1 ION -/4,4- / ' 1 1, N\ ',:;::// \ \ \ \ \ \ 1 1!',,i_-_-_--_.1k,, 7-.....-' ,:N....1..‘•LI-"•-i-,M-N"T,-.-ftN1.t'.4"OIi7I„I,./I•-f.,ri0 4,/•1..4•,,,11,i,ih-/,/l,,i.is-11‘•. _•, i f:\\!"•\ /i/L i`/:/, /--\ / , I \ / • \ ‘ \\ , I 1 1/t1 / 4 // '1 # / 13 i /Ij iI / I/ / /4try// KEY MAP •)/ 1 4frfyy-;"77 • '/74? att. y / , 1 t, • -.01(/ 7 4141-/•‘-I # ;--•, f 'Ai / I iin, i ! 0 , N 1\0 8 , /Cy// ,l..f'o '/• •e--/.'/, -'" V / ETL/D),NA/DR 7 t , , 41zSETBA / \ \ / .5, Je'-r • . . siy / •Y \ 1-0.7.-) cOit .4 , * ' . ' 1 / 1 06 / I / 1/ ,,,PPROXIE,IkREA if / *7 - ( / / /q/ 4is-rc uoR,A%oil ON / • i 'bri- ..------:.# • ' / Niri ' / / _/ t/Y/ i/ / _-• '' 11 NV (5,' 1-05 1 i.r., f/....7 ,,,,/ ----- , / / /.//./. V/1/ ---- / --yr._ _______ _ /4 / /' / / ...f) / / / , •,..„ -6. ------- • _,..-- / / / *• 1 <V Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-4-02 • SCALE IN FEET . .N .... _... WETLAND Figure D-3 I gar Northerly Wetland 0 25 50 Barbee Mill Preliminary Plat . _ /• . Wit, 4,,— .,,, Jsr /j47 ; ! ------ -- -- - - --- 'v. //1,12 IIIIIIIIIIIIIIIII f ,. - "___ __ /. V f i / " l /il i 104 1 44:. IIIIIV- / ,.w. .. • 4::' ,.....)04,, ;117**,4 liA.' :74.1.-. ._ ....... / -'-'4-- 44 0110 III 11 I/- , 4r, / i.,41%.1, ....11111111111 4 ,// Akio, c; </,'p,/, .a , ,...,„ , ‘,/ 40, , \,./:/ //487/,./ ; \ , ..., .. , , - 1;K:' :.:;\,-?-</i I , '16'2 2 • /416./...--- i �- SOUTHER1Y- — / 'jilt, f wTr�vp . air 101 / � / --\�. iT ? \ . .ile / , \ N / / QQKEY MAP • N I \ :#7' . • i ,.LYr t Q- � � i*I• • 9.- A/ /\ ''• 1/ 4r / I i ' \ / r WET ® 1 / \ '� s\. =Z / `,, / \,ems "Lu/ �/ 1 j • / ' CO SC' - - _�- =.:.. Ii -25 SETBACK ,� /Al 3 ,„,.-." . ,,,r 1 ,>, ii /01/-1)r. - 40/147 / i r. 97 COS //♦ +� ` ;l:f p; / / /f- / �P // fr a'. / 7 N �� !i a/ �/ I I ® / ' -------� it I �,�j -� --- �_ N 40TH_ST Jy-,,� ,,,1„ i f/''' l( /4 1/ Parametrlx DATE: 07/24/03 ALE: K1779017P01T14F-3-4-03 . SCALE IN FEET "` _in_ Figure D-4 _ W WETLAND Southerly Wetland 0 25 50 Barbee Mill Preliminary Plat the Barbee Mill Property. Both wetlands were classified as Category 3 (City of Renton) palustrine emergent wetlands (David Evans 1997). These two wetlands are dominated by non-native herbaceous vegetation, inparticular reed canarygrass, tall fescue,velvetgrass Holcus lanatus), rasses creeping g rY�' � ( )� g P g buttercup, and a variety of native sedges and rushes, such as small-fruited bulrush (Scirpus microcarpus), dagger-leaf rush (Juncus ensifolius), and sawbeak sedge. Wetland hydrology is provided by surface runoff on the site, runoff from east of the site (via culverts under the BNSF tracks), and shallow subsurface flow through the BNSF railroad bed (Raedeke 2002). Both wetlands have been regularly mowed, as part of landscape maintenance for the mill entry and office area and also to maintain access to water utilities. The buffer areas around the wetlands are characterized by turf-grass lawns, railroad right-of-way(ROW), or a narrow fringe of young red alder,Himalayan blackberry, and willow. A portion of the buffer for both wetlands on the site is the BNSF railroad track and ROW. Two Priority Habitat and Species (PHS) wetlands are mapped to the north of the project area on WDFW maps. These wetlands are classified as forested, scrub-shrub and emergent wetlands associated with May Creek and its tributaries; however, these wetlands lie to the north of the project area and are not associated with the lower reaches and delta area of May Creek on the project site. General wetland functions include wildlife habitat, critical groundwater recharge, additions of organic matter to stream food webs, nutrient cycling, sediment trapping and other improvements in water quality. In addition, wetlands are valued for their ability to provide floodwater storage capacity that attenuates floodwater peaks downstream. Specific functions likely provided by the wetlands on this site include some sediment retention and limited water storage. Both wetlands, due to their small size, limited buffer area, and periodic disturbance associated with mowing, have low species diversity and probably provide minimal wildlife habitat. D.2 IMPACTS D.2.1 Impacts of Subdivision Construction Impacts Vegetation Communities Construction of subdivision infrastructure will have limited impacts on plant communities because the majority of the site is unvegetated impervious surfaces. The proposed bridge crossing of May Creek will remove portions of the existing riparian vegetation consisting largely of shrubs and grasses below the existing lower office parking lot. The extent of impacts will depend on bridge design and construction methods. It may be possible to maintain existing or enhanced vegetation beneath the bridge if the bridge deck is high enough to allow light penetration and water is provided by precipitation or irrigation. Wildlife Impacts on wildlife during construction would depend on duration of construction and the extent of disturbance from interruption of the riparian corridor during bridge and road construction. Noise impacts for pile driving for bridge or other foundation construction could be a substantial, although temporary disturbance. If pilings are required for building foundations, and construction of residences occurs over several years the impacts on disturbance sensitive wildlife could lead to avoidance of the site over the entire construction period. Most animals that use the area are habitat generalists that are tolerant of human activity. Addition, animals using the creek as a corridor are already adapted to the high levels of human activity in the May Creek watershed. These wildlife populations may develop some tolerance for City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-9 August 2003 high noise levels, or may limit their use to nighttime and other hours when construction doesn't take place. The effects of human activities on waterfowl along the portion of Lake Washington adjacent to the project site may be greater. Use patterns may change during construction. Nesting activities almost certainly will not occur near very high noise levels such as impact pile driving. The high noise levels associated with construction may discourage the osprey currently nesting on the sawdust tower from relocating in the vicinity. Wetlands The northernmost of the two wetlands is proposed to be retained; however, construction of Street C and the townhomes it serves will eliminate existing buffering vegetation below the Renton code minimum of a 25-foot buffer area for a Category 3 wetland. The roadway constructed adjacent to the wetland is in a fill section and is proposed to be supported by a low retaining wall. Construction impacts likely will extend approximately 10 feet from the edge of improvements and therefore encroach within about 10 feet of the wetland. The buffer area remaining after construction will be approximately 20 to 22 feet wide at its smallest dimension. The southernmost wetland will experience permanent displacement due to roadway construction of an area of about 10 feet by 40 feet, with construction disturbance of up to another 10 feet. Modification of the drainage system in the area to serve the new development likely will remove the source of water to recharge the wetland, resulting in loss of the total wetland area of 1,712 square feet. If portions of the wetland were retained, all of the buffer area on the west side of the wetland would be eliminated. D.2.2 Impacts of Development and Use of the Site Vegetation Communities Several natural and human processes are expected to influence the long-term impacts of the site on plant and wildlife communities. Delta formation at the mouth of May Creek is expected to resume after the sawmill is closed and the need to maintain depth for log storage and movement has ended. The delta will take a substantial amount of time to fill in the deepest dredged areas that are up to approximately 12 feet in the vicinity of log dump and sawmill loading areas to the south of the existing sawmill. The long term effects of delta deposits is likely to be similar to the Coal Creek delta in Bellevue about two miles north of the site where the delta - has expanded considerably since development of the Newport Shores residential area in the early 1960s, resulting in extensive upland and shallow aquatic habitat(King County 2003). The proposal includes setting aside a buffer area along May Creek that varies from about 20 feet from the waters edge to about 100 feet and averages about 60 feet. A stream buffer is designated on the project conceptual landscaping plans, but specifics of proposed plant species and densities of planting are not specified. In addition, it is presumed that the 0.63 acre of publicly owned land between the inner and outer harbor lines will be managed as public open space. This applies to approximately 520 linear feet extending from the northerly property line to proposed Lot 30. The width of this public land is approximately 20 feet along Lots 23-28 and approximately 80 feet along the open space tract, Lots 29 and 30. The existing sawmill and related facilities would be removed,which would allow opportunities for provision of a more City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-10 August 2003 ' natural shoreline habitat through removal of bulkheads and replanting the area to provide a buffer of indigenous native species. Public access along the shoreline is presumed to be developed pursuant to the requirements of the Renton Shoreline Master Program, which requires "significant" public access on Lake Washington (RMC 4-3- 090-K-14-d). The applicant has not defined a public access program. For the purposes of this analysis, public access facilities are presumed to take one or more of the following forms: • Use of the public shoreline waterward of the inner harbor line for general public use. This area is about 16 feet wide at Lot 24, 20 feet wide at Lot 28, and around 80 feet wide at the open space tract and adjacent to Lots 29 and 30. • A public walkway along the Lake Washington Shoreline for about 700 feet between Lot 29 and the mouth of May Creek within the shoreline building setback area of proposed lots, which is proposed to be 25 feet. Such a public walkway is likely to be located directly at the water's edge, to reduce privacy impacts on the private residences as much as possible. • Public walkways or trails are presumed to be developed through the buffer area along May Creek, including use of two of the existing bridges for pedestrian crossings. The proposal includes creation of 38 lots directly fronting on May Creek with 300 feet of road parallel to May Creek and a 120-foot-long roadway and bridge crossing the creek. Twenty four lots are proposed along the Lake Washington waterfront. Of those, 8 front on the public land managed by DNR, leaving 16 with direct private lake frontage. A setback of 25 feet from the building line is proposed for these lots. The lots adjacent to public land on the shoreline propose either a 10-foot setback or no building setback. A 280-foot-wide Open Space parcel is proposed adjacent to a portion of the publicly owned shoreline and contains a water quality pond that takes up about a third of the area. An irregularly shaped water quality tract is located near the center of the site. A water quality pond takes most of the space in that tract. The vegetation plantings associated with the project, specifically those along May Creek that range from 20 to 100 feet, averaging about 50 feet, would provide an area for an enhanced community of native riparian vegetation and related habitat. The lack of specific restoration plans precludes evaluation of the potential effectiveness of such a buffer area. Establishment of a community of native vegetation on a site largely characterized by impervious surfaces, imported fill, compacted soils, and in the absence of nearby communities of native vegetation to provide seed sources for a natural succession of plant communities requires human intervention at every stage of establishing and maintaining a viable community of indigenous vegetation. Specific considerations for establishing a similar community are discussed in the mitigation section below. The May Creek Final Action Plan recommends restoration of conifers adjacent to the creek to improve habitat conditions, stabilize streambanks, and improve the complexity and diversity of habitat. The plan also notes that the prospects of proposed land use changes at May Creek Delta could create the opportunity for initiation of a major habitat restoration project at the delta(King County 2001). The water quality tract and wet pond treatment area that would be constructed as part of the project is proposed to be planted with a mix of shrubs and non-native dwarf hinoki cypress(Chamaecyparis obtusa gracilis). This native of Japan and Taiwan typically grows between 6 and 12 feet tall at maturity. It is primarily an ornamental with irregular spreading branches that give an interesting appearance. This proposed plant community has limited habitat value although the area pond and upland area has the potential for an indigenous plant community and wildlife habitat as discussed in the mitigation section below. 1 City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-11 August 2003 The 25-foot shoreline building setback has no proposed landscape treatment in current plans. It is likely that common residential landscaping typical of lots in Renton would be applied, absent specific conditions of approval. One would expect primarily lawn and ornamental plants. Extensive soil amendment likely would be required for fill soils to support landscaping. Wildlife Human disturbance associated with the proposed project would generally have minimal effect on the existing patters of wildlife use of the May Creek riparian and upland area. Construction of residences could take place over several years time and high noise levels associated with construction may disrupt use of resident wildlife and wildlife using the stream as a corridor. Most of the existing animals that use the area are habitat generalists that are tolerant of human activity. In addition, animals using the creek as a corridor are already adapted to the high levels of human activity in the May Creek watershed. These wildlife populations may develop some tolerance for high noise levels, or may limit their use to nighttime and other hours when construction doesn't take place. The establishment of greater wildlife populations may be delayed until after construction on the site ceases. This also would be expected to coincide with the time period needed to establish new communities of vegetation along the riparian corridor. The effects of human disturbance on waterfowl along the portion of Lake Washington adjacent to the project site may be slightly greater than to the habitat generalists that use other portions of the project site. The relatively high level of waterfowl use in the area, as observed during the April site visit, may reflect the existing relatively low levels of human use along the lake's shoreline at the project site. Increased human activity and noise, especially given the limited proposed 25-foot setbacks for buildings,may result in reduced waterfowl use of the area. The addition of recreational docks and watercraft use would further reduce wildfowl use. The impacts of public access will depend on the location, width, and use character of the public facilities. Walkways directly adjacent to the shoreline can be expected to have the greatest impact because: • Armoring or bulkheading the shoreline likely would be required to maintain the trail at the shoreline edge. This would result in loss of opportunities to establish shoreline vegetation, thus narrowing the potential for establishment of a complex and productive plant community at the littoral edge. • Use of walkways is likely to introduce direct disturbance to wildlife species using the area; • Persons are likely to leave the trail where beach or shallow water conditions allow, and may disturb plants,especially newly established plantings,or contribute to soil erosion. Pedestrian walkways set back from the shoreline would reduce the impacts on shoreline waterfowl. The likelihood of users leaving the trail can be reduced by fencing and controlled public access for shoreline viewing from boardwalks or enclosed areas at the shoreline. Risk of wildlife mortality on the roads is not expected to substantially increase because of the project, as low speed limits would minimize potential for vehicle-wildlife collisions. The vegetation plantings associated with the project, specifically those along May Creek, would result in an increase in forage, cover, and potential nest sites for wildlife. The creekside vegetation would also help to serve as a visual buffer from human activities on the completed project site. Streamside buffers are proposed to be narrowest near the mouth of May Creek with the narrowest area occurring between Streets A and F on opposite sides of the stream. This represents one of the greater sources of disturbance from vehicle noise and lights and is provided the least buffer. The Street D bridge crossing also represents a direct disturbance to wildlife movement along the stream corridor depending upon its design. The hours that traffic is present will likely be longer with residential development, discouraging wildlife City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-12 August 2003 i I movement that has to cross the roadway. The stormwater detention pond that would be constructed as part of the project may provide additional wildlife habitat, depending on the extent of riparian vegetation along the pond's edge and the complexity of the vegetation community. The current proposal for a mix of shrubs and non-native dwarf hinoki cypress has limited habitat value. The proposed open space area and the wet-ponds, however provide the potential for wildlife habitat as discussed in the mitigation section below. The May Creek Final Action Plan recommends restoration of conifers adjacent to the creek to improve habitat conditions, stabilize streambanks, and improve the complexity and diversity of habitat. The plan also notes that the prospects of proposed land use changes at May Creek Delta could create the opportunity for initiation of a major habitat restoration project at the delta(King County 2001). Osprey The proposed construction would involve the removal of all existing mill structures, including the sawdust tower with the osprey nest site. Without mitigation, the birds may or may not find and use an alternative nesting structure in the vicinity. Increased human activity and noise, as well as the presence of artificial lighting,may also influence osprey use of the site. Bald Eagle The proposed project would have no effect on nesting bald eagles, since no nest sites occur within a mile of the project site. Construction activities may affect bald eagle foraging in the vicinity, due to disturbance to the eagles, as well as to their waterfowl prey. After construction, noise levels would be reduced, however, human activity levels and noise are expected to be greater than under existing conditions. Depending on the sensitivity of individual bald eagles as well as their waterfowl prey, use of the project site vicinity by foraging eagles could be slightly reduced. Wetlands Maintenance of residential landscaping could potentially impact native wetland vegetation and water quality. Addition of fertilizers for residential lawns and gardens, as well as the use of pesticides and herbicides to maintain landscaped areas could potentially impact both wetland and aquatic wildlife via surface runoff. In addition,pesticide or herbicide drift during application could impact aquatic organisms in May Creek or Lake Washington and non-target plants or animals in the stream or shoreline buffer areas. D.3 MITIGATION Impact mitigation includes the following steps: 1. Avoid the impact, 2. Minimize the impact, 3. Reduce the impact over time, 4. Rectify the impact,and 5. Compensate for the unavoidable impact. Impacts that narrow the range or degree of beneficial use of the stream and shoreline areas of the site are inherent in the permanent change of use to the residential development proposed with the specific City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-13 August 2003 setbacks and presumed uses discussed above. The mitigation outlined illustrates opportunities to expand the beneficial use of the stream and shoreline areas to include more complex plant communities and associated wildlife populations as well as mitigate specific adverse impacts of the proposal. Mitigation has also been viewed from the perspective of local regulations, specifically Renton Shoreline Regulations, which sets forth several requirements as follows: the potential effects on wildlife should be considered in the design plans for any activity or facility that may have detrimental effects on the environment (RMC 4-3-090-K-2-a); landscaping should be representative of the indigenous character of the specific types of waterway (stream, lake edge, marshland); the ecological qualities of natural and developed shorelines should be recognized and preserved as valuable resources (RMC 4-3-090-K-6); and wildlife habitat should be incorporated into the site(RMC 4-3-090-K-6). Mitigation of Subdivision Construction Impacts Mitigation of construction impacts to existing vegetation should include protecting the existing native buffer vegetation along May Creek from disturbance during construction by erecting barrier fencing. Staging and access areas should be designed to avoid buffer areas that are dominated by native vegetation. During construction, any cleared or regraded areas on the site during construction should be kept covered and/or reseeded with a temporary cover crop to prevent the establishment or spread of invasive weedy species. In particular, in portions of the site where Himalayan blackberry or reed canarygrass already occur, clearing should be done as quickly as possible to completely remove these species and the area should be replanted with native species. Mitigation of Development and Use of the Site Vegetation Communities Project conditions could require residential landscaping to include native vegetation along the shoreline, although assuring long-term maintenance given residential preferences for lawn and ornamental vegetation is a long-term maintenance and enforcement issue. Planting of native vegetation would provide some habitat, although the quality of the vegetation community within a 25-foot setback area would be limited. Native vegetation will minimize the need for fertilizers, pesticides, or herbicides and reduce adverse affects on terrestrial wildlife, native vegetation, and aquatic organisms in May Creek and Lake Washington. Use of native plants,plants suitable for the specific site conditions,or drought tolerant and disease resistant horticultural varieties could further minimize reliance on chemical fertilizers and pesticides. Designing the residential landscapes consistent with Integrated Pest Management principles can also minimize use of chemical controls. In addition, importing high quality soil material and ensuring adequate soil health, prior to installing residential or ornamental landscaping can decrease the need for chemical supplements or controls in landscape maintenance. Mitigation measures for installation of additional vegetation in the proposed buffer area along May Creek are addressed below in discussion of mitigation through alternative buffer areas. Wildlife Waterfowl, cormorants, and other birds would benefit from maintaining the existing log rafts and pilings in Lake Washington, adjacent to the project site,which provide perch and loafing sites. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-14 August 2003 I - Osprey Osprey mitigation measures are described in the Biological Assessment (BA) prepared by Raedeke Associates (2002). In summary, mitigation measures will include relocation of the osprey nest to an artificial structure erected in the project site vicinity, as recommended by WDFW and agreed upon by the U.S. Fish and Wildlife Service (USFWS). A WDFW biologist will be consulted during relocation of the new nest site,which will occur while the birds are on their wintering grounds. Research has proven that ospreys will quickly adapt to and use artificial nesting structures (Saurola 1997; Houghton and Rymon 1997). As of 1994, regional data indicated that approximately 64 percent of ospreys in the United States nested on artificial structures, particularly artificial structures erected specifically for the birds (Houghton and Rymon 1997). A study in Saskatchewan showed that the overall breeding success improved from 45.9 percent in natural trees to 62.9 percent in human-made platforms (Houston and Scott 1992). The International Osprey Foundation (1992) and Link (1999) provide recommendations for construction of osprey platforms. Potential sites for relocation on site include the riparian corridor proposed to be established along May Creek. Mitigation of Wetland and Buffer Area Displacement Avoidance The displacement of buffer area for the northerly wetland could be avoided by design changes in the proposal to place development outside the wetland buffer, with an additional area of 10 to 15 feet for temporary construction disturbance. This would require redesign of the townhomes on Lots 109 through 115 to move the proposed access road 12 to 15 feet to the west. If the same setbacks from May Creek were maintained,this would shorten the depth of the lots,which range from 85 to 104 feet in depth to 60 to 75 feet. These lot depths are more typical of dimensions of proposed duplex lots such as lots 99 to 102. The result of such modification would likely be the creation of four to six duplex lots instead of the eight townhome lots proposed. If the roadway and townhomes were shifted enough to provide a permanent buffer dimension of 25 feet, but allow construction disturbance and restoration, eight townhome sites could be retained. The displacement of wetland and buffer area of the southerly wetland could be avoided by redesign of this portion of the proposal to place all development outside the 25-foot-wide wetland buffer area. This would involve shifting the access road currently proposed at the property line west about 40 feet in the immediate vicinity of the wetland. This would displace proposed Lots 99 and 100 and require reconfiguration of other lots for a net loss of two building sites. If retained, existing utilities consisting of water valves and a hydrant should be relocated outside the wetland and buffer. Compensation, Restoration, and Enhancement Restoration of buffer area of the northerly wetland disturbed by construction would require planting of native vegetation to replace the existing vegetation displaced vegetation. The existing buffer vegetation west of the wetland is characterized by non-native grasses and forbs, with some areas of red alder and Himalayan blackberry. Replacement vegetation would consist of nursery stock of trees and shrubs to provide at least a 25-foot buffer around the western edge of the wetland on the project site. This replacement vegetation would include a mix of native trees and shrub species, such as western red cedar, western hemlock, Douglas-fir, big-leaf maple, vine maple, beaked hazelnut, salmon berry, and red currant. City of Renton 554-1779-017 { Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-]5 August 2003 Enhancement of the existing wetland vegetation community of the northerly wetland, which consists of introduced vegetation, could be accomplished byplantinga mix of native shrubs and emergent plants. g � P g p Shrub species such as twinberry, red-osier dogwood, and willows such as Sitka, Scouler's, and Pacific willow could be densely planted around the edges of the wetland. In the central, lower portions of the wetland that tend to be wetter, native grasses, sedges and rushes such as slough sedge, small-fruited bulrush and dagger rush would provide increased diversity and water quality enhancements. Only a small portion of this wetland occurs within the project site however,most of the wetland is on the BNSF ROW. Any wetland enhancement would require the cooperation of the BNSF railroad. Compensation for the area of the southern wetland proposed to be displaced,together with likely changes in hydrology, would necessitate replacement elsewhere on site. The City of Renton specifies a 1.5:1 minimum replacement ratio for wetland creation and replacement with the provision for additional area in cases where there is uncertainty as to the probable success of the proposed restoration or creation; significant period of time between destruction and replication of wetland functions; or projected losses in functional value(RMC 4-3-050-M-11-e). The most likely candidate area for wetland creation is north and west of the northerly wetland adjacent to the proposed May Creek buffer area. This area is north of the area proposed for development and could be used to replace wetland area lost by filling the southern wetland, as well as to enhance the northerly wetland. A wetland mitigation plan has not been proposed by the applicant. Likely constraints for wetland creation in this area that must be addressed include the following: • Adequate groundwater and surface water supply is critical to sustain a wetland vegetation community. The existing hydrology supports the existing northerly wetland. There is currently no indication that surface water or groundwater resources are present that would support a larger wetland area. It is possible that surface water runoff from the proposed roadway or from building roofs could provide recharge for the wetland. Surface water runoff from streets contains pollutants that can be an undesirable addition to wetland ecology. Roof runoff generally avoids such pollutant; however, any runoff source is subject to interruption during low rainfall months and is a less reliable source to sustain wetland vegetation than groundwater. In addition,much of the project area exists on fill and removing fill and regrading some of the area north of the existing wetland to lower the elevation may provide sufficient groundwater hydrology, along with surface runoff,to ensure adequate hydrology to support additional wetland area. • If hydrology is adequate, it is likely that regrading would be required to provide an area to hold _ surface water or tap groundwater. Grading will remove existing vegetation and soils, requiring soil amendment and replanting of both wetland vegetation and appropriate buffer area. Replacement wetland areas would be planted with a mix of native shrubs, sedges, and rushes, while the buffer area would be planted with a mix of native trees and shrubs. The specific wetland planting plan would depend on a detailed evaluation of site hydrology and soils following regrading, however, the wetland would likely be planted with species such as Pacific, Scouler's and Sitka willow, salmonberry, twinberry, red-osier dogwood, slough sedge, small- fruited bulrush, sawbeak sedge, dagger rush, hardstem bulrush (Scirpus acutus) and northern mannagrass(Glyceria borealis). • The degraded character of the existing vegetation within the northerly wetland should be addressed through enhancement plantings. The invasive nature of the existing community of reed canary grass poses a high risk of invasion of the created wetland by weed species. This risk can be addressed by removing the existing reed canarygrass by grading and replacement with dense plantings of native shrubs and trees. The location of most of the northerly wetland on a different enhancement and weed control measures problematic. The degraded roe mayrendert�'rty property condition of both existing wetlands,however, makes enhancement desirable, if the cooperation of City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-16 August 2003 the BNSF railroad can be gained to ensure the entire wetland is managed as a single biological entity. • Monitoring and enforcement are critical elements of successful wetland compensation. To ensure successful establishment of a new wetland, there should be a monitoring program, qualified reviewers, and the performance of a bond to cover the necessary costs of control of invasive species and possible replanting is an important measure to ensure successful establishment of a wetland replacement. Recent studies at King County(Mockler et al. 1998)and Ecology(Johnson et al. 2000) have found that 79 percent of County mitigations, and 65 percent of Ecology mitigations, failed to meet assessable performance standards. Failure has been attributed to design, installation, and maintenance flaws. The single most important cause of failure has been lack of enforcement. In this case, the provision of the proposed buffers along May Creek and the Lake Washington shoreline have varying degrees of impacts, as compared to existing conditions and provide some degree of mitigation of some adverse impacts on vegetation and wildlife habitat. Mitigation Through Alternative Buffer Areas The scientific information cited above suggests that greater buffer areas provide for a wider range of vegetation communities. These buffers could support reestablishment of indigenous elements of the Lake Washington shoreline,which would reduce long-term impacts of residential development of the shoreline and expand the beneficial use for wildlife. Concepts related to the restoration of natural vegetation communities include the following: Structure. Refers to the physical complexity within each plant community. It is not always desirable, feasible, or even possible to replicate the natural structural complexity of target plant associations. A mature, forested riparian corridor or lake shoreline cannot be instantly created or restored, but a young sapling community can be planted that will develop into a mature system over time. Site design must reflect the fact that restored plant associations will evolve and mature over time. To replicate structural complexity, several elements must be addressed in the restoration design. These include spacing, patch size, interspersion, and persistence. It must be understood that natural succession within a vegetation community is generally not possible within a restored vegetation community in an urban setting. The complex interactions with existing stands of vegetation are not present in fragmented or isolated stands of vegetation. Sources of seeds from existing stands of vegetation may not be available; therefore, a complex vegetation community that contains as many features as native communities must be created within the restored vegetation community. Spacing. Within each target plant community, the patterns of species and their spatial relationships should be replicated to the extent possible. It should be noted if species tend to grow in clumps or clusters of multiple specimens or if each specimen is represented singly. Patterns within communities should be distinguished and replicated to the extent possible. Patterns of vertical stratification should also be replicated. Many communities are composed of species with different vertical growth patterns. It is important to develop a design to incorporate trees in the overstory canopy, trees in the mid-story, shrubs in the understory, and herbs forming the ground layer. Other important components of the ground layer are logs and stumps, which provide habitat for insects and amphibians, and are a source of nutrients and organic matter. Interspersion. The structural patterns within the overall targeted vegetation and wildlife community must also be replicated. Different animal species have different requirement for optimum patch size. "Interspersion" refers to the degree of complexity of patches within a system or the transitions among various plant communities. Plant community types are distributed throughout an ecosystem in spatial City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-17 August 2003 arrangements that range from simple to complex. Simple patterns often present an orderly progression of establishment of plant communities in concentric rings or linear bands. More complex patterns of plant communities may be a reflection of the maturity of the system. In general, the relationships between patch size, structure, edge, and dispersion/interspersion in the landscape are the critical factors affecting wildlife value of a system. Where spatial complexity is high, so is the amount of transitional area between plant communities. Such transitional areas or "edges" are rich in wildlife, both in numbers of individuals and species, and are considered important components of functioning ecosystems. Transitional edges offer wildlife proximity to several habitat areas and structural variety; however, if the amount of edge in a system is extremely high, the integrity within individual plant communities may be lost. Of special concern for establishment of vegetation communities in an urban setting are the adjacent land uses and the degree of disturbance from those uses, ranging from noise and light to disturbance and predation from domestic cats and dogs. Establishment and Persistence. The establishment and persistence of vegetation on this site is likely to include a number of challenges because the existing geology and soils largely consist of a variety of fill - - materials and there is no local community of mature native vegetation to provide for succession of native species. The persistence of newly established indigenous plants will require long-term management both to monitor and replace plantings that die prior to establishment, but also to control invasive "weed" plants and to monitor plantings to identify those that are most suitable to the site and most likely to be sustainable over the long term. Establishment of a soil substrate for indigenous vegetation will require: • Removal of existing impervious surfaces including pavement and foundations of buildings within the restoration area; • Removal of contaminated soils, and amendments to restore an appropriate soil chemistry, which may be needed because remnants of building materials and leachates from cement and asphalt as well as chemicals used on site that can affect soil pH and other parameters of soil chemistry. • Reducing the existing compaction of underlying fill. Compacted soils have soil aggregates that are broken into smaller particles, reducing the amount of pore space in the soil, which hinders aeration, water infiltration and results in low soil oxygen and poor water drainage. All of these factors retard root growth and jeopardizing the health of new plantings. Given the character of the existing fill and weight of buildings, lumber and vehicles used on the site, reducing compaction is likely to require: ➢ Deep plowing with a plow or backhoe when the soil is dry to break up compacted soils, or holes can be drilled to provide drainage and better root penetration; > Rototilling and disking to break up compacted soil aggregates(Miller 1997). • Mixing compacted fill with fully composted organic mulch is beneficial in improving the soil structure (up to 50 percent volume of soil may be needed) and is also necessary to provide soil microbes and invertebrates that are largely missing in urban soils and provides a very limited food source and results in a poor food web and unhealthy soil. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-I8 August 2003 `- Persistence of the established communities will require replacement of plantings that die or are replaced by invasive "weed" species. Several strategies are available, each with associated advantages and disadvantages. In most cases, a mix of strategies is appropriate. • Overplanting may compensate for lack of knowledge about appropriate communities in a particular setting as well as compensation for the normal mortality of installed nursery stock. In most cases, a survival rate of between 60 percent and 80 percent is specified in planting plans. It also may be appropriate to plant a mix of species at densities in excess of final expected densities of mature specimens to allow competition between various species to establish an appropriate species mix. It is not always possible for a landscape designer to discern the soil and other conditions that will favor species in a particular site. Overplanting also may be used in an attempt to compete with invasive species. This strategy is often inappropriate because invasive species by their nature are more aggressive and overplanting can retard the establishment of desirable. species through excessive competition for resources. • Irrigation is likely to be required for a period of 2 to 3 years until plants are established, especially during the typical Puget Sound drought period of July—August. • Monitoring and intervention to replant specimens that die, or actively remove invasive species. The extent to which existing non-native species can be removed or suppressed prior to replanting would be a benefit in reducing initial competition. Ongoing control of invasives as a major component of a successful the project because of the aggressiveness of invasive plants and the lack of existing plant communities on the site that might indicate an appropriate mix of new plants. Control of invasives is likely to require a long-term management commitment, including an initial 3 to 5 year establishment period and a longer-term monitoring and replacement period to identify plant communities that fare well and to continue to eradicate new infestations of invasives. This will be required for both upland areas and newly formed delta deposits that will be colonized both by species on-site and a variety of local ornamental plants common on the Lake Washington shoreline. The provision of a management entity for areas of restored buffer areas is likely to be a critical factor in successful establishment of a viable community of native plants and associated terrestrial and aquatic species. Management will require a long term commitment to monitoring establishment and replanting successful plant communities,removing invasive weed species, controlling the impacts of use by adjacent residents, or the public using trails through the area and possibly mediating between the view and animal control interests of residents and the general public purpose of the buffer areas. Substantial resources are likely to be required. Potential management agencies can include the City of Renton Parks Department and DNR, who has management responsibility for the public uplands and submerged aquatic lands, WDFW, who has primary responsibility for managing wildlife and fish resources, volunteer participation by the public using shoreline access, and the adjacent homeowners, or a homeowners association, or cooperative programs involving all of these agencies. Mitigation of bridge crossings may include greater height and width to allow penetration of light and precipitation to maintain plants and to provide for animal movement between the waters edge and bridge abutments to maintain the migration corridor. Vegetation species planted in the riparian and shoreline buffers would be basically the same under the different buffer-width scenarios. Some important considerations for buffer plantings to enhance the beneficial functions of buffers include dense plantings of native trees and shrubs to maximize sediment retention, water quality, and nutrient cycling functions. In addition, planting a variety of species with different life-forms (e.g., groundcovers, short and tall shrubs, small and large trees) enhances the structural diversity of the buffer, which increases the habitat quality for wildlife. Finally, planting a City of Renton 559-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-19 August 2003 I variety of different species ensures that there are a variety of food sources available for wildlife. Buffer planting plans for the riparian area should include native trees, such as western red cedar, western hemlock, Douglas-fir, black cottonwood, big-leaf maple, Oregon ash, and bitter cherry. Native shrubs and small trees such as red currant, red elderberry, vine maple, beaked hazelnut, Pacific crabapple, red- ' osier dogwood,Pacific willow, Sitka willow,and Scouler's willow should be planted in the buffer. The shoreline buffers could be planted with lower-growing species to provide some views of the water, but should include the three native willows and shrubs such as red-osier dogwood, twinberry, salmonberry, red elderberry, Pacific crabapple, bitter cherry, beaked hazelnut, and vine maple. These species can provide some shade and cover along the shoreline, as well as providing sources of organic material to the food web of the lake, and food and cover for terrestrial wildlife. Two conceptual scenarios are proposed for expanded buffer areas on the Shoreline and May Creek: Option A, 50-foot Buffer Under Option A, (Figure D-5) the following design modifications are proposed to slightly increase the buffer adjacent to May Creek: • Reorienting the turn-around for Street A to project to the interior, rather than into the riparian corridor. • Additional setbacks on the east side of May Creek near the mouth of the stream where the proposed setback narrows to 15 feet from OHWM. A 50-foot setback in this area reduces four proposed townhome units to one or two. For the Lake Washington shoreline,this option is presumed to include the following two components: • A 25-foot wide buffer adjacent to the shoreline that would include restoration of the shoreline to a more natural condition through: > Elimination bulkheads,or reduction in height of existing bulkheads. > Limited regrading to provide a more natural shoreline gradient and providing substrate for plantings near the water. > Planting of a mix of native vegetation on the shoreline,while preserving some view corridors for adjacent residential development. -- ➢ Providing passive public access through a pedestrian trail located 10 to 15 feet from the water with fencing between the trail and waterfront with viewing areas every 100 to 150 feet on the shoreline with benches or other passive features. • A 25-foot area for adjacent residences, including yard areas and ornamental landscaping would probablybe marked by the subsurface containment walls that are likely to be needed to prevent lateral spreading of potentially liquefiable alluvial deposits, and which also would likely be fenced for privacy. i I City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-20 August 2003 i COR-2 ZONE / .- —„,. M m _ i- /- . :. 2,1 IIllusw-mm s,I ;7— I . „m g1 I '-;i I '7.1 I 11 sI I— s/ • OHW—�_I,1 :g/ - t� ,� STREET - ' srI- / / - / ?/ M,. �l 1> (/.MM ^I. j / ,>, s50'SETBACK g :/C > ` / L - I> o 1I ILA—// *y/ / _i- - 1 / v / Vl Tract„B„ �� — " //l PUBLIC LAND 4~,, Tract"C" Water Quality \ "/ "/' i Open ■ >9\\'' °' \\/ ' \ j 1 Space /\�„ °' �� -� � / m /\ ' ,rt / /\\ /� i / �, /j Wall „� /\\ s\ \ / �' /1Uo f/ �= l' . • ` .'a- \ E,,/R -Ti t� tili; '' /r' _ // ' J ;� / / LAKE we \;, \ , f// / 1 , I/!��/ _ \u\ � i'�� N/Nibl/ /111:: � �/� .; lam/WASHINGTON — % ri'I i --V / 50'SETBACK ikto ItV /7 11111011,0 //i i' 1114 . y 1 _ ,/ • /4/7* PUBLIC LAND /��\ /, is 1 / f� �� / i • t-'-- * it .41**AL(Z,‘, -/ / . ., _______ ./.. ./.,,,/,//,,,.4:. i,,,7\.7 , Ler/(1 7 i/ ._ / • „,,_,,,-..„--,,",-3,-,,_-\-4,,4„',*-'4*,°---P-'----_4'-,41*/,/.\,2,tl l f1'-_/7-_/7,_t__,,4,`\".//:,, Ir„/./:_i' d MAY CREEK , t i DELTA =,e; . µ f J r I'- — ( L ___ r mm .ate-_ _...........R=9_.ZONE. i__. -...« r, / Xd, / M•f - --- k. An-ru CT._...__�.... REVISED 50'SETBACK FROM OHW 88 DUPLEX BUILDING SITES, 13 FOUR AND FIVE-PLEX BUILDING SITES 101 TOTAL BUILDING SITES Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-4-04 SCALE IN FEET Figure D-5 W Option "A" 50-foot Buffer o 100 200 Barbee Mill Preliminary Plat The following likely differences in impacts exist between Option A and the Proposal: The large width of the buffer area that would be planted with trees and shrubs under Option A would provide a greater degree of roughness and,therefore,would provide increased sediment retention,nutrient cycling, water quality improvements, and organic matter inputs to the stream and lake than the Proposal. In addition, Option A would provide slightly more riparian habitat and a greater distance from human disturbance then the original project design. Consequently, Option A would create better conditions for riparian-associated and aquatic wildlife(i.e.,muskrat,riparian songbirds,and waterfowl). The provision of a 25-foot-wide buffer of native indigenous plantings adjacent to the lake shoreline under Option A with a 25-foot area devoted to lawn adjacent to residences provides a very limited strip for reestablishment of native vegetation communities. The presence of public access trails in the area also would lead to potential impediments to establishing a stable vegetation community because of trampling and other disturbance, and would be an additional disturbance to wildlife. The creation of a more natural edge at the lakeshore would be the feature that differs most from the probable bulkheaded shoreline under the proposal. A much more varied community of plants could be established at the shoreline with regrading to remove or reduce the height of existing bulkheads because of the presence of water and the favorable environment provided for a wide variety of vegetation. That complexity would be reflected in value to wildlife. The potential value of revegetation, however, is limited by the narrow width of the buffer, which provides little opportunity for complexity in transitions to upland plants. A 25-foot buffer of native vegetation would be likely to allow plant communities to develop that were relatively simple and homogenous with few upland transitional areas or edges. The potential for conflict for areas exist where lots are proposed along the shoreline. In many cases, homeowners are likely to desire views of the shoreline that would not be accommodated by typically dense communities of indigenous species. Retaining views may limit opportunities to develop an effective community of indigenous shoreline vegetation and wildlife habitat because those communities typically create dense screens,especially native evergreen species. One strategy that may serve both goals to a certain extent would be to emphasize groundcover and shrubs in the shoreline with the tree species chosen for the potential to grow with a large leaf canopy above the level of major views. Such species would potentially allow removal of lower limbs at maturity that would allow some views between trunks, while providing a leaf canopy that would overhang the lakeshore and provide shade and other desirable elements. Native evergreens could be located closer to residences and along lot lines or other locations where views corridors between individual or groups of trees can be provided. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-22 August 2003 I 1__ I ' COR-2 ZONE All 1 , a a r 1 Ir. �I f. �I I7 I, -I 10 In::i —'r— 1— /76 ate( --- -- / - D- 1 (----44„- —ST' — / 1 7/— 7� c, --7// / . OHW�_P ' -- , /n ,e / _ I I I I--- f t L � II II 100'SETBACK \/ \// C'° '° / l Tract"B". �/ � P'' / / Water Qualty _ J PUBLIC LAND 4V.. // 1TEa ("Iceciti ' o // : , , :', .1110111X V \. " // '''' — —� ��f- - - 4,e,,,,, ,,U.FE � �' • . ,-/%�1 Z S'NE`// r 1 ,---- 8 . • _,(0/ -.--, ,-.-, . • -2-=-2----_• .-_>-<4. y / / 6 / of • ,Li • • / , %� OHW . r 8 / I 011111101 . / • • /7 • 1.11. : fri C;,1 LAKEIOW, • %, s /„� ,,. i,' WASHINGTON / /'• � • i,,;' �f r� j�� 100'SETBACK • Z : \ • 1/‘ i .. // : t. v l • /— '/ /:// PUBLIC LAND wu�' �� t'(. °/ 1: / 7-- V 4:1::,rr:1 I:/:\J ,,Z ,: i / II MAY CREEK w� �% � f • DELTA / 7-7:/ -�#4y, l it "/ � •r/ / 1�� . • _ x=BsoNE_�„ . /7 • " y 4%;-N 40TH ST :.,t , /rums_ 7 // REVISED 100'SETBACK FROM OHW 50 BUILDING SITES Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-4-05 SCALE IN FEETit- NFigure D-6 W Option "B" 100-foot Setback I o 100 200 Barbee Mill Preliminary Plat Option B, 100-foot Buffer Option B (Figure D-6) would approximately double the buffer width for May Creek, with specific changes on the May Creek corridor including the following: • Elimination of most of the potential for development on the east side of the stream. • Reduction of the number of lots fronting the stream from 19 to 15. • Elimination of most of the development on both sides at the mouth of the stream. For the Lake Washington shoreline,this option is presumed to include the following two components: • A 75-foot-wide buffer adjacent to the shoreline, which would include restoration of the shoreline to a more natural condition through: > Elimination of bulkheads, or reduction in height of existing bulkheads. > More extensive regrading to provide a more natural shoreline slope. > Planting a mixture of native vegetation on the shoreline, including more large trees, that could be accommodated in the wider buffer area, while preserving some view corridors for adjacent residential development. > Providing passive public access through a pedestrian trail located 15 to 25 feet from the water with fencing between the trail and waterfront and viewing areas every 100 to 150 feet on the shoreline with benches or other passive features. • A 25-foot area for adjacent residences to include yard area and ornamental landscaping, probably marked by the subsurface containment walls that would likely be needed to prevent lateral spreading of potentially liquefiable alluvial deposits and also likely to be fenced for privacy. The following likely differences in impacts exist between Option B and the Proposal: The greater width of the buffer area along May Creek planted with trees and shrubs under Option B would provide a greater degree of roughness and, therefore, would provide increased sediment retention, nutrient cycling, water quality improvements, and organic matter inputs to the stream and lake than the proposal. The additional 50 feet of trees and shrubs under Option B would also enhance these functions relative to Option A. In addition, Option B would provide more riparian habitat and a greater distance from human disturbance than the original project design or Option A, and consequently would create better conditions for riparian-associated and aquatic wildlife (i.e., muskrat, riparian songbirds, and waterfowl). The provision of a 75-foot-wide buffer of native indigenous plantings adjacent to the Lake Washington shoreline with a 25-foot area devoted to lawn adjacent to building sites would provide a more complex plant community and greater buffering for to the most productive natural edge at the lake shore. The larger depth of the buffer provides substantially greater opportunities to establish more complexity in transitions to upland plants and more potential to allow plant communities to develop that have more upland transitional areas or edges for a greater variety of wildlife habitat. The location of public access trails further from the lake shoreline would provide less disturbance to the lakeshore, which is the most sensitive element of the plant and wildlife community. The potential conflict for views of the shoreline by adjacent residents would be greater with the larger buffer area. The width of the buffer would substantially impair the potential for direct views. With such a buffer width,the primary visual access to residents may be provided by public access trails provided to the buffer area and associated shoreline viewpoints. City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-24 August 2003 i I ACRONYMS APA Aquifer Protection Area BA Biological Assessment BMP Best Management Practice BNSF Burlington Northern Santa Fe CERCLA Comprehensive Environmental Response,Compensation,and Liability Act CFR Code of Federal Regulations - cfs cubic feet per second CMZ channel migration zone COR Center Office Residential dB decibel dBA A-weighted decibel DEIS Draft Environmental Impact Statement DNAPL dense non-aqueous phase liquid DNR Washington State Department of Natural Resources DPS Distinct Population Segment Ecology Washington Department of Ecology EDNA Environmental Designation for Noise Abatement EFH Essential Fish Habitat EIS environmental impact statement EPA U.S.Environmental Protection Agency I ESA Endangered Species Act ESU Evolutionary Significant Unit FHWA Federal Highway Administration FRA Federal Railroad Administration I-405 Interstate 405 KCBW King County Backwater KCSWDM King County Storm Water Drainage Manual KCSWM King County Surface Water Management Leq A-weighted energy equivalent LWD large woody debris mg/L milligrams per liter mllw mean lower low water mm millimeter mph miles per hour MRSC Municipal Research Center of Washington MTCA Model Toxics Control Act City of Renton 554-1779-017 Barbee Mill EIS-Appendix D-Terrestrial Plants and Animals D-25 August 2003 NMFS National Marine Fisheries Service NOAA National Oceanic and Atmospheric Administration OHW Ordinary High Water OHWM Ordinary High Water Mark RMC Renton Municipal Code PAH polyaromatic hydrocarbon PCB ' polychlorinated biphenyl PCP pentachlorophenol PHS Priority Habitat and Species RCRA Resource Conservation and Recovery Act RCW Revised Code of Washington RMC Renton Municipal Code ROW Right-of-way SHPO State Historical Preservation Office SMA Shoreline Management Act SPTH Site-potential tree height SWPPP Stormwater Pollution Prevention Plan TESC Temporary Erosion and Sediment Control TIR Technical Information Report TOC total organic carbon TPH Total Petroleum Hydrocarbons TSCA Toxic Substance Control Act USFWS U.S.Fish and Wildlife Service USGS U.S. Geological Survey UST underground storage tank VOC volatile organic compound WAC Washington Administrative Code WDFW Washington Department of Fish and Wildlife WDOE Washington Department of Energy WNHP Washington Natural Heritage Program WSDOT Washington State Department of Transportation , i l City of Renton 554-1779-017 Barbee Mill EIS—Appendix D-Terrestrial Plants and Animals D-26 August 2003 APPENDIX E Aquatic Species I � I ' I1 l Barbee Mill Preliminary Plat Draft Environmental Impact Statement Appendix E Aquatic Species I Prepared for ' City of Renton Renton,Washington _, Prepared by Parametrix 5808 Lake Washington Blvd.NE,Suite 200 Kirkland,Washington 98033-7350 (425)822-8880 www.parametrix.com August 2003 Project No. 554-1779-017 ' E. AQUATIC SPECIES �yy =`I E.1 AFFECTED ENVIRONMENT !�I This technical appendix addresses impacts of the proposed Barbee Mill Preliminary Plat located in the City of Renton adjacent to Lake Washington, about a quarter mile south of the Kennydale interchange on Interstate 5, as indicated in Figure E-1. i ! May Creek The Barbee Mill site lies at the western edge of the May Creek basin, where May Creek discharges into Lake Washington. The May Creek basin encompasses a 14-square-mile area located in King County, southeast of Lake Washington,between the Cedar River, Coal Creek, and Issaquah Creek drainages. The basin lies primarily within unincorporated King County, but the western and southwestern portions of the basin(approximately 12 percent of the total area)are within the City of Renton(King County 1995). The May Creek watershed consists of residential, open space, agriculture, and commercial land uses (King County 2001). During the past several decades, the lower portions of the watershed have undergone intensive residential development, while the upper two thirds of the watershed have retained a mix of rural residential, small farms, and some forest areas (King County 2001). Currently, the amount of effective impervious surface coverage within the basin is 7 percent. Under, current zoning, full build-out of the basin would result in an increase of effective impervious surface to 12 percent of the total basin area(King County 2001). May Creek is identified as tributary#0282 in Water Resource Inventory Area(WRIA)08 (Williams et al. 1975). May Creek originates from the outlet of Lake Kathleen and flows westerly 8.6 miles to Lake Washington. On the project site, May Creek flows approximately 1,000 feet from I-405 in a southwesterly direction through the Barbee Mill site and discharges into Lake Washington near the south end of the site. The stream was rerouted to flow to the south,parallel to the Lake Washington Boulevard and the BNSF railroad some time after 1950. Historic maps and photos show the stream flowing at various locations generally in a more direct westerly direction through delta deposits. May Creek has a mean annual flow of 25.6 cubic feet per second (cfs) and the portion of May Creek on the project site is classified as a Type 1 stream (DNR 2002)based on its size (>20 cfs mean annual flow) and anadromous fish use. King County classifies streams under three different categories. Class 1 streams are those that have been inventoried as Shorelines of the State under King County's Shoreline Master Program and May Creek within the project site is listed as a designated Shoreline of the State I (Washington Administrative Code [WAC] 173-18-210). Class 2 streams are smaller than Class 1 streams, and either flow year-round under periods of normal rainfall or are used by salmonids. Unlike Class 1 and 2 streams, Class 3 streams are intermittent or temporary during years of normal rainfall and are not used by salmonids(King County 1991). Three bridges cross the on-site portion of May Creek. The southernmost of the three bridges is a single lane wooden structure located at the mouth of May Creek. The bridge provides vehicular access to the southern portions of the Barbee Mill site. The middle bridge is a narrow, foot-traffic only wooden structure located approximately 200-feet upstream from the mouth of May Creek. The northernmost bridge is a two-lane concrete structure that provides the primary access for the mill. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-2 August 2003 { r 405 �522 DUVALL 202 REDMOND ', KIRKLAND 202 203 520 SEATTLE Lake BELLEVUE Washington;' ;. `g* 90 W ISSAQUAH ty NEWCASTLE 900 RENTON PROJECT 405 SITE Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-1-1-01 1. Figure E-1 it Vicinity Map �il� Barbee Mill Preliminary Plat ' J , Within the project site, May Creek is approximately 10 to 20 feet wide, and the channel gradient is less than 1 percent. The stream channel is incised approximately 12 inches; hence the stream's OHWM is _ only slightly wider than the wetted width of the stream (Raedeke 2002). Riffles and glides characterize the creek northward from the northernmost bridge to the eastern property boundary. Riffle substrate is redominantly cobbles and gravel that may provide some spawning habitat for a small number of adult salmon and trout. Fine silts and sands are the primary substrate downstream from the southernmost bridge. Only three pools were observed during the April 8, 2003, field visit, two were associated with bridge abutments and another was associated with some woody debris upstream of the furthest upstream bridge. Substrate in the deeper pools in the northern on-site reaches of May Creek consisted of fine silts and sands. Water depth during the April 2003 site visit varied from greater than 30 inches in pools and about 8 to 16 inches in the riffles and glides. Much of the bank along both sides of May Creek within the Barbee Mill property is armored with riprap. Both east and west sides of the stream bank are armored with riprap at the mouth of May Creek in the vicinity of the southernmost bridge and portions of the west side of the stream are armored with riprap -' between the southernmost and northernmost bridges. Riprap is placed intermittently along the east and west banks of the creek from the northern bridge to the eastern site boundary(Figure E-2). Under current conditions, May Creek buffers are sparsely vegetated on the west side of the stream. In most cases, buildings and paved areas on the west side are 25 to 50 feet from the edge of the water. On the east side of the stream, the site is largely undeveloped between the BNSF railroad and the stream north of the existing bridge. This portion of the stream is fringed by red alder trees that overhang the stream; however, the width of the buffer in this area averages approximately 30 feet and includes only a - , single row of trees directly adjacent to the stream. Existing buffers along the lower half of the east side of the stream consist primarily of lawn and the majority of the on-site portion of the stream is poorly shaded. Scattered clumps of shrub vegetation and small trees are interspersed throughout the southern portion of the buffer. These areas have developed primarily as a result of recent buffer enhancement efforts by the Barbee Mill Company; however, shrubs and trees are small, located approximately 5 to 10 feet from the stream edge and do not provide substantial stream shading. Impervious surfaces (pavement, buildings, and other structures) cover approximately 85 percent of the project area and extend to much of the Lake Washington shoreline on the project site. Over the past several years, annual dredging at the mouth of May Creek in Lake Washington has been conducted by the Barbee Mill Company to remove bark debris from mill operations and to remove sediment that is transported from the upper reaches of May Creek and deposited in the lower reaches of May Creek and the delta area in Lake Washington at the mouth of May Creek. Dredging operations annually removed about 2,000 cubic yards of sediment from the May Creek Delta, which has served to prevent aggradation of the May Creek streambed, thereby maintaining the extent of the floodplain. A detailed floodplain description and analysis is found in the Floodplain Analysis Technical Report (Appendix B) of this Draft EIS. Recent surveys found that bark removal operations have been successful in improving substrate conditions in Lake Washington adjacent to the project site (Harza 2000; Meridian 2001). City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-4 August 2003 A OHW� fAi //✓ f.,,--:-.1 ry . / i j g \ ,,.., ,i / ....- ��& -........_„__� 'a_._.__._. ---'------ - ._..__ice f • f /✓- 4 � PIER v. _....; � �� t i 1 /: • • •7 e k,„..7,.,,,, \\_, i ,,,, ,3.„,,,,. 7 .. ,/ / .,, . . • rs.,,, ,,,,t„ ,._ . , , , . • •m I- Iv i ,, t / �, , � LOG 1 RAFT i • , , .� y' ©'' a ♦ids \ f _/77 ' j` -- :31//)- \`,,' '- 'i' '- ��%% it �,Q /,,`` -/f / f%v ✓ / ✓ r -/ ,, ` _ f �t'r`l t 74 4 1 1 LAKE 11. i� y/� :„./rt.:97//..______, "�O%'' ,-�� ,1 ill ) f} ,7' fWASHINGTON A //.L //°", ;1\,\I i / ,'/`� i/J•; - i i i 1 1 y „e / / r .11; ;1 I;? j I / /f/ �i / �� 1 1 J it.'" 1, / J r ,//// / "/ /r ✓ '` 1./ / / -- 7/ ' / ' '-, A,_.,, 41i. \ IP/i7, ` ._ /4 l'4 V, -_.....z=„./0. /// i'''''',,, ) s.\‘_, ,,,,,,,../a/f.141' 7i '''11 ..----- ',,,,. ...st-7 '' / • IS es •% I •• _s/1/,, / - 2 \ 7 / '''''•-• _ J MAY CREEK �.7 f; _ \ mod \/ rf DELTA �Ir _ —a— DELTA r L jam_..___ __...____.......-___._.-.�_._.;~. . _5.41 ,. N 40TH ST / =.. --- / f 40 r �: I 7,'" „ /,. / ; i 1` I i s�✓ / Parametrix DATE: 07/24/03 FILE: K1779017P01T14F-3-4-01 BROKEN ASPHALT SCALE IN FEETlAilk SHEET PILE BULKHEAD Figure E-2 lir —B— LOG BULKHEAD Existing Shoreline Protection 0 100 2I 0 �r-0 RIP RAP Barbee Mill Preliminary Plat • • • • LOG PILES Lake Washington Lake Washington, the largest lake in King County and the second largest in the state, receives its main inflows from the Cedar and Sammamish rivers. Lake Washington drains approximately 472 square miles. The basin containing Lake Washington is a deep, narrow glacial trough with steeply sloping side slopes. The lake's average depth is approximately 108 feet,with an average water volume of 2,350,000 acre-feet. Most of Lake Washington's surrounding watersheds are urban in nature; 63 percent of the watersheds are developed (DNR 1999). The lake connects to Puget Sound via Lake Union and the Lake Washington Ship Canal. The Ship Canal provides the only discharge from Lake Sammamish and Lake Washington. Construction of the canal in 1916 lowered Lake Washington's water level by about 9 feet to its present level. Lake Washington serves as a valuable natural resource to all King County residents. On the whole, the lake's water quality is extraordinary for a large lake surrounded by urban developments. It offers good rearing habitat for juvenile salmon and other wildlife, provides multiple recreational opportunities, supports varieties of resident fisheries, and acts as a focal point for the surrounding communities (DNR 1999). Nearshore landscapes on Lake Washington provide suitable habitat conditions for chinook, bull trout, and other aquatic species where natural habitat forming processes and functions are uninterrupted. Chinook and other juvenile fish migrate along the shoreline. Shallow water can provide protection from larger predatory fish. Native trees and shrubs growing near the water provide leaf litter, terrestrial insect food sources, and eventually woody debris along the shore and in the water. Native emergent vegetation in shallow water increases the complexity and diversity of habitat in the nearshore zone. The shoreline vegetation helps maintain and develop natural processes that establish a shoreline supporting the food web and provides crucial in-water habitat. During the past century, extensive shoreline modifications on Lake Washington have simplified the nearshore habitat and reduced structural diversity. Most native riparian vegetation has been replaced by residential and commercial development. Today, approximately eighty percent of the existing shoreline is lined with bulkheads that reduce the remaining shallow water habitat and change shallow water substrates. Over 2,700 piers extend into Lake Washington, introducing a different pattern of shade from that produced by shoreline vegetation and changing the underwater habitat from complex (horizontal fallen trees with branches)to simple(vertical smooth pilings). The result of these actions is to remove the complex and diverse plant community and associated food web from the shallow water habitat (USCE 2001). The Barbee Mill project site lies along approximately 1,700 feet of Lake Washington shoreline. The Lake Washington Basin, known as WRIA 08, is comprised of waters funneling into Lake Washington and hence through Lake Union and the Lake Washington Ship Canal to Puget Sound at Shilshole Bay (Williams et al. 1975). Riprap and bulkheads(consisting of either logs or metal sheet pile)reinforce virtually the entire length of the Lake Washington shoreline on the project site. Riprap extends northward along the shoreline for approximately 150 feet from the mouth of May Creek(Figure E-2). Beyond this extending to the north, a reach of shoreline approximately 100 feet in length (the former log-loading area) is reinforced with a sheet-pile bulkhead, as is the area where logs were loaded into the sawmill. Large pieces of asphalt and _ l other debris are falling into the water in the log loading area. Beyond the extent of the sheet pile, the City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-6 August 2003 entire shoreline is reinforced by log or riprap bulkheads to the northern extent of the project property boundary. A dock extends approximately 50 feet into Lake Washington from the shore north of the existing sawmill building. Numerous pilings and log booms associated with the mill have been installed in the lake and extend several hundred feet out into Lake Washington at two different points. Lake depths along the shoreline are largely related to past dredging of the mouth of May Creek and the log handling area. The shallowest depths of the lakebed are encountered adjacent to the existing sawmill and are 3 to 4 feet below the OHWM. The greatest depths are about 12 feet in the vicinity of log dump and sawmill loading areas to the south of the existing sawmill. An aquatic habitat survey of Lake Washington around the May Creek delta and shoreline within the project area revealed that high densities = of elodea (Elodea canadensis), Eurasian milfoil (Myriophyllum spicatum L.), and curly-leaf pondweed (Potamogeton crispus) occurred in shallow (less than about 3 meters, or 9-feet deep)near-shore portions of the project area during the summer months (Harza 2000). The highest abundance appears to be in depth of 2 to 3 meters (6 to 9 feet) whereas very few macrophytes were found in depths greater than 5 meters (15 feet). Abundance of plants is low in the winter. Substrate in the project area is a mixture of silt and fine sand with occasional patches of gravel (Harza 2000). Where observed, gravel was mostly located in very shallow water (less than about 0.5 meter), whereas silts were the dominant substrate in deeper water. Fish Species Use WDFW Priority Habitats and Species data indicate that May Creek supports five species of salmonids, including chinook salmon (Oncorhynchus tshawytscha), coho salmon (O. kisutch), sockeye salmon (O. nerka), winter steelhead (O. mykiss), and resident cutthroat trout (O. clarki). Of these species, chinook salmon are federally listed as threatened under the Environmental Species Act (ESA) and coho salmon are considered a candidate for listing. Sockeye salmon, winter steelhead, and resident cutthroat trout are identified by WDFW as priority anadromous and resident fish species. Resident rainbow trout (O. mykiss) are also a priority species that may occur in the project area, and Pacific lamprey (Lampetra tridentata) and river lamprey (Lampetra ayresi) are federal species of concern that have been found within King County and may also occur near the project site. ESA-Listed Species There are three fish species that are present, or may be present, within the Barbee Mill project vicinity that are either federally listed or a candidate for listing under the ESA. National Oceanic and Atmospheric Administration(NOAA)Fisheries has identified the Puget Sound Evolutionarily Significant Unit (ESU) of chinook salmon as a threatened species. NOAA Fisheries has also identified the Puget Sound/Strait of Georgia ESU of coho salmon as a candidate for listing under the ESA. Coho salmon have been considered in this Draft EIS to preclude additional analysis should coho salmon become listed in the future. In addition, the USFWS has identified Coastal/Puget Sound Distinct Population Segment (DPS) of bull trout (Salvelinus confluentus) as a federally threatened species that occurs within the project vicinity. Chinook Salmon (Oncorhynchus tshawytscha) On March 24, 1999,NOAA Fisheries listed chinook salmon in the Puget Sound ESU as threatened under the ESA of 1973 due to drastic decreases in abundance compared to historical levels (Federal Register 1999a: 14308-15328). Puget Sound chinook salmon stocks have shown long- and short-term negative City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-7 August 2003 trends in abundance that are attributed to the effects of forest practices, urbanization, and agriculture (Myers et al. 1998). These land uses typically cause habitat degradations that include stream blockages, stream bank instability and modifications, increases in sedimentation, widespread removal riparian vegetation and large woody debris, loss of stream shading, alteration of flow regimes, rerouting of streams, and loss of estuarine and nearshore habitat (Myers et al. 1998). Harvest and negative genetic effects of hatchery releases of chinook salmon are also considered factors of decline(Myers et al. 1998). ' Chinook salmon have a wide variety of life-history strategies that vary based on the length of freshwater and salt-water residency times (Myers et al. 1998). Puget Sound stocks of chinook salmon, including those found in Lake Washington and its tributaries, are summer and fall run stocks that generally exhibit an "ocean-type" life history pattern where juveniles typically migrate to the marine environment during the first 3 months after emergence from stream gravels (Myers et al. 1998); however, chinook juveniles have been found to delay seaward migrations by rearing in Lake Washington for extended periods of time (Harza 2000). Juvenile chinook salmon spend anywhere from several months to a year in estuary and nearshore areas prior to migration to the open ocean (Myers et al. 1998). After 1 to 4 years in the open ocean,Puget Sound chinook salmon return to spawn in summer and fall. Chinook salmon spawn in areas of clean gravels and cobbles, and generally in the mainstems of rivers(Myers et al. 1998). Chinook salmon use shoreline areas of Lake Washington from January to July and the distribution of juvenile chinook salmon has been demonstrated to be related to slope, substrate, and depth. Highest densities of juvenile chinook salmon have been found in areas with small to fine substrate (sand/gravel) during day and night, and in areas having gradual slope (less than 20 percent Tabor and Piaskowski 2001). From February to March, chinook salmon commonly used overhead structure during the day, but rarely at night. In contrast, chinook salmon do not appear to use overhead structures during the day or night (Tabor et al. 2002). During the day, chinook salmon are often found in aggregations, whereas at night they have been found to be inactive on the bottom in shallow water,close to shore. Woody debris and overhanging vegetation are commonly used by chinook salmon in March and April, but are used less progressing from May into June(Tabor and Piaskowski 2001,Tabor et al. 2002). It is at this time when predators such as smallmouth and largemouth bass move into shallow waters, often utilizing such cover and other overhead structures. Most habitat used by chinook salmon within the project vicinity occurs along the Lake Washington shoreline. Lake Washington is a major migration corridor for chinook salmon and is also used for rearing juveniles. Most juvenile chinook salmon that use habitat within project vicinity originate from the Cedar River. The Cedar River stock is a native, naturally spawning population without supplementation from hatchery stocks that is considered a depressed stock (WDFW 1994). Adult Cedar River stock chinook salmon enter Lake Washington from late June through September, with peak numbers occurring in late August. Spawning in the Cedar River occurs from mid-September through mid-to-late November, with peak spawning occurring in mid-October (WDFW 1994). Fry emerge from February through March (Harza 2000,City of Seattle 2000). Chinook salmon are known to use May Creek and the Lake Washington shoreline in the vicinity of the Barbee Mill project site. While May Creek does not have a self-sustaining chinook salmon population, some individuals believed to be strays from the Cedar River do use May Creek for spawning and rearing (Lucchetti 2002). Spawning surveys conducted in 1976 and 1977 found chinook salmon population densities in May Creek of 1 and 7 fish per mile, respectively. Population surveys conducted in 1983 did not find chinook salmon in May Creek, while surveys conducted in 1992 and 1993 found peak densities City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-8 August 2003 of 1 fish per mile (Harza 2000, Foster Wheeler 1995). In 1999, 6 live chinook salmon and 4 carcasses were spotted in May Creek at approximately River Mile 0.5 (Meridian 2001). From March to June of 2002, the May Creek delta and the lower 278 meters of May Creek (all on the Barbee Mill site) were snorkel surveyed to assess juvenile salmonid densities (Tabor et al. 2002). Few chinook salmon were observed in the channel, convergence pool, and delta area of May Creek. In that study, densities of chinook salmon did not greatly differ between delta areas and lake reference areas (Tabor et al. 2002). Bull Trout(Salvelinus confluentus) On November 1, 1999,the USFWS issued a final rule listing the bull trout as a threatened species under the ESA throughout the coterminous United States (Federal Register 1999b:58910-58933). Thirty-four subpopulations were identified within the Coastal/Puget Sound bull trout DPS. According to Quigley et al. (1997), the distribution of bull trout has been reduced to approximately 44 percent of its historical range. Key factors in the decline of bull trout populations include population fragmentation, watershed and habitat impacts(sedimentation,reductions in stream shading,altered flow regimes),hybridization and competition with non-native brook trout (Salvelinus fontinalis), and harvest by anglers (Quigley et al. 1997). Bull trout exhibit both resident and migratory life history forms. Bull trout have more specific habitat requirements than other salmonids species, and bull trout spawning and rearing is generally restricted to undisturbed relatively pristine cold streams, often occurring in headwater reaches (Rieman and McIntyre 1993). These streams have stable channels with abundant cover in the form of large wood, undercut banks, large boulders, and clean substrates used as spawning and rearing habitat (WDW 1992). Migratory adults frequently use lakes, reservoirs, larger rivers, and saltwater coastal areas for feeding and/or migration(Federal Register 1999b:58910-58933). Cold-water temperatures are particularly critical factor for bull trout. The maximum water temperature considered to be suitable for bull trout are 8 to 10 degrees C for spawning 2 to 4 degrees C for egg incubation, 4 to 10 degrees C for rearing, and 10 to 12 degrees C for migration (USFWS 1998). Areas where water temperature exceeds 15 degrees C (59 F) are thought to limit bull trout distribution(Rieman and McIntyre 1993). Migratory bull trout begin spawning migrations as early as May, and bull trout spawn from August through December when water temperatures are decreasing. As is typical of most salmonids, spawning occurs over gravels and cobbles with good intragravel flow of water or groundwater inflow. Juvenile bull trout use shallow backwater or side channel areas, and move to deeper water sheltered by large organic debris,vegetation,or undercut banks as they grow(Federal Register 1999b:58910-58933). Due to the habitat requirements of bull trout, it is highly unlikely that bull trout would be present within the project vicinity. No bull trout spawning has been documented within the Urban Growth Area boundary(Lucchetti 2002),which includes the project vicinity. The only confirmed bull trout stock in the Lake Washington watershed is the Chester Morse Lake population,which is restricted to the upper Cedar River watershed (WDFW 1998). Bull trout have, however,been sighted within Lake Washington and its tributaries over the past 20 years(Harza 2000;USFWS 1999; and WDFW 1998). The origin of these fish is unknown, though these fish may originate from anadromous populations from outside of the Lake Washington Basin(Harza 2000,WDFW 1998,USFWS 1999,Federal Register 1999b:58910-58933). �! City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-9 August 2003 Coho Salmon (Oncorhynchus kisutch) On July 25, 1995, National Marine Fisheries Service (NMFS) added the Puget Sound/Strait of Georgia ESU for coho salmon to the candidate species list based on several risk factors that may necessitate the future listing (Federal Register 1995:38011-38030). Risk factors include artificial propagation, high harvest rates, habitat degradations, observed declines in adult size, and unfavorable ocean conditions (Busby et al. 1996). Habitat degradations include activities such as logging, agriculture, development, and stream blockages. Coho salmon are an anadromous species that typically have a 3-year life cycle. Adult coho salmon returning to the Lake Washington basin in late August and continue through mid-November. After entering Lake Washington, adult coho may remain in the lake for up to several weeks if necessary until river flows are adequate for upstream migration. The majority of spawning in Lake Washington basin streams occurs late September through mid-January (Harza 2000, R2 2000). Spawning generally occurs in gravel substrates of tributary streams, and fry emerge from gravels in early March to mid-May (Johnson et al. 1991; Harza 2000; R2 2000). After emergence,juvenile coho salmon rear in freshwater for 1 year, migrate to the ocean, and return within 5 to 20 months to spawn. The stream distribution and abundance of coho salmon is likely influenced by water temperatures, stream size, flows, channel morphology,vegetation type and abundance,and channel substrate size and quality. Coho salmon runs in Lake Washington are heavily supported by hatchery production. Therefore, it has been difficult to fully determine the status of naturally spawning coho salmon populations in the region. However,recent trends in both hatchery and wild escapements in Lake Washington are showing a decline in populations that may be attributable to urbanization, high harvest rates, habitat degradation, and poor ocean conditions(Harza 2000;Fresh 1994;WDFW 1994). Use of Lake Washington by coho salmon is poorly understood,but juveniles are known to use May Creek and the shoreline of Lake Washington in the vicinity of the Barbee Mill project area. Spawning surveys of May Creek conducted in 1976, 1977, and 1985 found that peak coho salmon densities in the lower reaches of May Creek to be 23, 5, and 55 coho salmon per mile respectively (Raedeke Associates, Inc. 2002). Subsequent surveys conducted in 1992-1993 found densities of only 2 fish per mile (Harza 2000; Foster Wheeler 1995). In more recent fish surveys conducted near the mouth of May Creek, juvenile ''-- coho salmon were found in May Creek on the project site and also in Lake Washington in close proximity to the mouth(Harza 2000). However,juvenile coho salmon are not generally known to reside in lakes for extended periods of time prior to seaward migration. Therefore, most use of the Lake Washington shoreline by juvenile coho salmon occurs primarily in April and May during seaward migration. Other Fish Species Other species known to occur in the project vicinity include yellow perch (Perca flavescens), smallmouth bass (Micropterus dolemuei), largemouth bass (Micropterus salmoides), northern pikeminnow (Ptychocheilus:oregonensis), black crappie (Pomoxis migromaculatus), pumpkinseed sunfish (Lepomis gibbosus), three-spine stickleback (Gasterosteus aculeatus), speckled dace (Rhinichthys osculus), brown bullhead (Ictalurus nebulosus), peamouth (Mylocheilus caurinus), longfin smelt (Spirinchus thaleichthys), largescale sucker (Catostomus macrocheilus) shiner (Notropis spp.), and prickly sculpin (Cottus asper) (Harza 2001). In snorkeling surveys conducted in March and August of 2000, the most abundant species observed in Lake Washington near the project site were yellow perch and juvenile smallmouth and largemouth bass (Harza 2000). Other species observed in 2000 included northern pikeminnow, three-spine stickleback, and speckled dace. Though no salmonids were observed in these City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-10 August 2003 r f studies, they were conducted during months when migrating juvenile salmon would not be expected to occur. In May 2001, coho salmon, sockeye salmon, rainbow trout, yellow perch, and three-spine stickleback were observed (Harza 2001). Most fish were found in water depths less than 2 meters (about 6 feet) along the shoreline. Typically, these fish were associated with overhead and underwater cover in the existing dock,boathouse, and submerged logs. Essential Fish Habitat The Magnuson-Stevens Act requires the evaluation of proposed projects with a federal nexus to evaluate impacts on habitat of commercially managed fish populations. Essential Fish Habitat (EFH) has been defined for the purposes of the Magnuson-Stevens Act as "those waters and substrate necessary to fish for spawning, breeding, feeding, or growth to maturity" (NMFS 1999). NOAA Fisheries has further added the following interpretations to clarify this definition: • "Waters" include aquatic areas and their associated physical, chemical, and biological properties that are used by fish, and may include areas historically used by fish where appropriate; • "Substrate" includes sediment, hard bottom, structures underlying the waters, and associated biological communities; • "Necessary"means the habitat required to support a sustainable fishery and the managed species' contribution to a healthy ecosystem; and • "Spawning,breeding,feeding, or growth to maturity"covers the full life cycle of a species. NOAA Fisheries has recently proposed EFH for Pacific Coast salmon, including chinook salmon, within Amendment 14 to the Pacific Coast Salmon Plan (NMFS 2000). Any reasonable attempt to encourage the conservation of EFH must take into account actions that occur outside of EFH, such as upstream and upslope activities that may have an adverse effect on EFH. Chapter 3, Section 3.2.5.5 of Amendment 14 (NMFS 2000b) addresses construction/urbanization impacts upon salmon habitat. Construction projects can significantly alter the land surface, soil,vegetation, and hydrology and adversely impact salmon EFH through habitat loss or modification. Among numerous types of non-fishing activities that may affect EFH, should BMPs fail,those applicable to the project area are those that would: • Alter sediment delivery to, and quantity in streams and estuaries; • Alter water flow, quantity,timing,temperature,or chemistry; • Alter the amount or types of nutrients or prey; and • Discharge pollutants,nutrients,or contaminants. The use of BMPs during construction will avoid and minimize any potential effects upon salmon EFH. Examples of BMPs, as stated in the NMFS EFH guidance (2000), include avoiding ground disturbing activities during the wet season; minimizing the time disturbed lands are left exposed; using erosion prevention and sediment control methods; minimizing vegetation disturbance; maintaining buffers of vegetation around wetlands, streams, and drainage ways; avoiding building activities in areas of steep slopes with highly erodible soils; and using methods, such as sediment ponds, sediment traps, or other facilities designed to slow water run-off and trap sediment and nutrients. 7 City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-11 August 2003 Critical Habitat On April 30, 2002, the U.S. District Court vacated the rule designating critical habitat for 19 ESUs of salmon and steelhead on the West Coast, including the Puget Sound chinook salmon ESU. The designation of critical habitat for listed species was required under Section 4(a)(3)(A) of the ESA. The ESA defined critical habitat in Section 3(5)(A) as"the specific areas within the geographic area occupied by the species, on which are found those physical or biological features that are essential to the conservation of the species and that may require special management considerations or protection." Before the rule was vacated, NMFS (2000a) designated critical habitat to include all marine, estuarine, and river reaches accessible to listed chinook salmon in Puget Sound. NOAA Fisheries is currently reconsidering the designation of critical habitat. In the event that critical habitat is redesignated before this action is fully implemented, an analysis of the effects of the project on critical habitat, as defined under the vacated rule, has been included in this EIS. This analysis may be relevant in determining whether initiation of consultation will be necessary if critical habitat is redesignated. Currently,NMFS has not determined critical habitat for Puget Sound coho salmon as they are a candidate species and their status has yet to be determined. Recently,NOAA Fisheries proposed that critical habitat for Oregon Coast coho salmon should include all freshwater waterways and substrates below longstanding, naturally impassable barriers (i.e., natural waterfalls in existence for at least several hundred years) and several dams that block access to former coho salmon habitats (NMFS 1999). Should Puget Sound coho salmon become listed or proposed for listing,then a definition of critical habitat similar to that of Oregon Coast coho salmon critical habitat is conceivable. Lake Washington and May Creek in the general vicinity of the project site provides both spawning and rearing habitat for coho salmon and would be considered critical habitat under the definition proposed for Oregon Coast coho salmon. The critical habitat designation was deemed "not determinable" for bull trout by USFWS (1998) due to the meager understanding of the biological needs of bull trout. A critical habitat designation is generally expected within 2 years of the proposed rule, but it is not known when this designation will be made for the Puget Sound bull trout DPS(USFWS 1998). E.2 IMPACTS The determination of impacts to fish species and aquatic habitat due to construction and implementation of the proposed alternative is based on the ecological health of the species and cumulative impacts that threaten survival, the seasonal use of the project area by fish species, the existing site conditions, and the design of proposed alternatives. Impacts can include direct mortality, disturbance, degraded water quality, and habitat degradations. Because of the relatively similar life history requirements of chinook and coho salmon, impacts resulting from project construction and implementation would likely be similar for both species. In general, the proposed action alternatives have some potential to impact the habitat of chinook and coho salmon during either construction or implementation, but mitigations should improve the overall condition of the site over time. Habitat for other aquatic species should also be improved over time as mitigations promote more natural stream and lakeshore conditions on the project site over time relative to existing conditions. Short-Term Subdivision Construction Impacts The direct impacts of the project are related to the extent and duration of the construction activities, whether fish species are rearing or migrating at that time, and the immediate habitat modifications that City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-12 August 2003 result from the project. Initial construction of subdivision infrastructure, such as roads, bridges, stormwater treatment facilities, and utilities, would potentially cause some disturbance from the demolition of existing buildings and clearing of existing impervious surfaces,which would make the site susceptible to erosion and accidental discharges of sediment and pollutants to surface water. The impacts on May Creek of constructing the proposed bridge is likely to be related to design,specifically the setback of abutments or bridge supports from the stream. Increased sedimentation and in-water disturbance may adversely affect aquatic species and habitat in the short-term. Suspended sediment originating from urban landscapes contains higher levels of contaminants than from more natural landscapes and high turbidity can reduce feeding rates by young salmonids (Gregory 1994; Gregory and Northcote 1993). In addition, young salmon and bull trout may avoid increased turbidity when lower turbidity water is available (Bisson and Bilby 1982). High concentrations of suspended sediment may also delay or divert spawning, and extremely high concentrations can cause spawning salmon to avoid an area(Spence et al. 1996). The magnitude of impacts will, however, likely be related to design considerations and the application of appropriate BMPs for erosion control as outlined in the Water Quality section. An important consideration will be conducting construction efforts during periods when use of the vicinity by listed or sensitive aquatic species is minimal, as discussed in the mitigation measures. In general, impacts to listed fish species can be minimized if in-water work is done during the time of year when fish are not present (as prescribed by WDFW,NOAA Fisheries,and Ecology), and if other appropriate BMPs are employed. dI Direct mortality or disturbance may result during installation of the stormwater treatment facility outfalls and the installation of bridge footings for the new bridge below the OHWM of May Creek. In general, impacts to listed fish species can be minimized if in-water work is conducted during the time of year when fish are not present (as prescribed by WDFW, NOAA Fisheries, and Ecology), and if other appropriate BMPs are employed. Short-to Medium-Term Impacts of Development and Use of the Site The proposal includes a 25-foot building setback from the OHWM along the Lake Washington shoreline for the 22 lots with potential shoreline frontage, or that are adjacent to public land less than 25-feet wide. The land ownership for 16 shoreline lots is proposed to extend beyond the OHWM of Lake Washington to the inner harbor line. It can be reasonably assumed that development of these lots would be typical of most residential development and would include landscaped lawns, shrubs, and small trees. In addition, it is assumed that bulkheads to prevent shoreline erosion would be installed, consistent with common shoreline building I patterns on Lake Washington, along with the recommendation that containment walls are likely to be needed to prevent lateral spreading of potentially liquefiable alluvial deposits. Impacts of future development of duplex and townhome residences is likely to result in construction- related temporary erosion and sedimentation impacts that can be addressed as outlined in the Surface Water section of this Draft EIS. Impervious Surfaces The proposal would decrease the area of on-site impervious surface as the result of removal of existing asphalt and concrete surfaces and mill structures on the site. Although a specific plan is not included in City of Renton 554-1779-017 Barbee Mill EJS—Appendix E—Aquatic Species E-13 August 2003 I - 1 i the current application, it can be expected that setbacks from May Creek that are proposed to be an open space tract would likely be replanted with native species to provide forest cover. The Lake Washington shoreline, however, is proposed to be retained as part of individual building sites and planting as lawn and ornamental landscaping can be expected adjacent to the lake. A reduction of on- site impervious surfaces is likely to have a negligible effect on flows in May Creek because the project site encompasses a small proportion of the overall drainage area and is located at the very downstream end of the watershed. For the lots fronting on Lake Washington, runoff from lawn and impervious surfaces such as patios are expected to sheet flow directly into the lake. This will result in additional runoff directly into the lake, as compared with existing conditions, but more importantly will result in erosion and sedimentation from construction, as well as fertilizers, pesticides, and herbicides from residential lawn care. Development of the site would result in an associated increase in vehicle use of the site, and it would likely increase the amount of pesticides and herbicides running off the site from lawns. However, under the current application, stormwater would be routed to an on-site stormwater treatment facility before being discharged to Lake Washington as described in Section 3.2 of this Draft EIS. Establishment of vegetated setbacks and stormwater treatment would likely reduce the amount of sediment and pollutants draining directly into May Creek and Lake Washington from the project area. Therefore, the biggest impacts to May Creek flows and water quality will continue to originate from upstream of the project site. Vegetation The proposed buffer (approximately 50 feet) along May Creek under the current proposal would be an improvement over existing conditions in some areas, and would be expected to contribute to riparian functions and the maintenance of existing salmonid habitat. However, the proposed buffers along May Creek would fall significantly short of providing full riparian functionality. The primary functions of stream buffers that are beneficial to fish species include provision for large woody debris (LWD) recruitment, bank stabilization/erosion control, removal of sediments and pollutants, regulation of water temperature through stream shading, and regulation of microclimate (May 2000). The required width of the buffer to maintain these functions varies with stream size and the ability of the channel to migrate; therefore, a wide range of recommended buffer widths is common among studies. However, none of the reported studies recommend 0 width, nor do the studies recommend the equivalent of more than several site-potential tree heights (SPTH). A SPTH is the height of a mature tree that can be expected on any given site. In western Washington, a SPTH may range from 50 to 250 feet, based on a 300-year period of growth. Pollack and Kennard(1998)recommend that a buffer width of one SPTH of 250 feet on all perennial streams would be required to reasonably provide a full range of riparian functions and not contribute significantly to loss of salmonid habitat. May (2000) and other extensive reviews provide detailed summaries of buffer width sizes necessary to achieve stream and riparian functions(Knutson and Naef 1997; FEMAT 1993). These studies generally conclude that one SPTH will provide a reasonably full range of riparian functions. Buffer width recommendations for riparian functions from these comprehensive reviews are presented in Tables E-1,E-2,and E-3. 4'- City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-14 August 2003 Table E-1. Riparian Buffer Functions and Appropriate Widths Identified by May(2000) Range Of Effective Buffer Minimum Function Widths Recommended Notes On Function Sediment removal and 8—183 m(26—600 ft) 30 m(98 ft) For 80 percent sediment erosion control removal Pollutant Removal 4—262 m(13—860 ft) 30 m (98 ft) For 80 percent nutrient removal Large Woody Debris 10—100 m(33—328 ft) 80 m(262 ft) 1 SPTH based on long-term natural levels Water Temperature 11 —43 m(36—141 ft) 30 m(98 ft) Based on adequate shade Wildlife Habitat 10—200 m(33—656 ft) 100 m (328 ft) Coverage not inclusive Microclimate 45—200 m(148—656 ft) 100 m(328 ft) Optimum long-term support Table E-2. Riparian Functions and Appropriate Widths Identified by Knutson and Naef(1997) Function Range Of Effective Buffer Widths(Ft) Water Temperature 35—151 Pollutant Removal 13—600 Large Woody Debris 100—200 Erosion Control 100—125 Wildlife Habitat 25—984 Sediment filtration 26—300 Microclimate 200—525 Table E-3. Riparian Functions and Appropriate Widths Identified from FEMAT(1993) Function Number of SPTH Equivalent(Ft)Based on SPTH of 200 Ft. Shade 0.75 150 Microclimate up to 3 up to 600 Large Woody Debris 1.0 200 Organic Litter 0.5 100 Sediment Control 1.0 200 Bank Stabilization 0.5 100 Wildlife Habitat ---- 30—183 m(98—600 ft) The Tri-County response to NMFS's 4(d) rule for the taking of listed Puget Sound chinook salmon includes a proposal for a wider stream buffer than that proposed for the Barbee Mill site. For urban streams like May Creek, the Tri-County response recommends maintenance of a minimum no-touch buffer width of 115 feet, plus an additional 65 feet of restricted use buffer beyond the no-touch buffer (Parametrix 2002). The Tri-County proposal also recommended that these buffers be measured from the lateral extent of any existing channel migration zone (CMZ). The CMZ allows for natural channel City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-15 August 2003 migration processes to occur and promotes floodplain connectivity,which is integral to the formation and maintenance of stream habitat (May 2000). The CMZ concept is based on best available science as reviewed by May(2000)and in CMZ guidelines developed by DNR(DNR 1999). Based on the recommendations presented in Tables E-1,E-2, and E-3, a buffer width of approximately 50 feet, as proposed for May Creek on the Barbee Mill site, will not provide the full range of habitat functions and protections that streams require (Knutson and Naef 1997; FEMAT 1993; May 2000). In addition, the proposed buffer would not be measured from the CMZ, which would provide for stream migration and habitat formation. But some stream habitat functions may be improved. Stream habitat functions such as pollutant removal, sediment filtration, and some water temperature regulation (particularly on small streams) can be improved or provided for by buffer widths as narrow as 35 feet, particularly in areas having a flat topography as on the Barbee Mill site (Knutsen and Naef 1997) and some additional LWD recruitment and bank stabilization due to vegetation is likely. Therefore, a fully functioning riparian stream buffer would not be achieved under the current proposal and substantial improvements to instream habitat are unlikely. Lake Washington Shoreline The Lake Washington Shoreline is proposed to be developed into 24 duplex lots. Eight of these lots would not have direct access on Lake Washington because of intervening public land between the inner and outer harbor lines,which is 15 to 20 feet wide across lots 23 to 28 and about 80 feet wide across lots 29 and 30. An open space tract about 200 feet in length is proposed adjacent to public land on the shoreline. The relatively narrow 25-foot setback would preclude long-term measures to enhance the shoreline environment through establishment of a vegetation community more consistent with a natural vegetation community for aquatic species. This impact is discussed in more detail in the following Mitigation Section,which outlines potential benefits of greater shoreline setbacks. Chemical fertilizers, herbicides, and pesticides are generally associated with residential and ornamental landscaping. The application of these substances can be expected to occur up to the limits of the lot, since landscaping can extend to the waters edge. Direct application of chemicals to the water can be expected from over spraying and inadvertent spillage, and runoff containing chemicals can be expected to flow directly into adjacent waters of Lake Washington. Fertilizers, herbicides, and pesticides affect aquatic resources through direct toxicity or by nutrient enrichment, which can increase plant production and oxygen demand. In addition, it is presumed that the 0.63-acre publicly owned land between the inner and outer harbor lines will be managed as public open space. This applies to approximately 520 linear feet extending from the northerly property line to proposed Lot 30. The width of this public land is approximately 20 feet along Lots 23-28, and approximately 80 feet along the open space tract, Lots 29 and 30. Facilities for public enjoyment of the shoreline are presumed to be developed for limited passive enjoyment, including trails, benches, and interpretive facilities. This would include removal of the existing sawmill and related structures bulkheads on the parcel,which would allow for the formation of more natural shoreline habitat for fish species over time,particularly for juvenile chinook salmon, as discussed under long-term impacts, and mitigation below. If this area is developed for public access, human activities at or near the shoreline may introduce direct disturbances to the shoreline and shallow water habitat areas that are not present in an industrial site where noise is the most constant impact. Disturbance from human activity may include City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-16 August 2003 informal access to the shoreline that can erode slopes and impact vegetation, as well as wading or swimming in shallow areas,which can disturb the use of the shoreline by fish. The current proposal assumes the construction of one individual dock per developed lot. For the current application, this would result in 16 docks up to 80 feet long and 12 feet wide. Under the City of Renton Shoreline codes,that would potentially impact the migration and feeding patterns of juvenile salmonids as well as provide habitat for predators of juvenile salmon. Currently, there are numerous pilings, a large -' raft of logs, and an existing pier. The addition of more docks would further impact juvenile salmonids in the project vicinity. Long-term direct effects to salmonids can occur as a result of nearshore permanent shading such as that created byoverheadpiers, boathouses, and logbooms. The establishment of these structures can disrupt P normal migration and feeding patterns, provide refuge from predators and reduce the production of aquatic vegetation, phytoplankton, and forage fish along the lakeshore (Kahler et al. 2000). Recent research indicates that juvenile salmonids in the southern portion of Lake Washington tend to avoid overhead structures(Meridian 2001;Piaskowski and Tabor 2000). Bulkheads have been shown to reduce the abundance and diversity of fish species and continued effects from the retention or replacement of existing bulkheads can be expected. As summarized by Kahler et al. (2000),bulkheads act to: • Disrupt the migratory and rearing behavior of juvenile chinook and coho salmon, • Prevent recruitment of sediment into the lake necessary for the formation of natural shallow- water habitat that provides refuge, spawning, and feeding habitat for a variety of aquatic species, • Promote bulkhead toe or lateral shoreline erosion, and • Create an inhospitable high-energy environment for juvenile fish. Artificial light cast from overhead piers can also adversely affect juvenile salmonids (Simenstad et al. 1999) by causing delays in migration or a change in migratory routes into deeper water where juveniles would be more vulnerable to predation (Simenstad et al 1999). Artificial light intrusion into Lake Washington would also occur from adjacent residences and street lighting, in addition to overhead pier lighting. This source would likely be of lower intensity than the artificial lighting conditions examined by Simenstad et al (1999); therefore, the intensity of artificial lighting expected from the current proposal may have some affect on salmonid behavior, but the extent of change cannot reasonably be determined. Currently,the City of Renton has no specific restriction on pier lighting. Public access along the shoreline is presumed to be developed pursuant to the requirements of the Renton Shoreline Master Program, which requires "significant" public access on Lake Washington (RMC 4-3- 090-K-14-d). The applicant has not defined a public access program; therefore, for the purposes of this analysis, it is presumed to take one or more of the following forms: • Use of the public shoreline waterward of the inner harbor line is presumed for general public use. This area is about 16 feet wide at Lot 24, 20 feet wide at Lot 28 and around 80 feet wide at the open space tract and adjacent to Lots 29 and 30. City of Renton 554-1779-017 Barbee Mill EIS—AppendixE—Aquatic Species E-17 August 2003 • A public walkway is presumed along the Lake Washington Shoreline for about 700 feet between Lot 29 and the mouth of May Creek within the shoreline building setback area of proposed lots, which is proposed to be 25 feet. Such a public walkway is likely to be located directly at the edge pf the water to reduce privacy impacts on the private residences as much as possible. • Public walkways or trails are presumed to be developed through the buffer area along May Creek, including use of two of the existing bridges for pedestrian crossings. The impacts of public access will depend on the location,width,and use character of the public facilities. Walkways directly adjacent to the shoreline can be expected to have the greatest impact based on the following: • Armoring or bulkheading the shoreline would be required to maintain the trail at the shoreline edge. This would result in loss of opportunities to establish shoreline vegetation,thus narrowing the range or degree of beneficial use provided by reestablishing vegetation. • Use of walkways is likely to introduce a certain amount of runoff directly to the adjacent surface water. A pedestrian trail is unlikely to attract significant pollutant loads, however, periodic cleaning of the walkway may result in discharge of soil and other substances. • People using the trail are likely to leave the trail where beach or shallow water conditions allow, and in doing so,may disturb substrate or directly displace aquatic species by their activities. Pedestrian walkways set back from the shoreline would reduce the impacts of the loss of the opportunity to reestablish shoreline vegetation. The tendency for users to leave the trail can be addressed by fencing and controlled public access for shoreline viewing from boardwalks or enclosed areas at the shoreline, ` with the potential for direct shoreline access at specific locations where beach environments might be created or reestablished through delta deposits. Impacts of Long-Term Development and Use of the Site The major expected long-term change in conditions at the site are expected from resumption of normal delta formation from sediment carried by May Creek after the termination of the dredging that has traditionally taken place on the site to facilitate loading and storage of logs in the water. Past dredging has resulted in near-shore depths of about 12 feet in the vicinity of log dump and sawmill loading areas to the south of the existing sawmill. This compares with the existing water depth of 3 to 4 feet on the west side of the sawmill. As described in the Floodplain Analysis Technical Report(Appendix B) of this Draft EIS, aggradation is expected where the May Creek channel flows across the delta because of the abundant upstream sediment supply, increased peak flows to transport the sediment, and the low gradient across the delta. Historic dredging operations annually have removed approximately 2,000 cubic yards of sediment at the mouth of May Creek downstream of the lowest bridge,where a river mouth bar would naturally build(Barbee Mill 1999). Aggradation at the mouth leads to a backwater upstream that controls the gradient and sediment transport capacity of the delta channel. With regular dredging at the mouth, the gradient and backwater would be temporarily lowered until the floods filled in the channel. Following dredging, some short-term incision upstream would be expected. Without dredging, the river mouth bar would remain and expand laterally City of Renton 554-1779-017 Barbee Mill EIS—AppendixE—Aquatic Species E-I8 August 2003 and the channel would adjust by aggrading. Subsequent increases in flood stages would result in increased channel scour, bank erosion, and likely impacts to habitat and water quality that may not be compensated for by a riparian buffer width of 50 feet,as proposed. In addition, the mouth of the bar would block the channel mouth, causing flood and low flows to shift to either side, further distributing the sediment. Wind and waves created by the wake from boats would further redistribute the river mouth sediment along the shore. Waves would also limit how high the bar at the mouth of the river could build. The river mouth bar would probably not build much more than a few feet above the typical winter lake level. The deposition of sediment to form a delta and the redistribution of sediment can therefore be expected to create more shallow water habitat throughout the project waterfront, which would potentially benefit all aquatic species, including salmonids, such as juvenile chinook or coho salmon. Additional shallow habitat will be generally beneficial by increasing the complexity and diversity of habitat in the nearshore zone and reestablish a shoreline supporting the food web and providing in-water habitat. If docks are developed to serve new residential lots, and the existing boathouse to the south of the proposal is retained, delta formation can be expected to reduce water depth and the usability of the docks over time. This is likely to result in a desire on the part of residents to extend docks, with resulting impacts of additional cover for juvenile salmonid predators and potentially greater disruption of salmon migration routes. Residents may also choose to institute dredging, which would deepen shoreline areas, thereby reducing the habitat benefits potentially provided by the natural creation of more shallow water habitat due to aggradation of May Creek sediments along the shoreline. E.2.1.1 Cumulative Impacts As noted above, during the past century, extensive shoreline modifications on Lake Washington have simplified the nearshore habitat and reduced structural diversity. Most native riparian vegetation has been replaced by residential and commercial development. Today, approximately eighty percent of the existing shoreline is lined with bulkheads that reduce the remaining shallow water habitat and change shallow water substrates. More than 2,700 piers extend into Lake Washington, introducing a different pattern of shade from that produced by shoreline vegetation and changing the underwater habitat from complex (horizontal fallen trees with branches) to simple (vertical smooth pilings). The result of these actions is to remove the complex and diverse plant community and associated food web from the shallow water habitat(USCE 2001). The proposed residential subdivision provides some benefits from increased buffer areas on May Creek, however these buffers are not sufficient to provide for a wide range of riparian functions. The proposed residential development on the private shoreline of Lake Washington would continue the pattern of bulkheads and docks and preclude improving the beneficial use in respect to aquatic resources. The proposal is likely to continue the trends that have resulted in degradation to terrestrial and aquatic habitat that is illustrated by the decline of salmon species. E.3 MITIGATION Impact mitigation includes the following steps: 1. Avoid the impact, 2. Minimize the impact, 3. Reduce the impact over time, City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-19 August 2003 4. Rectify the impact,and - 5. Compensate for the unavoidable impact. Provision of the proposed buffers along May Creek and the Lake Washington shoreline have varying degrees of impacts, as compared to existing conditions, and provide a degree of mitigation of some adverse impacts on aquatic resources. Impacts that consist of narrowing the range or degree of beneficial use of the shoreline are inherent in the permanent change of use to the proposed residential development, with the specific setbacks and presumed uses discussed above. Mitigation that will illustrate opportunities to expand the beneficial use of the shoreline to include greater benefits for aquatic species is outlined below. Mitigation has also been viewed from the perspective of local regulations, specifically City of Renton Shoreline Regulations. These regulations require that the potential effects on water quality, water and land vegetation, water life, and other wildlife (including, for example, spawning areas, migration, natural habitats, and feeding) be considered in the design plans for any activity or facility that may have detrimental effects on the environment(RMC 4-3-090-K-2-a); and require a provision that landscaping be representative of the indigenous character of the specific types of waterway (stream, lake edge, and marshland) and shall be compatible with the Northwest image. The ecological qualities of natural and developed shorelines also require recognition and preservation as valuable resources(RMC 4-3-090-K-6). Unique features and wildlife habitats should be preserved and incorporated into the site(RMC 4-3-090-K- 6). Mitigation of Subdivision Construction Impacts Mitigation of construction impacts can largely be accomplished by controlling erosion and sedimentation as outlined in the Water Quality section of this Draft EIS. Perhaps the most important consideration during construction activities is to conduct in-water work during the time of year when fish are generally not present. Mitigation of Impacts of Short-to Medium-Term Development and Use of the Site Impervious Surfaces Currently, the Barbee Mill site is approximately 85 percent impervious surface. Converting the site to residential development would convert a substantial portion of the site to pervious surface in the form of lawns as well as the proposed open space. This would improve infiltration where extensive areas are provided, however,the 10-foot building setbacks from streets and other buildings and the 25-foot setback from Lake Washington do not provide appreciable areas for infiltration. Mitigation could be provided by providing greater areas of pervious surfaces. This could either reduce the number of units, or the unit count could be kept constant with utilization of larger or taller buildings as allowed by current zoning. Vegetation A 50-foot vegetation buffer along May Creek will enhance riparian function for May Creek. Some functions provided by streamside vegetation may not provide much benefit to the site because many habitat variables (e.g., water temperature and flows) are largely controlled by conditions upstream of the project site. Some functions of vegetation, such as sediment and pollutant filtration, are expected to be controlled by stormwater management. The proposal currently contains no specific revegetation City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-20 August 2003 proposal. Mitigation, including establishment of greater revegetation areas, is included in Section 3.2.1.3, above. There is no proposal in the current application for planting riparian vegetation along the Lake Washington shoreline. The Renton Shoreline Master Program provides general guidance stating that landscaping is to be representative of the indigenous character of the specific types of waterway (stream, lake edge, marshland) and compatible with the Northwest image. The scenic, aesthetic, and ecological qualities of natural and developed shorelines should be recognized and preserved as valuable resources (RMC 4-3- 090-K-6). Landscape practice for residential lots has not required native plantings, low fertilizer, or herbicide plantings, or plantings designed to provide shading or further habitat values. The project could be conditioned to require revegetation of the publicly owned land between the inner and outer harbor lines and of private lots to provide shrubs and trees that would, in time, grow to provide habitat and other values, such as shading. Maintenance of shoreline plantings on public land will require designation of a management entity. Maintenance of plantings on private lots adjacent to the shoreline will likely involve long-term enforcement issues in view of property-owner interest in making recreational use of the shoreline, an interest in maintaining views of the water and a general cultural preference for lawn. Maintaining non-ornamental landscaping on private lots likely will require extensive public education and enforcement. Providing for management of the shoreline setback by an entity other than the individual property owner likely would contribute to better maintenance of non-ornamental vegetation. Erosion Control Under the current proposal, approximately a 50-foot vegetated riparian buffer would be established along May Creek. This buffer would provide an additional measure of streambank stabilization and control of bank erosion; however, some natural erosion can be expected during high flow periods. No vegetation buffers are proposed along the Lake Washington shoreline within the proposed 25-foot building setback, which may be occupied by lawns or patios or other residential). Erosion from construction sites would migrate to the lake over the 25-foot buffer unless substantial BMPs were implemented and maintained. BMPs for water quality are discussed in Section 3.2, Surface Water Resources. Maintenance of existing bulkheads or construction of new bulkheads would effectively control shoreline erosion from wave action. Pollutant Removal and Sediment Filtration A 50-foot vegetated buffer along May Creek is expected to provide some natural control of pollutants and sediment runoff; however, it is expected that most control will be attained by stormwater management (see Section 3.2, Surface Water Resources). On the Lake Washington shoreline, additional pollutant control could be accomplished by adding surface water interception to the 25-foot buffer area between the shoreline and building setbacks. This would involve technical feasibility issues because of the difficulty of achieving gravity drainage from these areas to treatment ponds due to the flat site, but it would add runoff from these areas to water quality treatment facilities. Water Temperature Regulation An estimated riparian buffer width of 50 feet would not be sufficient to provide properly functioning water temperature regulation of May Creek because of shading, but would provide some benefits of additional shading over time as new vegetation matured. This level of shading would most likely serve to prevent or moderate further increases in water temperatures prior to water entering Lake Washington that would otherwise occur with no streamside vegetation. Because of the location of the project site and the City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-21 August 2003 short distance of stream on the site stream temperatures will, however, largely be affected by habitat and water uses upstream of the project site. - There will be little effect on Lake Washington water temperatures from the project's proposed 25-foot setback where private lots abut Lake Washington. It is assumed that little shoreline vegetation would occur in the setback under existing Renton land use regulations, and shading on private lots would be negligible. The project could be conditioned to require revegetation of the publicly owned land between the inner and outer harbor lines and of private lots to provide shrubs and trees that would, in time, grow to provide some shoreline overhanging vegetation and provide some temperature moderation of shallow water habitat. The project site faces largely to the west. The sun angle and height during the summer months will allow shading to occur in the morning, because the sun ruses north of due east after the spring equinox. During mid-day, the sun ranges from directly overhead to slightly north of overhead, allowing overhanging vegetation to shade shallow water areas. The sun in the afternoon is also slightly north of west, allowing crown shading. In addition, the angle of the sun shining through more layers of - - atmosphere in the afternoon reduces heat transmittal. Solar radiation in the spring and winter will be from the south and will shine under overstoryvegetation duringthoseperiods; however, the g h intensity of solar radiation is less than those periods. Plantings of overstory at or near the shoreline will contribute to less total daily solar exposure during the summer and provide some water temperature mitigation for the shallowest near-shore habitat that is most likely to experience elevated temperature, solar exposure, and provide some mitigation Large Woody Debris Recruitment The current proposal would provide for approximately a 50-foot vegetated buffer along May Creek, which would be inadequate for providing natural levels of LWD recruitment. Mitigation measures could include the addition of LWD to provide fish habitat, but this should only be considered a short-term solution and the subsequent effects on channel migration resulting from the redirection of flows would have to be carefully considered. Little vegetation is expected along the Lake Washington lakeshore except for along the publicly owned land, and LWD recruitment would be minimal. As with May Creek, LWD could potentially be placed along the Lake Washington shoreline as habitat. This would likely provide habitat for juvenile chinook salmon in early spring (through April); however, it also would provide additional habitat for non- salmonid predators such as bass. Regulation ofMicroclimate Regulation of microclimate would not appreciably improve under the current proposal and effective mitigations that would provide the benefits of microclimate control are highly unlikely. Herbicides and Pesticides Application of herbicides and pesticides associated with the development of lawn areas would be expected to increase under the current proposal. It is assumed that on-site stormwater treatment facilities would be able to treat all water leaving the site prior to discharge into May Creek or Lake Washington, but due to the proximity of the developable lots along the shorelines, infiltrated waters containing pollutants may enter Lake Washington and May Creek via direct groundwater input. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-22 August 2003 Bulkheads Shoreline protection on Lake Washington is assumed to be necessary on the site due to the southeast facing aspect and the prevailing direction of winds and storms from the south. The current sheet-pile bulkheads on the site were installed at high activity log-handling areas and are not necessary for shoreline protection. In addition, shoreline areas are anticipated to fill in over a period of years with sediment originating from May Creek due to discontinued dredging operations. This will likely provide more shallow area that will dissipate wave action prior to reaching the shoreline and in the long-term will provide accretion of new land waterward of the existing high water line. Delta formation also will provide shallow water habitat along the shoreline. The removal of existing bulkheads on the shoreline would allow for the formation of a more natural , shoreline in conjunction with bio-engineering shoreline protection options. Bio-engineering options presume some area available for natural processes and may be difficult to install in areas where a 25-foot -- building setback is proposed. The wider shoreline buffer areas provided in the public lands between the - inner and outer harbor lines provides the potential for bioengineering options that could include regrading the upland portion of the shoreline and limiting armoring to the lower wetted portion at a shallow angle allowing more natural shoreline processes to occur as shown in Figure E-3. Further options may be explored of varying the shoreline from its existing straight configuration to provide inlets and pocket beaches to more closely replicate natural conditions, as indicated in the conceptual sketch in Figure E-4. Design Typical's a - 4 tAAcud etS #r-iktig 8ums . and Pride suety Factor , .,In c seof SankccUatlse - , j Constant Dationad arm Bunsen tD Cortina SWIM. WAIN' Wti4-RAQtedtfagetatialitaWW1 0 'Bathes Srnak0 g * Ada to Stable Slope , S Prd Manage tor nage of Wand' M.w '"' ,,,„ ,''• a, 4 z - ham arrnppi O waves ft i. '. Stab%Anna-Slone on Stable 5Iopt F 4 4 "�'"" y .1 �. w" yritnSpaces�filed Y yl . ...3mnettlniitrltyer` ,x•` ''* torSiriratueit . . . or F7iterCtaIh .\ S,i ;:''.di* Not Shown:Struciule Entb 79ed into ATIOOnnt - ^;.`-"•-,�. „; : '•} .,t :.5 ; : ,f Flanking Erasion Source: Tri-County 2000 Figure E-3 Bulkhead Modification City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-23 August 2003 i a b sting Rtimap Remit!"vsf t9 Fom!P Jnt Lazge [aars Pravldu NOW and PraeBeach 0 0 � ' cro `fi i # .,upPs am. - �,�►' r r t,,tom 11 fG 41,00 Source: Tri-County 2000 Figure E-4 Shoreline Modification Provision of pocket beaches and other features Opportunities to implement bulkhead removal and shoreline enhancement in areas of public ownership could be coordinated with Washington DNR requirements for removal of existing development on the public lands. As an interim measure, short of bioengineering, or for those portions of the site where dredging has created deep water adjacent to existing bulkheads,the following measures could be implemented: • Removal of sheet-pile bulkheads, or in the alternative, lowering the concrete cap close to the OHWM and providing a graded slope on the landward side will reduce the negative impact of wave reflection and provide an area of soil to support revegetation. It may also be desirable to engineer filled areas waterward of the OHWM to place sand and small gravel substrate that provides suitable habitat for juvenile salmonids in the intervening period prior to substantial accretion from delta formation. • Riprap revegetation by filling the voids in the riprap with soil and installing plant cuttings or rooted plants, which provides more favorable habitat features for fish and wildlife, including shade, leaf litter, browse and additional roughness to slow overbank flow and capture nutrient- laden sediments. • Add small gravel substrate along the shoreline that is more suitable for juvenile salmonids. In-Water Structures Removal of existing in-water structures such as pilings and log booms would improve conditions for juvenile salmonids by reducing the amount of existing cover for predators, such as smallmouth bass, and by not interfering with production of aquatic food resources. Therefore, any measure to reduce the number of overhead structures within the project site would likely benefit juvenile salmonids. Mitigation City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-24 August 2003 of the adverse impacts of residential dock construction and use can be addressed by a number of strategies ranging from avoiding construction of docks, to reducing the number of docks, to specific design and construction measures. Avoidance of the impacts of new docks could be addressed by a plat condition prohibiting private dock construction. This would avoid the potential impacts from use of the docks and from dock shading. Such a prohibition could include the implication that property owners would use commercial moorage at off- site marinas or could provision of alternative moorage facilities such as mooring buoys or floats located at a distance from nearshore habitat for boat moorage and recreation. The latter option could include a dingy dock for access to buoys and floats. Such a dock could include the existing sawmill dock at the northern end of the proposed common area, or a new, smaller dock more centrally located that would avoid proximity impacts on adjacent lots. An option that would reduce impacts, but not prohibit new docks, could involve shared moorage by two or more property owners. In such a case, docks could be developed at property lines to serve two adjacent properties, or a single moorage facility to serve the entire development. Dock construction could include narrower width or materials that allow light penetration. As noted above, long-term use of docks is likely to be hampered by delta formation and could lead to requests by residents to dredge that would reduce the benefits of creation of shallow shoreline habitat. Residential Noise and Lighting Under the current proposal, it is anticipated that noise and lighting effects along May Creek will be reduced over time as an approximately 50-foot riparian buffer is established; however, a 25-foot setback along Lake Washington with no replanting requirements will not serve to reduce residential lighting and noise impacts. Conditions could prohibit outdoor lighting; however, this would be very difficult to enforce over time and may not be as large a source of light as light from building windows. Discussion below of greater setbacks and more effective vegetation buffering has the potential to reduce this impact. Public Access Disturbance Under the current proposal, it is presumed that public access would be provided to meet the provisions of Renton's Shoreline Master Program. Access consisting of trails and other facilities could be set back from the shoreline where public land is present ranging from 20 to 80 feet wide. Setbacks would allow runoff from the pathway would be infiltrated or filtered by soils and plantings established adjacent surface water. Fencing between the trail and the shoreline could reduce damage from trampling of vegetation and erosion from informal pathways. Controlled public access for shoreline viewing from boardwalks or enclosed areas can be provided at the shoreline with the potential for direct shoreline access at specific locations where beach environments might be created or reestablished through delta deposits. In areas of private lots adjacent to the lake, public access would likely be at the edge of the shoreline to minimize impacts on residents. Mitigation could include setting back public access from the shore and reducing residential lawn area. Additional flexibility for mitigation is provided by larger setbacks, as discussed below. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-25 August 2003 Mitigation to Impacts of Long-Term Development and Use of the Site The resumption of normal delta formation is largely expected to produce beneficial impacts as discussed above. There are no readily available mitigation measures for potential adverse impacts of extension of docks or resumption of dredging to maintain usability of the existing boathouse and residential docks that may be constructed. Avoiding construction of new docks in recognition that an area of delta formation is not an appropriate location for moorage is the most effective means of avoiding future impacts. Mitigation through Alternative Buffer Area Width The scientific information cited above suggests that greater buffer areas provide for a wider range of ' - riparian functions on May Creek and would provide for reestablishment of natural elements of the Lake Washington shoreline,which would reduce long-term impacts of residential development of the shoreline and expand the beneficial use in respect to aquatic resources. Greater buffer areas also would provide the opportunity to provide public access and other use of the shoreline with fewer tradeoffs for aquatic resources. The following two conceptual scenarios are proposed for expanded buffer areas on the Shoreline and May Creek: Option A, 50-Foot Buffer This is generally consistent with the proposal for May Creek. Specific changes on the May Creek corridor include: Design modifications to increase the buffer slightly are proposed adjacent to May Creek: • Reorienting the turn-around for Street A to project to the interior rather than into the riparian corridor. • Additional setbacks on the east side of May Creek near the mouth of the stream where the proposed setback narrows to 15 feet from the OHWM. A 50-foot setback in this area reduces the number of townhome units from four to one or two units. For the Lake Washington shoreline,this option is presumed to include two components: • A 25-foot-wide buffer adjacent to the shoreline, which would include restoration of the shoreline to a more natural condition through: > Elimination of bulkheads or reduction in height of existing bulkheads. > Limited regrading to provide a more natural shoreline gradient above the OHWM and providing substrate for plantings near the water. > Planting of a mix of native vegetation on the shoreline,while preserving some view corridors for adjacent residential development. Providing passive public access through a pedestrian trail located 10 to 15 feet from the water with fencing between the trail and waterfront and viewing areas every 100 to 150 feet on the shoreline with benches or other passive features. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-26 August 2003 1 - z f COR-2 ZONE ; ,.,:. g � I s , � aI , _ ___, \II II ° I - II , „ ° ' ,, ° ° ° ° OHW�_ I 7.i I- ` — _ STREET ' ( / ` / n °°al g ,/�50'SETBACK .. s / "/ ° / , .>,°s I Tract„B„ I .�.�u s,j / ... g/ r/ -:.' '(� Water Quality \ / .-..°-s//.3 �!d- PUBLIC LAND <.:'=>. <'l)Tract„C" \klii,\,,\ m / °,� Open ■ ' \\/ / \ //\ ,` . ' 0. /� / i I / NE Sass,\ / ,/‹., I/ Ix /.:2) , INA- N / '''''''::`--—,"/.:Z!.<.;-.- . ' / fF C41 • so ,\ -// A, • OHW ,i- 5... \� / //, / : A J� =c� LAKE ' `\ / ' ' / �� WASHINGTON - — 1;' /' /' Jfi ''1 � b. i Via / i/i • „, ;/�,'.' /4. ` c., 50'SETBACK I, /4§; ) v /1.:/ / 1, ,aL41110 I i/ l' „ --...., ,/f itilv , /ity PUBLIC LAND/./ I�„mg\ , /�/ \ ��// ,, ' I •-•-•...;/" ..„---„,..--- x/6 ,,/,:"*. ''''-1 2, 4, .1:/// K / \-.:-...1-4°55 ,,-,P' / . ,/ N.„1 , , , \_ _ ----• . ---. .' * Iti/ /4:/)7 !` MAY LRAEK .`;';^ 1 Itil; s'/ , I _._ ‘-.14 iI-Ft • `• ,� . " _.LB_ZONF _ 1 b- i srC- /- — _ __ % Anm CT / REVISED 50' SETBACK FROM OHW 88 DUPLEX BUILDING SITES, 13 FOUR AND FIVE-PLEX BUILDING SITES 101 TOTAL BUILDING SITES Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-4-04 SCALE IN FEET ,All Figure E-5 IW Option "A" 50-foot Buffer o 1 0 200 Barbee Mill Preliminary Plat • A 25-foot area for adjacent residences to include yard area, ornamental landscaping, and that would probably be marked by the subsurface containment walls that are likely to be needed to prevent lateral spreading of potentially liquefiable alluvial deposits and would also likely be fenced for privacy. This option would reduce the number of units on the site from 115 to about 100, given the current layout of town homes. The existing zoning, however, allows a variety of residential building types. Within the applicants proposed height limits of 50 feet with Shoreline Management Act (SMA)jurisdiction and 70 feet outside, other types of residential units could be constructed. For example, construction of apartment buildings 70 feet high could result in five to seven story buildings that could accommodate well over 100 units on the 43 lots outside SMA jurisdiction. Likely differences in impacts between Option A and the Proposal include: Impervious Surfaces The current proposal and Option A will have similar setbacks for May Creek, and there will be little difference in impervious surface or its effects on habitat or water quality. The setback for the Lake Washington shoreline, however, would increase from 25 to 50 feet, including a 25-foot vegetated buffer, which would potentially double the impervious surface area which likely would be large enough for natural infiltration of most precipitation, providing for support of vegetation in the setback area and reducing total runoff from the site somewhat. The additional area would provide for other potential mitigation,as outlined below. Vegetation A minimum 50-foot vegetation buffer along May Creek would provide additional area of buffering vegetation at a few additional areas where the proposed buffer narrows and would provide a limited amount of riparian function for May Creek. The mitigation provided by intensive plantings of native vegetation discussed in EIS Section 3.4.1.3, and Appendix D, Terrestrial Plants and Animals, would apply. Overhanging streamside and lakeshore vegetation would provide cover for fish, particularly salmonids, such as chinook salmon, that have been found to associate with such cover (Tabor and Piaskowski 2001). Several effects of landscape and riparian vegetation, such as microclimate control, will,however,not be improved. With a 50-foot buffer, evenly split between residential ornamental plantings and a 25-foot natural planning area, the general policy in the Renton Shoreline Master Program for landscaping representative of the indigenous character of a lake edge could be established with fewer conflicts with property-owner desires to control the character of residential lawns, patios and ornamental plantings. The provision of a 25-foot revegetation area adjacent to the water would provide limited opportunities to establish native plantings as discussed in EIS Section 3.4.1.3, and Appendix D, Terrestrial Plants and Animals. The immediate waters edge could be planted with shrubs and trees that would, in time, grow to provide habitat and other values, such as shading. Some conflicts with the interests of adjacent property owners to enjoy views of the water would be present, depending on the intensity of indigenous plantings and the design of residences. Opportunities to provide view corridors between tree plantings and could be explored. Building design that placed the main living and entertainment quarters on the second floor with garages on the first floor would provide the potential for visual access over shrub plantings and would allow visibility over privacy fences between the lawn areas and areas of indigenous plantings. Maintenance of a separate privately controlled area on lots with the 25-foot-wide section adjacent to the water with a public City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-28 August 2003 I easement or dedication for vegetation management (and public access) would make enforcement of planting and maintenance requirements more effective. Erosion Control Under Option A,the buffer along May Creek would be similar to the current proposal and afford a similar level of protection as described for the current proposal, except where the current proposal contains a narrow buffer adjacent to access roadways near the mouth of the stream where Option A would provide additional area to filter sediments. Along the Lake Washington shoreline, an additional 25 feet of vegetated buffer area would provide for a greater setback of construction from the water. Extensive erosion control BMPs would be required during the process of removal of impervious surfaces and regarding for planting. After initial removal of existing impervious surface and establishment of permanent vegetation, future land alternation would be separated by a buffer which would be beneficial if the shoreline vegetation buffer was established prior to building construction. Pollutant Removal and Sediment Filtration Pollutant removal and sediment filtration along May Creek will be similar under Option A as under the current proposal. The provision of a 25-foot buffer area of restored vegetation would provide limited pollutant removal as discussed above. The provision of an intervening area of more natural vegetation not subject to fertilizer 1 and pesticides would result in some interception of those chemicals from infiltration of sheet runoff and would also largely eliminate over-water drift or accidental spillage. Water Temperature Regulation A riparian buffer width of 50 feet on May Creek would have approximately the same benefits as the current proposal,as discussed above with some potential benefits in areas where current buffers narrow to approximately 20 feet. As discussed above,mature vegetation in a 50-foot buffer may not be sufficient to provide properly functioning water temperature regulation of May Creek due to shading, but would provide some additional shading as vegetation matures over time. The 50-foot setback, split between residential lawn and a revegetation area would provide greater potential for planting of shoreline shrubs and trees that would provide shading of near-shoreline areas through overhanging vegetation and especially in the summer when the sun angle is overhead and would not penetrate overhanging branches. A 25-foot buffer of indigenous plantings at the shoreline would allow substantially greater shading than plantings that could be accommodated in an area of residential lawn. Large Woody Debris Recruitment The 50-foot buffer options, like the current proposal would provide for approximately a 50 foot vegetated buffer along May Creek which would be inadequate for providing natural levels of LWD recruitment. Mitigation measures could include the addition of LWD to provide fish habitat, but this should only be considered a short-term solution and the subsequent effects on channel migration due to the redirection of flows would have to be carefully considered. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-29 August 2003 Establishment of a 25-foot buffer of larger vegetation, such as native trees, would provide little opportunity for LWD recruitment along the Lake Washington shoreline. As discussed above for the proposal, LWD could potentially be placed along the Lake Washington shoreline as habitat. This would likely provide habitat for juvenile chinook salmon in early spring (through April); however, it would also provide additional habitat for non-salmonid predators, such as bass. Herbicides and Pesticides Application of herbicides and pesticides would be expected to be reduced under Option A compared with the current proposal because less area would be developed as lawn under Option A due to the additional 25-foot vegetated buffer along Lake Washington, which would eliminate lawn and ornamental landscaping at to the waters edge and would provide a 25-foot buffer from the waters edge for infiltration and filtering of surface runoff containing herbicides and pesticides. Due to the proximity of the developable lots to the shorelines, however, infiltrated waters containing pollutants may enter Lake Washington and May Creek via direct groundwater input. Bulkheads The additional setback of buildings from the shoreline would allow additional area for regrading the _ shoreline to a more natural grade and allow more space for natural shoreline processes to occur with bioengineered shoreline protection measures without endangering buildings. This would make bioengineered solutions as outlined in the previous section more feasible. - In-Water Structures The same mitigation measures described above for the proposal, involving the removal of existing in- water structures, such as pilings and log booms,would be appropriate mitigation with a larger buffer area. Under Option A,however, it is anticipated that individual docks would not be developed. Public Access Disturbance Under Option A, public access could be provided further from the waters edge. It is anticipated that a trail system would meander 10 to 15 feet from the waters edge. The larger setback accommodates the requirements of the Renton Shoreline Master Program for "significant" public access on Lake Washington with less potential impact than accommodating the access within a 25-foot setback. As under the current proposal,the following mitigative effects would apply under Option A: • Armoring or bulkheading the shoreline to protect the trail would not be required and would allow of opportunities to establish shoreline vegetation,thus narrowing the range or degree of beneficial use provided by reestablishing indigenous vegetation. • It would reduce privacy impacts on the private residences by providing greater setbacks. Residents could fence the 25-foot residential use area from the public use and indigenous vegetation area. • Runoff from the pathway would be infiltrated or filtered by native soils and plantings directly to the adjacent surface water. Fencing between the trail and the shoreline could reduce damage from trampling of vegetation and erosion from informal pathways. Controlled public access for shoreline viewing from boardwalks or City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-30 August 2003 enclosed areas can be provided at the shoreline with the potential for direct shoreline access at specific locations where beach environments might be created or reestablished through delta deposits. Option B, 100-Foot Buffer This proposal would approximately double the buffer width for May Creek. Specific changes on the May Creek corridor include the following: • Eliminating most of the potential for development on the east side of the stream. • Reducing the number of lots fronting the stream from 19 to 15. • Eliminating most development on both sides at the mouth of the stream. For the Lake Washington shoreline,this option is presumed to include two components: • A 75-foot-wide buffer adjacent to the shoreline, which would include restoration of the shoreline to a more natural condition through: > Elimination of bulkheads or reduction in height of existing bulkheads. > More extensive regrading to provide a more natural shoreline slope above the OHWM. > Planting of native vegetation on the shoreline, including more large trees that could be accommodated in the wider buffer area, while preserving some view corridors for adjacent residential development. > Providing passive public access through a pedestrian trail located 15 to 25 feet from the water,with fencing between the trail and waterfront with viewing areas every 100 to 150 feet on the shoreline and benches or other passive features. • A 25-foot area for adjacent residences to include yard area and ornamental landscaping, and that would probably be marked by the subsurface containment walls that are likely to be needed to prevent lateral spreading of potentially liquefiable alluvial deposits, and would also likely be fenced for privacy. This option would reduce the number of units on the site from 115 to 70, given the current layout of townhomes. The existing zoning, however, allows a variety of residential building types. Within the applicants proposed height limits of 50 feet with Shoreline Management Act (SMA)jurisdiction and 70 feet outside, other types of residential units could be constructed. For example, construction of apartment buildings 70 feet high could result in five- to seven-story buildings that could accommodate more than 100 units on the 43 lots outside SMA jurisdiction. Likely differences in impacts between Option B and the Proposal include: City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-31 August 2003 COR-2 ZONE • � ;- IL- -II_ -I� _IL _IL _IJJJJJJL - dr OHW-� 1 L ,7;/ / n n, �.�"MN A 1 I l m / // 100'SETBACK _ -� �'° I- - Tract"B". \/ Water Quality d / / PUBLIC LAND Tract"Cu \.." 44r.o.'— f Open v / ' Space ,� : .'','''.';': L. c.%.< -, 1$7. ...,%/'//7 . ,/,' ,:",,,,,,,..,:iismes , . * ..\ --._ d UPPER/O c= ,, xl , . • i � L OHW �'j � n (9 01 1 ,, /,, �/ LAKE ` / •%,� • /,,, " ?,' �` WASHINGTON v t • 749,///� I�� 100'SETBACK • / : &.t. jj • /,mom / / . '/ • /- ';/,,./ / PUBLIC LAND��• n%µu • l�\,'N, Ai ' 1 cY * g// •'mom. 4 ,` / . .....„.. - \-- . •:, , i )„,,s,..,,,,,..<__,, - - �`/ ! � J MAY CREEK � S/ , / > l DELTA e,/ `- ,l / ..R_flsONF 8M.3 _ N. = - re N 40TH ST...� — REVISED 100' SETBACK FROM OHW 50 BUILDING SITES Parametrlx DATE: 07/24/03 FILE: K1779017P01T14F-3-4-05 SCALE IN FEET lAll Figure E-6 Option "B" 100-foot Setback 0 100 20 W 0 Barbee Mill Preliminary Plat Impervious Surfaces Option B would increase the setback along May Creek by a distance of 50 feet, thereby reducing the potential area of impervious surface. The setback for Lake Washington would increase from 25 feet with no vegetation retention requirement to 100 feet, including 75 feet of replanted vegetation directly adjacent to the shoreline. Combined, this would potentially reduce the impervious surface area. The impervious area likely would be large enough for natural infiltration of most precipitation, providing for support of vegetation in the setback area and reducing total runoff from the site somewhat. However, as previously described, there will be little effect on May Creek flows and habitat due to the reduction in impervious surface due to the location and size of the project site relative to the rest of the watershed. Vegetation A minimum 100-foot vegetation buffer along May Creek would provide substantial additional area of buffering vegetation and riparian functions such as erosion control,pollutant removal, sediment filtration, water temperature regulation, and LWD recruitment for May Creek as described above. The mitigation provided by intensive plantings of native vegetation discussed in EIS Section 3.4.1.3, and Appendix D, Terrestrial Plants and Animals, would apply. Overhanging streamside and lakeshore vegetation would also provide cover for fish,particularly salmonids, such as chinook salmon(Tabor and Piaskowski 2001); however, some effects of landscape and riparian vegetation, such as microclimate control, will not be improved With a 100-foot buffer, split between residential ornamental plantings and a 75-foot natural planning area, the general policy in the Renton Shoreline Master Program for landscaping representative of the indigenous character of a lake edge could be established with fewer conflicts with property-owner desires to control the character of residential lawns, patios and ornamental plantings. The provision of a 75-foot revegetation area adjacent to the water would provide limited opportunities to establish native plantings as discussed in Section EIS Section 3.4.1.3, and Appendix D, Terrestrial Plants and Animals. The immediate waters edge could be planted with shrubs and trees that would, in time, grow to provide habitat and other values, such as shading. Some conflicts with the interests of adjacent property owners to enjoy views of the water would be present, depending on the intensity of indigenous plantings and the design of residences. Opportunities to provide view corridors between tree plantings could be explored. Building design that placed the main living and entertainment quarters on the second floor with garages on the first floor would provide the potential for visual access over shrub plantings and would allow visibility over privacy fences between the lawn areas and areas of indigenous plantings. Maintenance of a separate privately controlled area on lots with the 75-foot-wide section adjacent to the water with a public easement or dedication for vegetation management (and public access) would make enforcement of planting and maintenance requirements more effective. Erosion Control Under Option B, an established mature 100-foot vegetated buffer along May Creek is within the range of effective buffer widths for streambank stabilization and erosion control, as outlined in Tables E-1, E-2, and E-3 (May 2000; Knutson and Naef 1997; FEMAT 1993), whereas the 50-foot buffer options, including the current proposal, is not. Some natural erosion can, however, still be expected during high flow periods. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-33 August 2003 } I Establishment of a 75-foot buffer along the lakeshore would provide substantial additional area to control construction erosion and sedimentation, although removal of impervious surfaces and regarding for planting would require extensive erosion control BMPs. Pollutant Removal and Sediment Filtration As with erosion control, a 100-foot buffer along May Creek is within the range of effective buffer widths for pollutant removal and sediment filtration functions as outlined in Tables E-1, E-2, and E-3. In contrast, the 50-foot buffer under the current proposal and Option A are generally not effective at providing fully effective pollutant removal and sediment filtration functions. Establishment of a 100-foot buffer on Lake Washington, split between a 25-foot residential lawn area and - a 75-foot area for reestablishment of indigenous vegetation, would also allow for effective pollutant removal and sediment filtration. Water Temperature Regulation A vegetated buffer width of 100 feet is within the range of effective buffer widths for providing stream shading and control of water temperatures where as the 50-foot buffer under the current proposal and Option A is not(Tables E-1,E-2,and E-3). Stream temperatures will be greatly affected by habitat and water uses upstream of the project site,but fully functional shading would have the potential of reducing water temperatures on the project site,thus improving habitat for salmonid species. The 100-foot setback,split between a 25-foot residential ornamental landscape zone and a 75-foot-deep area revegetated with indigenous species would provide greater area for planting of larger trees. This would provide more extensive summer shading from two sources: • Greater tree height and density would block morning and afternoon sun. • Overhanging shrubs and trees planted near the shoreline can provide extensive shading, especially in the summer when the sun angle is overhead and would not penetrate overhanging branches. Large Woody Debris Recruitment The additional 50 feet of vegetated buffer required under Option B would provide a riparian buffer of 100 feet along May Creek which has been identified as a minimum recommended buffer width for providing effective LWD recruitment in western Washington assuming the buffer consists of mature forest (Tables E-1, E-2, and E-3). Therefore, while fully functional LWD recruitment may not be achieved with a 100- foot buffer depending on vegetation characteristics, Option B affords recruitment potential that approaches natural levels more closely than either of the 50-foot buffer options along May Creek. Herbicides and Pesticides Application of herbicides and pesticides would be expected to be more reduced under Option B compared with the current proposal or Option A because less area would be developed as lawn under Option B, which would eliminate lawn and ornamental landscaping at to the waters edge and would provide a 75- foot buffer from the waters edge along Lake Washington and a 100-foot buffer along May Creek for infiltration and filtering of surface runoff containing herbicides and pesticides. Due to the proximity of City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-34 August 2003 the developable lots to the shorelines,however, infiltrated waters containing pollutants may enter Lake Washington and May Creek via direct groundwater input. Bulkheads As with Option A, the additional setback of buildings from the shoreline,would allow additional area for regrading the shoreline to a more natural grade and allow more space for natural shoreline processes to occur with bioengineered shoreline protection measures without endangering buildings. This would make bioengineered solutions as outlined in the previous section more feasible. ii In-Water Structures The same mitigation measures described above for the proposal, involving the removal of existing in- water structures such as pilings and log booms would be appropriate mitigation with a larger buffer area. However, under Option B, as with Option A, it is anticipated that individual docks would not be developed. Residential Noise and Lighting Residential noise and lighting would be reduced by moving the sources of noise and light further from the streambanks and shorelines by an additional 75 feet under Option B. In fact, direct artificial lighting would likely be virtually eliminated after replanted vegetation matured over time. Therefore, any impacts from direct lighting on migration or habitat use by migratory salmonids would also be minimal. Public Access Under Option B,public access could be provided even further from the waters edge than under Option A. The proposed trail system could meander further from the waters edge in-between lake access points. The larger setback accommodates the requirements of the Renton Shoreline Master Program for "significant" public access on Lake Washington with less potential impact than accommodating the access within either a 25- or 50-foot setback. As previously described for the current proposal, the following mitigative effects would apply: • Armoring or bulkheading the shoreline to protect the trail would not be required and would allow of opportunities to establish shoreline vegetation,thus narrowing the range or degree of beneficial use provided by reestablishing indigenous vegetation. • It would reduce privacy impacts on the private residences by providing greater setbacks. Residents could fence the 25-foot residential use area from the 75-foot public use and indigenous vegetation area. • Runoff from the pathway would be infiltrated or filtered by native soils and plantings directly to the adjacent surface water. Fencing between the trail and the shoreline could reduce damage from trampling of vegetation and erosion from informal pathways. Controlled public access for shoreline viewing from boardwalks or enclosed areas can be provided at the shoreline with the potential for direct shoreline access at specific locations where beach environments might be created or reestablished through delta deposits. City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-35 August 2003 j ACRONYMS APA Aquifer Protection Area BA Biological Assessment BMP Best Management Practice BNSF Burlington Northern Santa Fe CERCLA Comprehensive Environmental Response,Compensation,and Liability Act CFR Code of Federal Regulations cfs cubic feet per second CMZ channel migration zone COR Center Office Residential dB decibel dBA A-weighted decibel DEIS Draft Environmental Impact Statement DNAPL dense non-aqueous phase liquid DNR Washington State Department of Natural Resources DPS Distinct Population Segment Ecology Washington Department of Ecology EDNA Environmental Designation for Noise Abatement EFH Essential Fish Habitat EIS environmental impact statement _I EPA U.S.Environmental Protection Agency i ESA Endangered Species Act ESU Evolutionary Significant Unit FHWA Federal Highway Administration FRA Federal Railroad Administration I-405 Interstate 405 KCBW King County Backwater -- KCSWDM King County Storm Water Drainage Manual KCSWM King County Surface Water Management Leq A-weighted energy equivalent LWD large woody debris mg/L milligrams per liter mllw mean lower low water mm millimeter mph miles per hour MRSC Municipal Research Center of Washington MTCA Model Toxics Control Act City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-36 August 2003 NMFS National Marine Fisheries Service NOAA National Oceanic and Atmospheric Administration OHW Ordinary High Water OHWM Ordinary High Water Mark RMC Renton Municipal Code PAH polyaromatic hydrocarbon PCB polychlorinated biphenyl PCP pentachlorophenol PHS Priority Habitat and Species RCRA Resource Conservation and Recovery Act RCW Revised Code of Washington RMC Renton Municipal Code ROW Right-of-way SHPO State Historical Preservation Office SMA Shoreline Management Act SPTH Site-potential tree height SWPPP Stormwater Pollution Prevention Plan TESC Temporary Erosion and Sediment Control TIR Technical Information Report TOC total organic carbon TPH Total Petroleum Hydrocarbons TSCA Toxic Substance Control Act USFWS U.S.Fish and Wildlife Service USGS U.S. Geological Survey UST underground storage tank VOC volatile organic compound WAC Washington Administrative Code WDFW Washington Department of Fish and Wildlife WDOE Washington Department of Energy WNHP Washington Natural Heritage Program WSDOT Washington State Department of Transportation City of Renton 554-1779-017 Barbee Mill EIS—Appendix E—Aquatic Species E-37 August 2003 �fl 02 -OLi saw- Golder Associates Inc. AN— Ak 18300 NE Union Hill Road,Suite 200 - Redmond,WA 98052-3333 ® Golder Telephone(425)883-0777 ® Associates Fax(425)882-5498 REPORT TO BARBEE MILL COMPANY ON MICROFILMED GEOTECHNICAL FEASIBILITY BARBEE MILL SITE DEVELOPMENT Prepared for: Barbee Mill Company P.O.Box 359 Renton,WA 98057 y, c,W Loc.. Submitted by: A. C.) " Golder Associates Inc. '' �, 0984 Seattle,Washington ' o s-rs c [EXPIRES 3[If J a3 /7/1,!, S.. J es G.Johns Charles W.Lockhart Associate Engineering Geologist Principal DEVELOPMENT NAMI CITY OF RENT April NG April 4,2002 APR 0 5 2002 003-1228.000 04040.doc RECEIVED OFFICES ACROSS ASIA,AUSTRALASIA,EUROPE,NORTH AMERICA,SOUTH AMERICA April 4,2002 i 003-1228.000 TABLE OF CONTENTS Page No. 1. INTRODUCTION 1 1.1 Site Description 1 1.2 Project Description 1 2. PREVIOUS INVESTIGATIONS 3 3. SITE GEOLOGY 4 3.1 Geologic Hazards 4 4. SUBSURFACE CONDITIONS 6 4.1 Soils 6 4.2 Groundwater 6 5. PRELIMINARY GEOTECHNICAL RECOMMENDATIONS 7 5.1 Preliminary Foundation Design 7 5.1.1 Building Foundation Support 7 5.1.2 Floor Slabs Support 8 5.2 Seismic Design 8 5.2.1 Liquefaction 8 5.2.2 Preliminary Seismic Design Criteria 8 5.3 Site Preparation 9 5.4 Erosion Control Measures - 9 6. USE OF THIS REPORT 10 LIST OF FIGURES Figure 1 Vicinity Map Figure 2 Site Plan APPENDIX • Appendix 1 Logs of Boreholes i- ' Golder Associates April 4,2002 1 003-1228 1. INTRODUCTION Golder Associates Inc. (Golder)is pleased to present this report presenting feasibility- level geotechnical engineering recommendations for the Barbee Mill property located at 4101 Lake Washington Boulevard in Renton,Washington. Our scope of work included a review of the previous geotechnical investigations, feasibility-level engineering analysis,and the preparation of a geotechnical report. The report addresses the general guidelines required by the City of Renton for a geotechnical report. 1.1 Site Description The project site is located along the east shore of Lake Washington where May Creek empties into the lake,as indicated on Figure 1. The site is just to the west of Exit 7 on Highway 405 in Renton,Washington. The property is just under 23 acres in size and is wedge shaped. A set of railroad tracks and Lake Washington Boulevard run along the east property line,and vacant land borders the site to the north. The site topography slopes generally westward,from a high of about elevation 35 feet in the southeast to about elevation 20 to 21 feet along the lakefront. May Creek flows through the southeast portion of the site. Lake Washington is immediately to the west of the site. The property is currently occupied by the Barbee Mill,a sawmill that,until recently, provided specialty cut wood. The mill property contains a bridge across May Creek along the main entrance road. There are about fifteen buildings on site and most of the area around the buildings is covered with asphalt paving. Log containment booms are located offshore. The mill is currently idle. 1.2 Project Description The proposed development concepts for the Barbee Mill site are shown on the Site Plan, Figure 2,provided by Otak Inc. The site plan shows residential lots situated on both sides of May Creek. On the north side of May Creek the site plan shows residential lots for townhomes or attached dwellings situated around a looped access road. The south end of the loop road contains a short cul-de-sac. The site access to this portion of the site will be from the northeast corner off Lake Washington Boulevard. The portion of the development south of May Creek is much smaller and consists of a single row of lots with an access road off Lake Washington Boulevard near the center of the row of lots. The residential structures are expected to have lightly loaded foundations and we understand that no below-grade construction is currently planned. Roadways will be constructed to access the buildings and parking areas,and landscaping - will be introduced to complement the site development. Relatively minor site grading will be required to accommodate the site development north of May Creek. Generally,cuts and fills are expected to be less than five (5) feet in Golder Associates April 4,2002 2 003-1228.000 thickness. South of the creek,the grading will be more extensive,requiring thicker cuts and fills to level two localized ridges. There will be a retaining wall on the west side of the some of the lots. The height of the wall was not shown. I . • Golder Associates April 4,2002 3 003-1228.000 2. PREVIOUS INVESTIGATIONS 1 I Golder submitted a previous geotechnical feasibility report on this site dated August 9, 2000. This report contains revisions to the earlier report to reflect the new site plan and additional comments on geologic hazards. In preparing this and our earlier report,we were provided with portions of a previous geotechnical report for the site vicinity prepared by Shannon and Wilson,Inc.,dated February 1997,and boring logs from an environmental investigation carried out by Hart-Crowser,Inc. dated 9/98. A set of preliminary civil drawings of the proposed project development,prepared by Triad Associates,was also provided to assist in our understanding of the project development concepts. The most pertinent geotechnical data were the geotechnical borehole logs of two borings drilled on the Barbee site to a depth of 111 feet below ground surface and included in the Shannon and Wilson report. In addition,the text of their report referenced conditions on the adjacent properties to the north. The five (5)Hart-Crowser borings were shallow, ranging from a depth of about 9 to 21 feet. The locations of the borings drilled by the Shannon and Wilson and Hart Crowser are indicated on Figure 2 of this report. Copies of the logs of the borings are included in Appendix 1 of this report. Golder Associates April 4,2002 4 003-1228.000 3. SITE GEOLOGY The Barbee site is located geologically in what is referred to as the Puget Sound lowland, which is a north-trending structural and topographic trough that extends from British Columbia to central western Washington. In general,the soil materials in this geologic feature are predominantly glacial materials deposited during several intercontinental glaciations in the region. Other significant geologic features in the near vicinity of the Barbee site,as reported in the Shannon and Wilson report,include the Mercer Island sunken forest and a splay of the Seattle Fault. .The sunken forest is a large intact block of soil that reportedly slid from the upland of Mercer Island about 1,100 years ago during a strong earthquake. The mapped outline of this submerged soil mass extends about 1/4 to 1/z of the distance across Lake Washington between Mercer Island and the May Creek delta. The report also indicates that a southern splay of the Seattle Fault crosses in an east- northeast orientation less than a mile to the north of the center of the Barbee site. However,the report indicates that the closest formation that is cut by this fault is a tertiary rock outcrop of the Tukwila Formation,about three miles to the northeast, and that no Pleistocene or Holocene beds are known to be interrupted by this fault. Specific to the vicinity of the Barbee Mill site,the May Creek delta is the source of significant post-glacial sediment deposition. The creek is currently located on the south side of the delta,but has likely meandered across the breadth of the delta in the geologic past,depositing much of the near-surface soil materials,which currently underlie the site. 3.1 Geologic Hazards The City of Renton requirements for geotechnical reporting,presented Table 18 of Renton Municipal Code RMC 4-8-120,require that geologic hazards regulated by the critical areas regulations be addressed in the geotechnical report if the site contains a geologic hazard. Geologic hazards associated with the site are limited to seismic liquefaction potential because of the topography and soils present on the site. The site is relatively flat and level except along the southeastern edge of the property adjacent to Lake Washington Boulevard. Low slopes are located in this area of the site with vertical relief of less than 15 feet and slope angles of less than 10°. The geologic hazards that are required to be addressed in RMC 4-8-120 include: • Steep Slopes (40% or greater)—We did not observe any steep slopes on the Barbee site; • Landslide Hazards;We did not observe any steep slopes or landslide hazards on the Barbee Mill site; • Coal Mine Hazards—We did not find any reported coal mines, sink holes,surface depressions,mine shafts,mine entries or coal mine waste dumps on the site; Golder Associates - April 4,2002 5 003-1228.000 • Seismic Hazards—Soils that underlie the site,to depths of up to about 60 feet,are potentially susceptible to liquefaction during an earthquake. Mitigation measures for liquefaction are discussed in Section 5.2.2 of this report,and • Erosion Potential—We did not observe any steep slopes or soil exposures susceptible to high erosion present on the site in its current state. However,site soils may be susceptible to erosion during construction. Mitigation measures for erosion control are discussed in Section 5.4 below. Golder Associates April 4,2002 6 003-1228.000 4. SUBSURFACE CONDITIONS Subsurface conditions underlying the Barbee site have been inferred from two (2) borings put down on the site by Shannon and Wilson,and five (5)borings put down by Hart-Crowser. The locations of these borings are presented on Figure 2. Copies of the boring logs are presented in Appendix 1 of this report. 4.1 Soils _ Subsurface conditions underlying the site are generally uniform,and consist of surficial fill materials of up to about 15 feet in thickness,overlying a natural depositional sequence of delta and/or lacustrine sediments,which are in turn underlain by glacially deposited materials. In general,the natural delta and/or lacustrine sediments underlying the fill include soft organic silts and silty clays,which are interbedded with very loose, silty fine to medium sands. These sediments overlie more granular alluvial deposits which consist of layers and/or lenses of loose to medium dense gravelly,fine to coarse sands,and occasional silts,which are likely discontinuous and characteristic of this type of depositional environment. Localized areas of soft sediments may be present within the alluvium. These alluvial sediments extend to depths of up to at least about 60 feet based on the boring logs. The alluvial soils in turn overlie glacial sediments consisting of outwash deposits or glacial till. At the Barbee site,there is an apparent layer of ablation till,which has similar grain size characteristics to lodgment till but has not been overridden by glacial ice,and therefore is not as dense. This ablation till layer ranges from 3 to 12 feet thick and is medium dense to very dense. Very dense lodgment till underlies the ablation till. The boring logs indicate that rock was not encountered in the two deep borings put down at the Barbee site. - 4.2 Groundwater The surficial groundwater level at the site is most likely controlled by the water surface elevations in Lake Washington and May Creek,which runs along the southern portion of the project site. As such,we would assume that the groundwater surface throughout much of the site area would be at approximately elevation 20 feet or so (depths on the order of 3 to 5 feet below the existing ground surface). The two deep borings advanced on the Barbee property encountered artesian groundwater conditions at a depth of approximately 110 feet below the ground surface. Groundwater recharge for this deep aquifer system is expected to originate largely upon the recessional outwash capped Kennydale hill and within the May Creek Valley sediments. Golder Associates April 4,2002 7 003-1228.000 5. PRELIMINARY GEOTECHNICAL RECOMMENDATIONS 5.1 Preliminary Foundation Design 5.1.1 Building Foundation Support Seismic liquefaction and the presence of undocumented fill will need to be considered in the foundation design of the buildings. Although a liquefaction analysis has not been completed for this site,the soil and groundwater conditions recorded in the borings by others indicate a high likelihood of liquefaction during a strong seismic event(Section 5.2.1). Several design approaches can be considered to reduce the potential damage from liquefaction. The relative merits of each design approach will depend on the relative cost and level of protection offered. Foundation support alternatives in liquefaction risk areas include piles,and ground improvement such as stone columns,deep dynamic compaction and others. Alternatively,it may be decided,based on the analysis to be completed,that the risk of liquefaction is relatively low,and the risk of damage will be accepted and no ground improvement will be done. Deep foundations (piles,drilled piers,caissons) can be designed to mitigate potential settlement in fill areas and fully support foundations during liquefaction. If deep foundations are used we recommend that they be founded in the medium dense to very dense glacial soils that underlie the project site. Foundation types could consist of drilled caissons,open-end or closed-end driven or vibrated steel pipe piles,concrete or timber displacement piles,or auger-cast piles. The actual type of deep foundation,including material,length and installation methods will be based on the structural requirements for the buildings,and an economic analysis of the most cost-effective foundation support systems. Downdrag forces will need to be included in the design of deep foundation. Placement of fill adjacent to the structures could consolidate the underlying compressible sediments,which,in turn,will result in downdrag forces. In addition,potential liquefaction of these soils,as discussed in section 5.2 of this report,could result in settlements and downdrag forces as well. Additional geotechnical engineering studies will be required in order to provide a better evaluation of the amount of downdrag force that will act on the deep foundations. Deep dynamic compaction and stone columns are a form of ground improvement that would be intended to improve the subgrade to allow the use of spread footings for the buildings. These methods could be evaluated with further analysis and assessment of the liquefaction risk. If the presence of contaminated sediments and groundwater is encountered on the site, special installation techniques may be required for the deep foundation system in order to minimize contaminant migration across the geologic strata during or after installation. Golder Associates April 4,2002 8 003-1228.000 As an example,techniques could include the use double casing through zones of contaminated soils or groundwater,or vibration installation techniques. This factor will also play a role in the selection of the appropriate foundation system for final design of the project. 5.1.2 Floor Slabs Support Floors for buildings can consist of structural floors supported by the foundation system selected,or slab-on-grade floors supported on compacted fill. This recommendation is provided because the underlying sediments at the site are susceptible to differential settlements due to loading and liquefaction potential. Framed floors with crawl spaces are also acceptable provided adequate ventilation is provided. 5.2 Seismic Design 5.2.1 Liquefaction The fills and alluvial soils that underlie the site to depths of up to about 60 feet are very loose to medium dense,and potentially susceptible to liquefaction during an earthquake. Liquefaction of these soils would result in a loss of shear strength of the soil or the capacity of these soils to adequately support structures supported on shallow foundations. Additionally,the potential development of liquefaction within these soils could result in vertical settlements,and/or lateral spreading of these soils near the shoreline area. The effects of liquefaction on the performance of the building structures can be mitigated by the use of a deep foundation system,which would transfer the building loads to the dense glacial soils beneath the potentially liquefiable alluvial deposits. The foundation system would be designed to withstand the design earthquake and the effects of liquefaction. Alternatively,ground improvement measures such as stone columns or deep dynamic compaction may be suitable to reduce the liquefaction potential. Site improvements,such as containment walls,may be needed along the shoreline area to mitigate the hazard for lateral spreading. Without such mitigation measures,structures located along the shoreline may experience potentially damaging lateral deformations as a result of liquefaction due to earthquake loading. As discussed in Section 5.1.1 of this report analysis of the potential for lateral spreading will depend on the subsurface topography along the lakeshore,and the structural details of the shoreline development. These analyses can be carried out in subsequent phases of the project. 5.2.2 Preliminary Seismic Design Criteria The site would fall within Zone 3 (seismic zone factor z =0.30g)based on the Uniform Building Code (UBC,1997). Furthermore,based on the soils data on the borehole logs, we would classify the soil profile as SF,requiring a specific investigation and analysis in i i Golder Associates April 4,2002 9 003-1228.000 order to ascertain the ground response to earthquake events. This can be analyzed in subsequent phases of the work. 5.3 Site Preparation It is our understanding that site fills on the order of 5 feet or less will be constructed to accommodate the site grading requirements. It is unlikely that this level of filling will cause significant settlements. However,as previously discussed,settlements could be induced as a result of soil liquefaction due to earthquake shaking. Therefore,we would recommend that precautions be taken to minimize the potential impacts of these ground settlements,such as an increased pavement section for roadways and parking areas,and the use of flexible utility connections. 5.4 Erosion Control Measures Erosion control for the site should include the best management practices (BMP's) incorporated in the civil design drawings and may incorporate the following recommendations: • Complete the primary grading during the dry summer months; • Route surface water through temporary drainage channels around and away from exposed slopes and surface soils; • Use silt fences,straw,berms,and temporary sedimentation ponds to collect and hold eroded material on the site; • Seeding or planting vegetation on exposed areas where work is completed and no buildings or pavements are proposed,and • Retaining existing vegetation to the greatest possible extent. • I . Golder Associates April 4,2002 10 003-1228.000 6. USE OF THIS REPORT This geotechnical study has been prepared exclusively for the use of the Barbee Mill Company and their consultants for specific application to the Barbee Mill site development. No warranty,expressed or implied,is made. Our work did not include any subsurface investigations. Our work was based solely on data describing the site conditions that were carried out by others. We have relied on that information in the preparation of this report. Once the site development concepts are finalized,additional geotechnical investigations will need to be undertaken to determine the specific geotechnical conditions and provide final geotechnical design recommendations for the site development. In addition,our scope of work did not include any environmental screening or assessments. This work will be carried out by others. Golder Associates FIGURES • Golder Associates f / 41 i ( Site E . Newcastle -0thSt E 38th St I \1 - NE 30th St Creek \\ \ ...._. _____— ---- umw.—._ - \--\,50, y N Lake i _ Z Ct°,F Washington t Q Renton E W NE 12th St SR 900 FIGURE 1 VICINITY MAP BARBEE MILL PROPERTY "�"""""'""m°'°°""""""'.-."" `°°""" Golder Associates J '' 111141111 c.: 11.1, HCMW-03 HCMW-01(D) i o r -- p-----\* .......‘ \ --X (-<,,, ;7"N ' \ LAKE WASHINGTON O �,I `HCMW 02 \ iff \\ IP.10\ ' t.14\ it % tuft- 1, "It , --------.. /Ill.0 ..4 1*. 4 I - \ / 1. k 4 0\\ ...-0 0 i. ,1 i 4 , „.4 e\ �,. ._ri 'l'i .\41 ��/ CMW-04 /� `k : <4.,•:,• At 7 Sigirrir* �kWB-10 ` ■ . i 7, Ativoi.440\ . NiAlw_q;!4,10,__ _......„--- ii-r14,1111prip .,....„„... ...... . ,..7:7\#O\ 1 -- 0.-, A- f v4rirrow..... 0 . '17-4 — p--. .......----- ,,,„___ s\ , aullts ,.. ,c. AN ,_____ ravair-..-ith. \fildillik ,-.10- --- -----a--i-0-=----- , .iwa- ili ts► ,f ry/JgliMi1l,�► �'1.--- > _ _ _ _ _ Is .. ��-'�rl�I 1;%1i�r'� i`t'�_= f��11�i � \_ HCMW-05(D) !s� �`�.� � � �t�i i �-�J 11_ . 1-405 • Ai ' — - — .--— — —. ——.—— ----- i -----\ , . , r______________ 1---- \ I \ LEGEND A r•-• ©HCMW-04 sli NUMBER AND APPROXIMATE LOCATION OF BORINGS PERFORMED / BY HART-CROWSER,9/98 Z// SWB-7 NUMBER AND APPROXIMATE LOCATION OF BORINGS PERFORMED 0 200 400 FIGURE 2 BY SHANNON&WILSON,3/97 REFERENCE: BASE DRAWING PROVIDED BY SITE PLAN OTAK,INC., UNDATED,RECEIVED 4-3-02 FEET CUGINI/BARBEE MILL WA DCabe1K:lProjects120001003122810031228F01.dwg14-4-211:33pc0031228BA021i:- Golder Associates APPENDIX 1 LOGS OF BOREHOLES Golder Associates JUL-31-2000 15:07 CENTURYPACIFIC 206 689 7210 P.09/30 TAASTERLO 2171ti7 _ T .1-- MATERIAL DESCRIPTION X 2 it Standard Penetration Resistance . n (140 lb. weight,30' drop) '= E :E 2 °0 . A Blows per foot 41 a Surface Elevation:Approx. 25 Feet c H �__ 0 ,0 20 40 60 -\Asphait and base. 0.3 Gray SAND; moist;SP. 2-5 ti • c - I :0 . 4.0 t Loose,gray,fine to medium sandy U 5 1441 GRAVEL; moist;trace of wood fragments; aJ (Fill) GW. 7.0 .' 'a ;tii• 3= .6 Loose,gray, silty,fine SAND; wet at 5 feet; (F117) SM. 't 4I o 10 Stratified,loose, gray,fine to medium •"-i- a SAND and very soft, brown, slightly sandy 1a.s ' 'I eI i £. . . . . . . . . ' .0.• SILT and silty fine SAND; wet; (Fine - e= 15 r Alluvium) SP/ML. •• Very loose to loose, gray, slightly clayey, -:,-, 'I organic silty,fine SAND and fine sandy 20A I 20 • it -__ _ • SiLT;wet;lenses of coarse sand and I clayey silt;trace of organics; (Fine + Z 0 • • • III Iluvium/Depression Filling) SM/ML. ill . - Medium dense to dense, gray,trace silt to 10= 25 —0 . . . . , , silty,sandy GRAVEL, locally gravelly sand; wet; (Coarse Alluvium) GM-GW. I • i 121 30 --0- 131 34.0 G' . Very dense to medium dense, gray,clean 1a= 35 •— - 5 to silty, fine to coarse SAND grading to t slightly silty to silty, sandy GRAVEL; wet; •: I. 16T (Medium to Coarse Alluvium) :•�' .1. . • . . , . . , , , , • • , SP-SM/GP-GM. • r 1e= —�. . . 42.0 1 Medium dense, gray, slightly silty, sandy • 1'= - GRAVEL, grading to gray, silty, sandy I e GRAVEL;wet; layers of gray,fine to e` "I45 • medium sand; (Medium to Coarse • ' Alluvium) GP-GM. �i 10i �= 50 •. . . • . . , . . . . . . 52.0 Loose,brown,fine to medium SAND, •.-. r trace of gravel, grading to silty SAND; wet :,i to moist;lenses of gray, slightly clayey silt 50.0 t 21I 55 e and gray, slightly clayey, sandy silt; 1. (Medium Alluvium) SP-SM/ML. 22 CO1frRdt,rD NIX. rAOC •7 ' LEGEND 0 20 40 60 • %Water Content • Samplo Not Recovered e■c Surface Seel I 2"O.D.Split Spoon Sample ® 'Annular Sealant Plastic Limit l 0—I Liquid Limit 3"D.D.Shelby Tube Sample S=S Piezometer Screen Natural Water Content cam Grout • U Water Level -- JAG Development • Renton,Washington NOTES • 1.The stratification lines represent the approximate boundaries between soli types.and the transition may be gradual. LOG OF BORING SWB 7 2.The discussion in the text of thie report it necessary for a proper undrstendinp of the nature of subsurface materials. •' December 1996 W-7443.03 3.Water level,If indicated above,is for the data specified and may vary. a.Refer to KEY for explanation of"Symbols"and definitions. • SHANNON&WILSON,INC. FIG. A-7 5_UM letter symbol hosed on visual destificstion. a.eaetwlio.1•ed ttn,tvnm,nel omruri.nt■ Sheet 1 of 2 JUL-31-2000 15:07 CENTURYPACIFIC 206 689 7210 P.10/30 MATERIAL DESCRIPTION o A ns u Standard Penetration Resistance (140 lb.weight,30' drop) H A 3 g. A Blows per foot Surface Elevation:Approx. 25 Feet p 4 • • 20 40 60 Gray, slightly clayey,sandy SILT;wet; 80.0 .�; 2a1 • \(Lacustrine Deposit) ML. .l 83.0 i%.t. Medium dense to dense,gray, slightly silty .. I. to silty,line to coarse SAND,trace of .. 24= 65 --A- . . . _ _ . . . • , •: , Sv/4• 411. gravel; moist; (Ablation MI SP.-SM. •r Very dense, slightly silty, coarse SAND, ee.o , trace of gravel;wet; (Till) SP-SM. . •i 261 70 •, • • • . • . , . . . . . • - • 50/4".4 Very dense, silty,fine SAND,trace of C;L. gravel; moist; increasing gravel at 85 feet; ▪`i. (Till) SP-SM. �, 4e= 75 W-A 1 27= BO • 60/6.- -- r •1. . • r 24= 85 1.074's7A .,. •.1 Hard, gray, silty CLAY; moist; locally 90 i . . . . . . . . . _ i . . , laminated (Glaciolacustrine Deposit)) 29/ �gl CL-CH. • . 95 / . 99= 100 . . . . . . •. . . . . ^ / 105 Very dense, silty,sandy GRAVEL grading 10e.0 II to slightly silty,sandy GRAVEL; wet; ► lit fractured rock at 110.5 feet; wood at 111 ► 110 -• feet;artesian conditions at 170 feet; 111.0 31= Ice-Contact Deposit) GP•GM. • BOTTOM OF BORING COMPLETED 11/20/96 115 LEGEND 0 20 40 60 • %Water Content i • Sample Not Recovered MD Surface Seal X 2'O.O.Spilt Spoors Sample •:'■*:' Annular Sealant Pleetic Limit I--110--1 Liquid Limit = 3"O.D.Shelby Tube Sample 6=15 Piezometer Screen Natural Water Content ® grout $ Water Level — - JAG Development Renton,Washington NOTES 1.The etretfication linos represent the approximate boundaries between LOG. OF BORING SWB-7 ma types,and the transition may be gradual. 2 The discussion in the text of this report is necetsery for•proper understanding of the nature or subsurfeee materials, 3:Water level,if indicated above,is for the data specified and may very. December 1996 , , • ,. W-7443-03 4.Refer to KEY for explanation of'Symbols'and definition/. SHANNON&WILSON. INC. FIG. A-7 6.USC letter symbol based on visual Goasification. C•otaohnind and Emit mental conuamu•• Sheet 2 of 2 JUL-31-2000 15:07 CENTURYPACIFIC 206 689 7210 P.11/30 MATERIAL DESCRIPTION ® o 2tStandard Penetration Resistance t E E c (140 lb. weight,30' drop) a >• cn,?� . A Blows per foot Surface Elevation: Approx. 22 Feet p a� o r 2 60 Asphalt and base. 0•2errt Dark brown SAND; moist;SP. 1.0 '`T 0 Gray SAND and GRAVEL; moist; SP/GP. 2.0 '.� t Very loose to loose,gray, slightly slily, •;••f. 21 s --. gravelly SAND; moist; wet at 8 feet; .I Q scattered wood pieces; organics soils and .• r 31 sr ill i slit chunks;locally trace of clay; (FIII) 11 0 . ,_ 2 10 12e ! SP-SM/GP. oilIPPIIIP • Interbedded, loose to medium dense,gray, a • fine to medium SAND end brown,slightly g 1 5 r sandy, peaty,organic SiLT;wet;lenses of aZ • , � wood fibers end peat; gravels noted at •- :►I 17.5 feet; (Medium Alluvium/Depression Filling) SP/OH. a= 20 Loose, gray,silty, fine to medium SAND; • wet; organic lenses and partings; (Medium ..A 10= 25 . Alluvium) SP-SM/ML. � 27.0 . . . . Denise,gray, sandy,•fine GRAVEL; wet e 0 ill_ . 1angular to subrounded; (Coarse Alluvium) 2e.o . GW. 31.0 121 30 . . . Medium dense,gray, slightly gravelly, 131 slightly clayey, silty SAND; wet; organics; 94'0 '� t4�••• 35 (Fine Alluvium) SM. 1 Medium dense, gray, fine to medium po 151 SAND,trace of gravel; wet; (Medium e !Alluvium) SP, o lei 40 Medium dense to dense,gray, sandy, fine Q to coarse GRAVEL, local trace of; siit; 43.0 l_. »I • wet; mud bubbling at 37 feet; (Coarse 44'o ti', 1ei 45 . sr. uvium) GW. Stiff,brown, slightly clayey SILT;wet; ,ti.• (Lacustrine Deposit) ML. :; "I 50 0 Very dense to medium dense,gray, slightly clayey,trace to gravelly,silty '• SAND; moist; (ice-Contact • • Deposits/Ablation Till) SM. 6eA 22Z 55 Dense to very dense, gray,slightly silty to :; j. silty,fine to medium SAND;.wet; gravelly :A - CONTINUED NEXT PAGE •;.. T • LEGEND 0 • 20 40 60 . • %Water Content 41 Sample Not Recovered E03 Surfece•Seal 12"O.D.Split Spoon Sample ilCE1 Annular Sealant plastic Limit I--•-1 Liquid Limit 3"O.D.Shelby Tube Semple a=a Piazornator Screen Natural Water Content •`' •I'�Pd Grout_ . 2 Water Level • • JAG Development Renton,Washington NOTES 1.The stratification ranee represent the approximate boundaries between • soil types.end the transition may be gradual. LOG OF BORING SWB-1 O 2.The dscuselen in the text of this report is necessary far a proper • undosatandinp of the nature of subsurface materials. 3.Water level,if indicated above,is for the date specified and may vary. December 1996 W-7443-03 4.Refer to KEY for explanation of'Symbols'and definitions. SHANNON&WILSON,INC. i FIG. A-9 5.use letter symbol based on visual classification. • SHANNON EnvironmentalConeu Sheet.1 of 2 CO • . -0 .�.. °I....... .... ... = M �N m „"p cv a• � �' 0 vm t h � o a- CC O•�• •1 ? C •J c C4. O ca cr. N 0 i. Q. ........ mF E .... U) C , coo ti • $ ° y Z_ z co a• m _ f 0 * := n m3 z . �n w C • u l7 . CO co 51 N y� • aas 'I rzco O rn al "" - _ 0 • O -0 01 in o is o . in 0 to o to 0 to 2 •»'43da0 to r • n co ao 0 o, O O •- •- "r E Z -.- r" e •- m JBZ2M O Ou puma - • • soidweg H H H H H n g 11 o i an co 4 E Era q 64 al m 2 E ro u. en o▪ 0} IS to ftfl NI EA paop .eoo SW ..F.0= ® WI Z • c oa ont oa ` 41 a a ZW0 LL 1 N +•• 4'• ®. O o p o. ° a t H a .▪ N7 ran. c in O GN to > .... Y ® N o + VI o .� o m LL w a .r.0 o � 'vir- m m p � o c � 5 ..c � � � 0 Q N C W m a C "- m • > •$,4 o a - Q W t0' tr. ten "'- a~ ao 'a-6 .0 Q c �4. Doti- C 43�o) r p v► >• crs e� C gD m W O `JO .01 q!a W F- a at • •1'i7 oc = r a In 1.. 0 .m_ a >.... • rm .+ 00 zIntn ..°_ ■4So . E gm'c y =° q o c`>o co mV aka a 2 cg i m C � c coEOC • a' • r' 3°aE o mI 0 4+ (7 v I5P ai N N c+J � � a � Ll m {� 11 CO m t.O Cmi 0 Q O d. rl LJ n N o? V Iff M! w o " ). 09 0 ON Quu) • t1 Jc M ti • JUL-31-2000 15:06 CENTURYPACIFIC 206 689 7210 P.07/30 Shannon&Wilson.Inc.(S&W),uses a soil GRAIN;SIZE bEFINITiONS classification system modified from the :,...._ :��;•, . Unified Soil Classification(USC)System. • , DESCRIP110N? ••;. .SIEVE SIZE • Elements of the USC and other definitions FINES <ft2oo(0e13a mil) are provided on this and the following page. Soil descriptions are based on visual- SAND" manual procedures(ASTM D 2488-93) •F •N200-e40(0.4 mm) unless otherwise noted. •Medium •#40-*10(2 mm) Coarse •010-tl4(5 mm) S&W CLASSIFICATION GRAVEL' OF SOIL CONSTITUENTS • •Fine •e4-3/4 inch • •Coarse •3/4-3 Inches • MAJOR constituents compose more than 50 percent.by weight,of the son. Major COBBLES 3-12 Inches constituents are capitalized(SAND). BOULDERS a 12 Inches - Minor constituents compose 12 to 50 percent •Unless otherwise noted,sand and gravel,when present, of the soil and precede the major Constituents range from line to coarse in grain size. (silty SAND). Minor constituents preceded by 'slightly compose 5 to 12 percent of the soil (slightly silty SAND). RELATIVE DENSITY/CONSISTENCY • Trace constituents compose 0 to 5 percent of • S the soil(slightly silty SAND.trace of gravel). COARSE-GRAINEDOILS ' .FINE-GRAiNED►COHESIVE sons• N,SPT. RELATIVE N,SPT, RELATIVE • MOISTURE CONTENT DEFINITIONS BLOWS/FT. DENSITY BLOWS/FT. CONSISTENCY • 0-4 Very loose <2 Very soft Dry Absence of moisture,dusty,dry to 4-10 Loose 2-4 Solt 4-8 Medium stiff the touch to-30. Medium dense 30-SO Dense 8.15 Stiff Moist Damp but no visible water Ovor 50 Very dense 15.30 Very stiff Wet table free water.from below water ` Over 30 Hard • ABBREVIATIONS WELL AND OTHER SYMBOLS All) AtTime of Drilling riTi Cement/Concrete I. Asphnit or PVC Cap Elev. Elevation ft feet fiN Bentonite Grout ® Cobbles HSA Hollow Stem Auger . . ID Inside Diameter IEN Bentonite Seal iii"4" Fill in inches Slough CC Ash • lbs pounds Mon. Monument cover Elp Silica Sandi Bedrock N Blows for last two 8-inch increments • NA Not Applicable or Not Available Eg0 ft). -I.D.PVC Slot) (O.OtO-Inch Slot) n 0D Outside Diameter • OVA Organic Vapor Analyzer • PID Photolonlzadon Detector . ppm parts per ration JAG Development PVC Polyvinyl Chloride , Renton,Washington SS Split Spoon sampler • • SOIL CLASSIFICATION SPT Standard Penetration Test AND LOG KEY USC Unified Soil Classification WI-1 Water Level Indicator . February 1997 • W-7443-04 SHANNON&WILSON,iNCl FIG. A-1 • Geoted�lusl end EnvUa�mental Cms90nB ..,Sheet 1 of 2 JUL-31-2000 15:06 CENTURYPACIFIC 206 689 7210 P.08/30 t NIFtE <:. .. ' U D,SOIL CLASSIFICATION SYSTEM • • . • (From ASTMi D 2488=93.&2487-93)•• 'i'.:• •,•': MAJOR DIVISIONS GRO f�C SYYMBOMBO P L® TYPICAL,DESCRIPTION Clean Grsval6en Gw io Ira Wall-Graded CGravets,Gravel-Sand Gravels (less then O Mbd R1te ures,L or No Fines it ( than 50% 5%lineal GP , / Poorly Graded Gravale,G svet.sand ofmuse _ 4 Miztwc ,Little or No Fins fraction retained Coarse-6 mined on No.4 stow) Gravels WM® GM Silty Gravels,GraveISandS11 Mixtures Solis(more than Fines Moro - 50%tota/ned on that,12%tines) GC Clayey Gravels,Gravel-Sand-Clay No.200 stew) Mbdurea Clean Sends SW Wen-Graded Sands,Gravelly Sands, Sends ••' Lillie or No Fines (less than %i=- (50%ormom sxgnea) se, • • Poorly Graded Send,Gravelly Sands, of coerce Little or No Fines Also Dual Symbols traction • - tor s•t2 Fines passes the Sands with° SM Silty sands,Sand-Slit Mbdures (l e.GP•GM))O No.4 slave) Flnes(more f.;.•. than 12%tines '. Sc Clayey sands,Send-Clay Mixtures Inorganic Silts of Low to Medium ML Plastcity,Rock Flour,or Clayey slit. Slits and pays inorganic with Slight Plasticity (liquid l(m!t ' Inorganic Clays of Low to Medium • toss than So) CL ys j s� y.Gys,ravelly s,Sandy Clays, Fine-Grained Soils Organ a =- Organic Silts and Organic Silty Clays of (SO%armors ...—_a _ Low Plasticity passes ?00 slave) C///�� Inorganic Clays of Medium to High N CH Plast fay,Sandy Fat Clay,Gravelly Fat • Clay Sifts and Clays Inorganic inorganic sole,Micaceous or (liquid limit MH Diatomaceous Fine Sands or Silty Sob, - 50 or more) Elastic Sat �Organic OH l/�' Organic Clays of Medium to High 1/ Plasticity,Organic Slits Highly Organic Primarily organic matter,dark in PT .' Peat, Swamp Solis with High Soils color,and organic odor Organic Content See D 4427-92) • • • NOTES JAG Development 1. Dual symbols(symbols separated by a hyphen.Le.. Renton,Washington SP-SM,slightly silty fine SAND)are used for sod with between 5%and 12%fines or when the liquid guilt and plasticity index values plot in the CL-ML SOIL CLASSIFICATION area of the plasticity chart. AND LOG KEY 2. Borderline symbols(symbols separated by a slash, i.e.,CL/ML,silty CLAY/clayey SILT;GW/SW,sandy February 1997 W-7443-04 GRAVEL/gravelly SAND)indicated that the still may fall into one of two passible basic groups. - - SHANNON&'WILSON,INC. FIG. A-1 G0�? and Environmental d Shetet2of2 AUG-01-2000 09:38 HART CROWSER, INC. 206 329 8964 P.04/09 Boring Log and Construction Data for- ,-- , , Monitoring Well HCMW-ID Geologic Log Monitoring . Well Design • v u. Sample N do 3 inches of ASPHALT over medium dense, ••'; •►•. —.. damp, brown, sandy GRAVEL. A �- - '' ' ►i:•' - Very loose to medium dense.moist to wet. g_i 13 •• •• - gray, medium fine SAND with occasional silt A - ..•. .•••. lenses and occasional wood fragments. - - .�•.: ....• . _ A _ s7D / / 5-2 7 J . 5— s-3 Ia11'A. _ / _ s-4 T e -A. 5-5 - 3 _ _ / _ 5-5 2 Very soft to soft, wet. Crown, sandy V - ,prganiC SILT with sand lenses to 3 [Tithes s-7 A. I _ _ and wood. / f S-8 7 2 - - 4 4 •. -. I/Ad IA _ s-s A• 3 - _ 15— Loose to medium dense. wet, gray,medium s-10 - 6 — - - fine SAND with thin silt layers. A - 5-11 - a _ ,� S-12 le - - - A - �; 20 Bottom of Boring at 20.0 Feet. - Completed 0/2S/98. • - _ I 25— — — 30— _ — • IN I. Refer to Figure A-I for explanation of descriptions and symbols. 2. Soil descriptions and stratum lines are interpretive -_ and actual changes may be gradual. J-4948-10 woe 3. Ground water level,if Indicated,Is at time of drilling (ATD!or for date specified. Level may vary with time. Fagiiie A—CO AUG-01-2000 09:38 HART CROWSER, INC. 206 329 8964 P.05/09 Boring Log and Construction Data for Monitoring Wel HC..1 M11--2 . Geologic Log • Monitoring Well Design Casing Stickup hi Feet: -0.3 doi, Sample N • o.5 0 3 inches o1 ASPHALT over medium dense, 'i♦i�i�•i♦i♦i - -� • moist,brown, sandy GRAVEL. J- - •;••�• ,•�•�•. - 4 4.4 4. 44;•101 ' Medium dense.moist,gay.medium fine 1- lira• SAND with trace gravels and wood.- J S-i 2t ?_. - No recovery. .s-2 34 .:�; all) • 5— Loose to medium dense,wet, gray, gravelly - �' - SAN'J wan cobbles. :1: 5 i2 - 5-5 7 - - 10-4, grown, organic SILT. — --• Bottom of Boring at 10.0 Feet. - 'Completed 9/25/98. - • 15— — — • 20— — — 25— — — 30— — — 1.Refer to Figure A-I for explanation of descriptions II and symbols. 2. Soil descriptions and stratum IineS are interpretive and actual changes may be gradual. J1,-49 13- D/v8 • 3. Ground water level,if indicated,is at time of drilling - _, (AID)or for date specifies Level may vary with time. Figure A-0/ AU.G-01-2000 09:39 HART CROWSER, INC. 206 329 8964 P.06/09 • Boring Log and Construction Data for Monitoring Nei h'CI4N-3 4 Geologic Log Monitoring Well Design Casing Stickup in=eet: -0.3 aSI Sample N • o5. • Asphalt over loose,moist to wet,gravelly, I +� ; - medium to coarse SAND with silty layers. - .+. .w�. _ • _ - 4 A S-1 I t ATO - - 5- - - . I 1- Grades to non-gravelly with wood chips. — - 5-2 X a - •1 - Bottom of Boring at 9 Feet. _ .10- Completed 8/5/90. - 15— — • I - 20— — — i - _ • 25— — r - • 30— _. int I. Refer to Figure A-1 for explanation of descriptions and symbols. 2. Sol descriptions and stratum lines are interpretive and actual changes may be gradual, J-4 - Wee 3. Ground water level,if indicated.is at time of drilling CATO)or for date specified. Level may vary with time. Fide A-412 AUG-01-2000 09:39 HART CROWSER, INC, 206 329 8964 P.07/09 Boring Log and.Construction Data for 1 Monitoring Nell HCMIW-4 • . Geologic Log Monitoring Well Design r se. Sample N Aspnalt over medium dense.moist to wet. %i • i•i - non-gravely to slightly gravelly, fine to - AkAl Alb..4 - medium SAND. - / - 5-I X 14 - / ' - 5— — — 5-2 X 14 — 10 Bottom of Boring at 10 Feet. ,Eompieted 8/5/00. - - t5— — — 20— — • - - 25— — — • • 30— — — 1.Refer to Figure A-1 for explanafi of descriptions and symbols. HiaRTCROWSER 2. Soil descriptions and stratum tines are interpretive and actual changes may be gradual. JI948—/0 8/99 3,Ground water level, if indicated.is at time of drtiting (ATO)or for date specified. Level may vary with time. F VC A->3 • AUG-01-2000 09:40 HART CROWSER, INC. 206 329 8964 P.09/09 Boring Log and Construction Data for Monitoring Weil HCMIV-So Geologic Log Monitoring Well Design L u �u. Sample N oC 0 - Loose.damp to wet. gray and brown, A� s• - non-silty 10 very silty,medium to fine - - SAND. 5.-1 Z 9 - _- 0 5— - - _ 0 - - g , _ _ . r 5-2 Z e ` p /, . 10- - - 'Interbedded, stiff, wet,brown PEAT, gray SILT, and medium dense, gray,medium - ^ - SANG, 0 '' '' 5-3 X II - 0 i:,/:, - - 0 15— _ _ _ . 19 / . • 0 / / - _ - ro 4 _ IT 20— /•� — . -- -4 — Dense to very dense, wet, gray,fine to - medium SAND. - - S-s 74 - - . _ •-:-• - 25-- - ; — • 1 - '`' - • _ ,• �: -\- Grades to medium to coarse SAND with 5-45 X 36 • - - • gravel, ( . - Bottom of Boring at 29 Feet. 30— Completed 8/5/80. - - !1 I.Refer to Figure A-1 for explanation of descriptions II - and symbols. HARTCROWSER 2. Soil descriptions and stratum lines are interpretive and actual changes may be gradual, -4940 40 WM 3. erourtd water level, if indicated,is at time 01 drilling (ATD)or for date specified. Level may vary with time. Fie A-85 Lull 02 -0(lu(y ) OLD PREPARED FOR: CENTURY PACIFIC, L. P. MICROFILMED PRELIMINARY TRAFFIC IMPACT NALYSIS BA RBEE MILL PROPERTY RENTON, WASHINGTON DEVELOPMENT PLANNING CITY OF RENTON APR 0 5 2002 RECEIVED PREPA D BY: HDR ENGINEERS, INC. MARCH 28, 2002 Preliminary Traffic Impact Analysis BARBEE MILL PROPERTY Renton, Washington Prepared for: Century Pacific, L.P. / 1501 4th Avenue, Suite 2140 K 4 Seattle, Washington 98101 �w®F wqs (206) 689-7203 Prepared4p4 0,. MOW by: o • � ��'�SiONAL ' HDR Engineering, Inc. - 500 — 108th Avenue NE, Suite 1200 EXPIRES 10/23/Q Bellevue, Washington 98004 (425) 453-1523 March 28, 2002 TABLE OF CONTENTS Introduction 2 Existing Conditions 5 Intersection Channelization 5 Traffic Volumes 5 Traffic Volume Forecasts 8 Trip Generation 8 Trip Assignment 9 2005 Forecasts 11 Traffic Impact Analysis 12 Level of Service Analysis 12 Mitigation 16 Summary 17 Appendix A—LOS Calculations 19 FIGURES Figure 1-Project Vicinity 3 Figure 2-Proposed Site Plan 4 Figure 3-Existing Intersection Channelization 6 Figure 4-Peak Hour Existing Traffic Volumes 7 Figure 5-Project Trip Assignment 10 Figure 6-2005 Peak Hour Traffic Volumes Without Project 13 March 28, 2002 1 Barbee Mill Property Traffic Impact Analysis INTRODUCTION This report documents the preliminary traffic impact analysis performed for the proposed Barbee Mill Property Development to be located in north Renton,Washington, along the shore of Lake Washington. This report documents existing traffic volumes and intersection channelization in the vicinity of the proposed development, estimated trip generation for the proposed development, and a level of service analysis for traffic impacts created by the proposed development, as required by City of Renton Municipal Code 4-8-120D. The development will be located on the Barbee Mill Property on Lake Washington Boulevard,just west of the NE 44th Street/I-405 interchange. The location of the project site is illustrated in Figure 1. The proposed development will consist of 24 townhomes and 88 residential duplex units. The proposed site plan for the development is presented in Figure 2. One driveway is proposed on Lake Washington Boulevard south of Ripley, which will provide access to the 24 townhomes only. The 88 residential duplex units will have access via Ripley. The proposed development is expected to be completed, and fully occupied, by 2005. March 28, 2002 2 Barbee Mill Property Traffic Impact Analysis I .,MIII=I N i co '0 eLlizi io.. ,0. 0 % %'‘..,..‘1-• i A ... SE 76th St „...._, CO / ...- a) ro / ..., _....,> NE 44th -4, .114 I 1 V6'41:1 fill V" 43) .......> %Lk Project / , c Site 0 u •... taarrval N 40th St "*"\\[.... r • ‘..V 4 .0°. / Lake / Washington ir N. 36th St z o _...„,› cu 14. I 'CC -1G tIS rj '1'r 35 1 al N 30 th St \ % ' "1- T '1-*•r Y y s.)- 1- ? , .....-- 1 NE 27th T, , St _ ..) 495 1 , Barbee Mill Property Figure 1 I-D:i. Traffic Impact Analysis Project Vicinity A' I ' r � �Or co.k.O•W• CNN Ir p tA„.F.div.4.T1-f P.0Ffat=. !oo I tz.o.vw. to R o , 4 f 4 ^ 2 t I It ' . _ r .4; `;4 34 - -1/ ' —!. - f 41_t j ry .$, ;L • I .t t• (Hqt ;9 29 44 tbrel$X ill , I: . p 40 ' , sal WV*x Rol. nitYtttlavµ+ — 4y L7 . Wkc>F}�Cvtt • t 4 -- I '•act• � 41 \ tc :4.17� ., a - zz z3 ', t, ' Wt:tt.a>ao 9vfF6F� z . . '. . ''''/ N. Z4 �wMNow+R sl(�5 -t- - 4 • y4 R-r kit, WIO ifr vi 3 - a. al •4\ 1.4kM t..,4,0. rk.v, ..X SS bvrt•ex vrtT4 _ y Z9"rQNltt-FOMEb �_... � t 1 ( . • ttZ Kov�� vnt-(h r 411, s 4 t4mZ got<ow AI N k + coI /Mr vow.opor• , — -- ' f•------ tin do I I Barbee Mill Property Figure 2 FD:i. Traffic Impact Analysis Proposed Site Plan EXISTING CONDITIONS INTERSECTION CHANNELIZATION Figure 3 presents an inventory of the existing intersection channelization around the proposed site. Four intersections were analyzed in this preliminary traffic impact analysis, because these intersections are expected to be the most impacted by the proposed development. The intersections are: • Lake Washington Boulevard/N 36th Street/Burnett Avenue N • Lake Washington Boulevard/Ripley Lane • NE 44th Street/I-405 Southbound Ramps/Lake Washington Boulevard • • NE 44th Street/I-405 Northbound Ramps/Lake Washington Boulevard All of the affected intersections are currently stop-controlled intersections. The speed limit along Lake Washington Boulevard and NE 44th Street is 25 mph. There are sidewalks on both sides of the road east of the I-405 interchange; however, there are no sidewalks on the west side of the I-405 interchange. There are marked bike lanes on both sides of the road on Lake Washington Boulevard west side of the I-405 interchange. Lake Washington Boulevard is a two-to three-lane, north/south collector arterial that connects N Park Drive with NE 44th Street in north Renton. The primary land uses along Lake Washington Boulevard are residential, recreational, and industrial development. NE 44th Street is a three-lane east/west collector arterial that connects Lincoln Avenue on the east side of I-405 with Lake Washington Boulevard on the west side of I-405. NE 44th Street provides access in all directions to I-405, and is primarily surrounded by commercial development. Burnett Avenue is a two-lane,north/south collector arterial south of N 30th Street and a residential access street north of N 30th Street. Burnett Avenue begins/ends at Lake Washington Boulevard at both of its termini, and is primarily surrounded by residential development. Burnett Avenue could be used as a shortcut from Lake Washington Boulevard to access the N 30th Street interchange at I-405. The speed limit on Burnett Avenue is 25 mph. TRAFFIC VOLUMES Existing a.m. and p.m. peak hour traffic counts were obtained at the four study intersections on Thursday, March 28, 2002. Existing peak hour traffic counts are illustrated in Figure 4. Traffic volumes on NE 44th Street between the two I-405 ramps are just under 1,100 and 600 vehicles per hour(vph) in the a.m. and p.m. peak hours, respectively. March 28, 2002 5 Barbee Mill Property Traffic Impact Analysis N © 0 Cy" 4.41 w0� a, c• SE76thSt may^'.: �, i + =w. w f 4 E 44th s .. ... - .. .. .. .. . ��`�°�� 2 3 ` �. ®.. E a) -- 4' ,1-. 0 Project c Lt Site rt J \ ,:: N 40th St er o ~. /11 Lake.` {" cos i____, -,:W . N. 36th St z • Q. '1- .i. E 1;. m N30thSt � � / -Nf;yr Cte;k'.11 k .r.,,t\ r�Y,. .r i„ Legend k i �s�'h. Stop-Controlled Intersection i7 '. NE O a itartsse Stop-Controlled Approach y it I Figure 3 Barbee Mill Property Existing Intersection ID:i. Traffic Impact Analysis Channelization , . .. N — 160 5 165 4U 1 15 --)1 0.4 .? . 2 it') 5 20 V 0 \ :6\, 4 '405 i .$' SE 76th St .4:.. LLI 4 U) .iii ..4. ,--(105) 65 1' '-,',,''>._,,, E 44th --..,k..._: ..0 ''''- 2 31/t \ 60(360)—t 41 t 1÷ CO 200 65 10 185(90)--0. (10)(1 00)(6_5) V. (110)(15)(0) 1 ci) 45(265)--- 10 230 1 bU , 77 ir (55)5 4---( Project i Site o (0)(165)(5) Z 0 76-±ir 0 35 5 .o' C (420)(5)(5) trpt N 40th St • \\ff.... o ,) e co .4. co 5 ( 7 Lake I 015 se. ILS1 Washington I0 N. 36th St -1-. •.11 i Z • (3) -, --( , > T ,t• r to T l'T I ti; D. ii / C i r(X X) peak hou volumes ; :111:,:e•gend N 30 th St t , i` '3- NE '. A• 4, vfir4 X X RM.peak hour volumes I 11 I Figure 4 Barbee Mill Property 2002 Peak Hour Existing ]Flja Traffic I mpact Analysis Traffic Volumes TRAFFIC VOLUME FORECASTS TRIP GENERATION The proposed residential development will generate some new traffic in the area. The a.m. and p.m. peak hours, and daily number of vehicles that will be generated by the development were estimated using rates/equations provided in the Institute of Transportation Engineers' 1997 Trip Generation manual, 6th Edition. The Trip Generation manual is a nationally recognized document providing trip generation estimates for more than 100 different land uses. It provides trip generation estimates based on average rates or equations that simulate data points,which consist of trip generation studies conducted all around the nation for various land uses. There are no land uses in the Trip Generation manual which are specific to duplexes; however, townhouses are included in the manual. The definition for a townhouse in the Trip Generation manual is: q!: 4'' ::`sin .e-family o er" hi ..units' at have;at;least on' "et sin` le" i1-' `wjnry s th e''oth .,s l _farii ownedunit�vi+ttlun;:the"-�. � "sain udi tur b t 5`?t y �`i iav ... .... .. ,w -,..<•»,f,.ts ,,,.:....,:.: �t:.x:Y,:.•".a,��:..yS:.i.i: a',t Because a duplex could fall within the definition of a townhouse,based on the Trip Generation manual, the trip generation rates/equations for the townhouse land use code were used for both the duplex and townhouse units. The estimated a.m. and p.m. peak hours and daily trip generation for the proposed development is summarized in Table 1. Table 1 Trip Generation No.of Trip Rates2 Vehicle Trips Period of Time Units LUC' In Out Total In Out Total A.M.Peak Hour 112 230 0.08 0.42 0.50 9 47 56 P.M.Peak Hour 112 230 0.40 0.20 0.60 45 22 67 Weekday Daily Total 112 230 3.20 3.20 6.40 358 359 717 Notes: 1. LUC= Land Use Code from ITE Trip Generation manual 2. Trip rates are measured in vehicles per unit. March 28, 2002 8 Barbee Mill Property Traffic Impact Analysis The proposed residential development is expected to generate approximately 56 and 67 trips during the a.m. and p.m. peak hours,respectively. On a weekday,the development will • generate approximately 717 vehicle trips daily. TRIP ASSIGNMENT The vehicle trip assignment for the proposed residential development was based on existing travel patterns and access to the major arterials and freeways. Figure 5 depicts the a.m. and p.m. peak hour trip assignment of the project-generated trips at the four study intersections and one driveway on Lake Washington Boulevard. The Lake Washington Boulevard/Ripley Lane intersection experiences the most project trips. If March 28, 2002 9 Barbee Mill Property Traffic Impact Analysis ' i N (4)22 4- -(4)16 ilt (42)16—► 0 2 (1)2--\ tr 1 I CO1 °j SE 76th St co (1)6 4:., it CD(9)4 �' v (3)9 �-(1)6 E44th_ _ .. a 41 2 ,3 (21)3 CO 1 (4 3 (5)10—I. 1 -- — (1 J. 77' ; (16)3 a -:��° �Project ./ c Site ,f o , 5 (1)5 ..... riii,N 40th St \:.). :.1't..r r Lake: :'��; ./ °``� cA Washington :`°`, `�� A N. 36th St w� 1 1 %./...._ ' 1 z > it L y"r (13 >_ f °0 N30thSt i A )- T --1-• T 'r T - r Legend 1. -"(? (X X) A.M. peak hour volumes ' 7 ^T ::• .: a 6.4401 X X P M.peak hour volumes 7 Barbee Mill Property Figure 5 1F-D3 Traffic Impact Analysis Project Trip Assignment 2005 FORECASTS To account for future growth in the City of Renton until the development is completed and expected to be fully occupied, an annual growth rate of two percent per year was applied to existing traffic counts, and pipeline traffic from recently and previously-approved development were added to the existing traffic counts. Forecasts were estimated for 2005. This methodology is consistent with the methodology previously approved by the City of Renton and the Washington State Department of Transportation (WSDOT) for the I-405/NE 44th Street Interchange Project Transportation Discipline Report(June 2001). The projects included in the pipeline development traffic were: • Labrador Subdivision ■ The Bluffs • Tamaron Point • Southport Estimated traffic volumes for both the a.m. and p.m. peak hours in 2005 are illustrated in Figure 6. March 28, 2002 11 Barbee Mill Property Traffic Impact Analysis TRAFFIC IMPACT ANALYSIS LEVEL OF SERVICE ANALYSIS A level of service (LOS) analysis was performed at the four study intersections and the proposed driveway on Lake Washington Boulevard in 2005, with and without the proposed development trips, and for both the a.m. and p.m. peak hours. The LOS Analysis was conducted using the principles of the Highway Capacity Manual through a computer software package, known as Synchro. The concept of LOS is to rate intersections operationally based on the average control delay per vehicle traveling through the intersection. The LOS of an intersection is ranked from"A" (low delay) to "F" (delay exceeding 80 seconds per vehicle at signalized intersections and 50 seconds per vehicle at unsignalized intersections). By 2005, the City of Renton is expecting to install traffic signals at the intersections of NE 44th Street and the I-405 ramps. Therefore, these intersections were analyzed as signalized intersections; however,no changes to the existing channelization were assumed. Results of the LOS analysis are summarized in Table 2 and Table 3, for the a.m. and p.m. peak hours,respectively. The LOS calculations are provided in Appendix A. March 28, 2002 12 Barbee Mill Property Traffic Impact Analysis 3 N 190 6 176 377 197 Y 155 (732)-► 4/ 1 b .......... to- i �� 6 22 ti��ry 5�� O� (6)(�) ,� \1titi. \ 24, //��e,� f � SE 76th St Lv A.� * 4 n 06ti/ ` ``:,,, ,° r `� 199 27 48 L69 32 (315)�2)(11) 4—(129)126Wg0 E 44th �(112)69 = 2341t 66(3B8)J I -. � 243 69 11'::; '_.: .:.'• 202(96)-0 (11)(107(69) e-. (122) (16))((0) (6)6 '';;:;•:^: 63(297)- 11 24 7 //Y 1�(6)6r, y :,: :.:. Project ff c ') P r Site o 7 -(0)(138)(6) C (107)(6)(6) ::.,.:? Itoip � �::... - ::' -::' :: N 40th St \yr__ .; : : l�:Lake Washington, 1% N. 36th St • d J 7 • 4.4 Q L I fir AS �a L 00 N 30 th St �� r �" r I.`°, -MayLI Ceplek nik ;.r'Y :rY.„1. I,. Legend )- 4sh45. (X X) 2005 A.M. peak hour volumes ryNE , 1r lazInal X X 2005 P M. peak hour volumes a if Barbee Mill Property Figure 6 Ei1 Traffic Impact Analysis 2005 Peak Hour Traffic Volumes without Project Table 2 2005 LOS Analysis Summary A.M. Peak Hour Without Project With Project Control Control Control Delay/ Delay/ Intersection Type Vehicle LOS3 Vehicle LOS3 2 2 Lk Washington Blvd/N 36th St/Burnett Ave N AWSC 16.0 C 16.1 C Lk Washington Blvd/Ripley Lane TWSC 2.0 A 4.2 A NE 44th St/I-405 SB Ramps/Lk Washington Signal 37.1 D 43.4 D Blvd NE 44th St/I-405 NB Ramps/Lk Washington Signal 18.3 B 18.1 B Blvd Lk Washington Blvd/Proposed Driveway TWSC n/a n/a 0.2 A Notes: 1. TWSC=Two-way stop controlled intersection, AWSC=All-way stop controlled intersection, Signal =Signalized intersection. 2. Control delay, measured in seconds per vehicle, is a measure of all the delay contributable to traffic control measures, such as signals or stop signs. At signalized intersections,the reported delay is the average of all the control delay experienced for all movements. At unsignalized intersections, the reported delay is for only one movement,the movement experiencing the worst control delay, which is typically one of the stop-controlled side street approaches. The control delay reported at unsignalized intersections is not a valid indication of the operations of the entire intersection. 3. LOS is the level of service, a concept based on the 2000 Highway Capacity Manual, rated from "A" (low delay)to"F" (delay in excess of 80 seconds per vehicle at signalized intersections, and 50 seconds per vehicle at unsignalized intersections). March 28, 2002 14 Barbee Mill Property Traffic Impact Analysis Table 3 2005 LOS Analysis Summary P.M.Peak Hour Without Project With Project Control Control Control Delay/ Delay/ Intersection Type' Vehicle LOS3 Vehicle LOS3 2 2 Lk Washington Blvd/N 36th St/Burnett Ave N AWSC 9.6 A 9.7 A Lk Washington Blvd/Ripley Lane TWSC 1.0 A 1.6 A NE 44th St/I-405 SB Ramps/Lk Washington Signal 14.2 B 14.2 B Blvd NE 44th St/I-405 NB Ramps/Lk Washington Signal 29.4 C 31.1 C Blvd Lk Washington Blvd/Proposed Driveway TWSC n/a n/a 9.3 A Notes: 1. TWSC=Two-way stop controlled intersection, AWSC=All-way stop controlled intersection, Signal=Signalized intersection. 2. Control delay, measured in seconds per vehicle, is a measure of all the delay contributable to traffic control measures,such as signals or stop signs. At signalized intersections,the reported delay is the average of all the control delay experienced for all movements. At unsignalized intersections,the reported delay is for only one movement,the movement experiencing the worst control delay, which is typically one of the stop-controlled side street approaches. The control delay reported at unsignalized intersections is not a valid indication of the operations of the entire intersection. 3. LOS is the level of service, a concept based on the 2000 Highway Capacity Manual, rated from "A"(low delay)to"F" (delay in excess of 80 seconds per vehicle at signalized intersections, and 50 seconds per vehicle at unsignalized intersections). During the 2005 a.m. peak hour, the LOS ranges between LOS A and D at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS, and all but one of the intersections experiences a small increase in delay (6.3 seconds per vehicle or less). The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the a.m. peak hour. March 28, 2002 15 Barbee Mill Property Traffic Impact Analysis During the 2005 p.m. peak hour, the LOS ranges between LOS A and C at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS, and all but one of the intersections experiences a small increase in delay (1.7 seconds per vehicle or less). The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the p.m. peak hour. MITIGATION The City of Renton does not have a LOS standard at intersections; however, in urban areas, many jurisdictions implement a LOS D standard. Because there is no change in LOS at any of the intersections after project trips are added to the traffic volumes, and because none of the intersections operate at an unacceptable LOS, no additional mitigation is proposed. March 28, 2002 16 Barbee Mill Property Traffic Impact Analysis SUMMARY This report documents the preliminary traffic impact analysis performed for the proposed Barbee Mill Property Development to be located in north Renton,Washington, along the shore of Lake Washington. This report documents existing traffic volumes and intersection channelization in the vicinity of the proposed development, estimated trip generation for the proposed development, and a level of service analysis for traffic impacts created by the proposed development. The development will be located on the Barbee Mill Property on Lake Washington Boulevard,just west of the NE 44th Street/I-405 interchange. The proposed development will consist of 24 townhomes and 88 residential duplex units. Existing a.m. and p.m. peak hour traffic counts were obtained at the four study intersections on Thursday, March 28, 2002. Traffic volumes on NE 44th Street between the two I-405 ramps are just under 1,100 and 600 vehicles per hour(vph)in the a.m. and p.m. peak hours, respectively. On Lake Washington Boulevard, traffic volumes are just over 800 and 400 vph in the a.m. and p.m. peak hours, respectively. The proposed residential development is expected to generate approximately 56 and 67 trips during the a.m. and p.m. peak hours,respectively. On a weekday,the development will generate approximately 717 vehicle trips daily. To account for future growth in the City of Renton until the development is completed and expected to be fully occupied, an annual growth rate of two percent per year was applied to existing traffic counts, and pipeline traffic from recently and previously-approved development were added to the existing traffic counts. Forecasts were estimated for 2005. A level of service (LOS) analysis was performed at the four study intersections and the proposed driveway on Lake Washington Boulevard in 2005, with and without the proposed development trips, and for both the a.m. and p.m. peak hours. During the 2005 a.m. peak hour, the LOS ranges between LOS A and D at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS. The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the a.m. peak hour. During the 2005 p.m. peak hour,the LOS ranges between LOS A and C at the four study intersections before the proposed project trips are added to the system. After the project trips are added to the system, none of the intersections change LOS. The proposed driveway on Lake Washington Boulevard serving the townhouses experiences a LOS A condition in the p.m. peak hour. March 28, 2002 17 Barbee Mill Property Traffic Impact Analysis The City of Renton does not have a LOS standard at intersections; however, in urban areas, many jurisdictions implement a LOS D standard. Because there is no change in LOS at any of the intersections after project trips are added to the traffic volumes, and because none of the intersections operate at an unacceptable LOS, no additional mitigation is proposed. March 28, 2002 18 Barbee Mill Property Traffic Impact Analysis APPENDIX A-LOS CALCULATIONS • March 28, 2002 19 Barbee Mill Property Traffic Impact Analysis 2005 A. M . Peak Hour LOS Calculations Without Project 1: N 36th St& Lake Washington Blvd 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak ir 4\ ; 6 _ I aar,Grri 77550 44747,,W4.4!".VgiE8LIPIIREB-37,748BRV4WBEnVial'Ai,tW1580VOIBLV.ZANBT,WA‘18Fliii'4XSBLIY.F.:SI33:4A,FiigtiR, Lane Configurations , _ 9,040) 4+.770-d rciFiFFTOWIRFOI:P77;c4ft47300A-Mill'Obil,0647',";' Turning Speed(mph) 15 9 15 _9 15 —` 7:17 1r7714 Ij74-AV :*1:41rpp W.Sre Frt 0.955 0.870 0.998 Satd. Flow(prot) 0 1750 0• 0 1621 0 0 • 1839 0 0 1852 0 EPRirAittgOK5g4*1 tal,i'eS 4 Satd. Flow(perm) 0 1750 0• 0 1621 0 0 1839 0 0 1852 0 :,PAF317.—WEr.9;g5W,„,_, Link Speed(mph) 30 30 • 25 25 .„ _ `•";"4;t1.1.iiii ittitits.7..iteivi Travel Time(s) 30.0 30.0 36.0 36.0 u y4,21PmelvP111-ti ' r Peak Hour Factor 0.40 0.40 0.40 0.87 0.87 0.87 0.88 0.88 0.88 0„..69 0.695,w7w7,0.69 ) 1 Fre'a'W—V-erhTere-sIMP1137-4',1/4`a727`)/"-- TIor,77,'.?7YY07,7m . Adj. Flow(vph), _15 _ _15_ 15 0 7 202 7 533 7 23 177 0 , r Sign Control Stop Stop Stop Stop _ bitar$7ec-trctri;871"urn111 s,;77. Area Type: Other - I { • I. Intersection Capacity Utilization 53.3% ICU Level of Service A I I - , I , I I ) " Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 1 HDRENGLVL7-FF51 1: N38thSt & Lake Washington Blvd 2O8SNoAction _ Barbee Mill Property#1173G-O01'UO2 Timing Plan:AM Peak � 13R, . Hourly flow ratepuvw m 15 15 v / 202 ' nua ' 23 177 v HCM Level of Service C " — ` ` ' ^ , ' ' ` M0 Gynohm5Report 3/27/2002 BVL Page HDRENQLVL7-FF51 2: Lake Washington Blvd & Ripley Lane 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak ' II-- ,.,yr...�• t -a?•;�s'?^'<.�,-r �s�*•nx ,;-"�.' """ ',3°%s r.�z. ��:Scp�,.,, �`;+'' ..•�'�;;<„r;: '.:,1>'�`rr'"i.'a,;!;-:^�,+;xy4,�ry x.n 11 1 - . ,..p'��'�` �� -�,�r'._ .,.•_�. „, ;1II�B.I'��`:�,=:WBR` �SBL= $BR xt�no;�»x ,. `,`� ��j, ;:s=W '.d.:.'>�:;z.:��u�•„��:�- '� Lane Configurations 44 �`sV �,ia ;•.};.,y,•. � "'"", :,�y`rri"'""..•..-^BvT�;,r tt �-r-•^•-nt*c ��vr;;Sc�>�r .4{a"-° "A+'"�. y*:s^„vsr-:rxf^rr, J �.�1,�F);a, _��!P�j?) �;�,;; 1.9�Q�;; 1900.; 900' y 900�� 1.9,0 900... •� ..r �,,, .,�. �,.::.. asYx :cz=..:a .�`aa�•4� h.�'r5.,. .-x.. k,s �avrtw.v.. , ;�. � :u. ,r«,:c 'x:J;�•.3*Syr..b`a+w?,L',::3r%Si�i.'s.:..d%ws�,.'f�:esr,-v.`• r2:• Storage Length(ft) 200 0 0 0 ; 1 �. trx, .:.=,{"`�+"�'�i'mgn�`•,F _ �:; -�'�S�'�;:"-'�':' ;�°�:=as:?;� �.". ;r,.-^*.�.a.',mr,.'.";^""'`;�:=,�•et"`^�3�+�? w` Y�"'cr?rt.L�, =;sue S O a L 8 •..a, v «: rr . •. ti c1,'g` ,O c 1. Q +.b;.z. +•t, {,,,W7, 4�j,t'1';° .7; f:`!:j'y,i f+<s:.;b''," n.,: .w .•r,3LJa��'S:•,i",>�:.,.F. :r.=dN,^,,�.3 w_ ntS',. ..,z'A ,.''�if��:,:,. �os.+4,a...a'��: +n,"7i&e�'��': r:d. G'e. :" Turning Speed(mph) 15 9 15 9 ,rr•+., w...',,.;'�;, �,rrrxw, ; �� -....�ft�: «-.y..,,�.f`^-.�,- '»�.-,... .��".,�T':•�.s,;r_-' .<t+;,.v; '9 :'K�"a.::�i �•.7c'a T�•:,sf:;,,^:a��.�F".,.: a,m,:rd„tF •�ane�:lJki �Fa"to��:�,�>,,,ta�,: Fitt 0.976 0.986 I `^8""*^A^q.%".+"v'.^ .. .ly ..y£.. ....'r�+r'+c .. �g�.ceJnr..�.»}•�^"r�"c"... .•G. .�"�'tT .,. „wC;,,.-4 '.•',^pnr�:vy?�%'t '>8:�"F�x _ - .s�.9i�;i;,.-.`-:v k. r.� ;e �:KF�°,,; :..v'.,v,.r'.a••^ a;�i.��::�y�r�,it.. = ,t• ,:a 'is"'.It Pr9♦eeted: gE .9:50- w ,�E.: ,M 5g ,,<- z0.957:�: .n, Z t-,.,,, ,.x,_,. :r�;�.'.. M �w..,i::7aL5wa�.., .: tk^;s''�xir'`�rJaati. ;;,4Y,:;.c-.'.;.n..k:,3..t,.a ..�:,.a��'.e,.•ac�-�,:�xi..., �" �=.:t'�.�fi'�Q�:�a u� � r .'"'�«z,:� ..•,«,.s,.,L�'}.'.�= ua::.::iS..+.,..w<.,w.�•w:y> Aa:? ri1.`.�.,�.R' ,sccn,,..,�r..a.F.ae?.'>...,....,.,,.:.,a. i=t` .n'�.v.,.,�.?.. `s Satd. Flow(prot) 1770 1863 1701 0 1615 0 •----7'mw!c--"-;r:";;d'",r`7?"�.L' -.�'"•_..q",-,. ,��sF,7."°'"^" .x-.< --gr.'ro••,?.,, .d'✓,v� :�;sryazy+. ,.,."4�„ s>�!rc,r;;,,a. „ix t,'�^F:"�_�y, 3.,•„ �.,...t,.`i.r�"'`^`z'9',b 'a:,'' �:' .''. �., `{, Ai'"='`•a.rm�,:* zr. ',r r z:E,, ..,�:x1i" =,.-.'4f-t--�;.,x :. '-`�,•,z`. �Ii�Per ttfe,,1' �;�- 0:95 � .fix,4' ,, ��z," 957; ,, X= r :'tr �"�°, �.ry: w �� ;:.�-.�. '�� zt.: � ':.'3.., .4;,::1•a:'w'It�•c:;�"e:�:: 'S�i- <�"ra '�5�:3i:=';S'wT1.,tt�:s?�t' ;,tr, .;g°R :' "`:;v"ruo-`::�3swis,`:d's�;c'3..+ri"v';i'��..'.,�,�;7�,��'��..�`:�Z�k't..r;'/r«.:s'�.,'aAtu:La:;,.x '..t�:;'.�c5,:v>=-`.:,.,Lsw?:- , °+`�'> � , Satd. Flow(perm) 1770 1863 1701 0 1615 0 i •e "".'-'a:�-'-rx+*r. q+egn,.r.r�.,..K2:g,, "':,�..;�r-.va.. .q;:;'�;, _..:}u�"` M,.�'�;.^.-^'-.,,,lr,tc'-.�;-P"'�r.�.n�w-„^,..,�,"p;:?za-'�,,,,�r.. ."•rnw:'to^:l,"��E-^s;m.-.,.�r'�+,s�";' ::,:+;.< 'f.r`+:� dw.a.,Facto A,,> �,>>.,. F 0129 0 °1,'00,,:w 0 .. :._ ,�_�• =�,R��A= r ,. °,y:. +•IEWi A�SC... s :2.sas....+'�.',�,,;,.�?n,<':s..:• ,.s&�'�w`"'',.,...h:....,,.,:1.^«'«e�iu�,...asa•.,.�v V!::3:`;nt ....x>'.ut.A �.�Mw'`ara""''`"> '`„r lf+:4.w �..u..rm�:J.s."c.• a'7.".�oui.:.,a:.�,,,,e�,...:.....Yd:K �;�e.+ii�'.�t',}�n"i}:u,SSb�.:,.� Link Speed(mph) 25 25 25 w,�'.•,7 .''�.§`"' 6 S ! k: '1.+' W', `RE'' f''S�''�'i'd�,•:;.+ir!i:�x''}:,�q•x''. �s,,,'; �,,a�r'�?:. •.�32 �� n •�_1.31'9�.Fs`> dab. �� .� ,• �re�;.z.e :;t�.� �,'tin1�D stance.ft :�: , ..�'- '�' ��; 1�':.`��; t3$.w,. �,,,�� _ :�- �-'.. ,!,��r ,>�, ),�''«.;:La:;:.' 'c.�:6tlx'rEt✓,;.t'Fe., � ,.;.'�'�#.:� s.:<.^:ca...,'•.c ,�,•.s� :z �e�,.,=.,,,.,G,:.��'a;�� sic•:...,XiwBsk.,t'a�Q'A•.,a:& .Xr'z��,•Jr�._,"�,+:t>�z,.d..;.C. Travel Time(s) 36.0 7.9 36.0 ...mmm+m-c..Y.�r:;d 'f.=>i.; :,r_.;; t'." ,-., ram -��yrgy-•��,:.r,^'"^,,,��r;?`%'',n;:r.:�-�,,*:mrr;;.;. .zK,.�+i7�°,Qy..'r4�.Arp"..,z�.�y��3.�,^t.,^:is:'. "'"�'+n^^-, ^;'r"''�^^Y�'i:•.v'rs�.•'T,'''«^ 'Volume u ;N n t �, Y l,10 , 92'�''=. ' 122-0 •-2 54.�,.,7 x;: ,�.� , . ti a 5.,. -� p�s`:a;..,.,t e,z" .,,u&`.r�i`' .. ti.;..:6. _. .`".`�.— ...:z"s:,..,�� R�tz3a,r,...t,:,'�,;?;,,�.�'�...�.a•. '2is�..._::ia'�'nwn.;1•��s��i" t2..,.Y»�.+:5:,,,•.,.°":1,".s`�%:� :.`;s"�.'3„rfY+�.r::�3ra�4.�<I Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 ,:.�..-r-c=-�-• p' :..b�:,- O ;s;"'��.,e.;i,�„ ��e� "-,t..n'o"n;!fs�p �,.Q;�'�u:#;3;�mtta,�,�, ,v'� �;„,7:'` --�-'�,c-z;."}:<<_�r�°=.:•yt;1'e`N�'xj � ea EVehtcles(,/,o\1��, gfato '2 , ,�K:9.luE '� .9,/a,,,. 1;I:Sa:7,1 l0 4 Gz a ye ,'A7 ;_ ,> j 1 ,..e'...,,a«.e. ?� lsey,:tx�'�.5.". •� «°`r;>», a,,"....:�:->.,¢• ra.r��}�'..;>� �,'`"axw' -.i�4 .n ';� ..� Su"' x .e,,..,a.:s,�.i, .:: .7a=:}ut•."L.dY:;. Adj. Flow(vph)� • . 7 814 182 40 79 9 -.•r�,•.Tcz»-`^^- ,,;r�•.qt'+' �uT.,.�._ .z....- �zyr-,-xr,,��np•^ - .S'.�;:^,�..x�e�^^;;x -;•t�' ..;;,^�.•� eat:-;".�r',"''� -+r`w.:•-:,'gyp 'ane'•.Gk`�1— ,low',:.v�h'�,� .,,>..ru'7: �.814`�':., `222 •�,�'� �0�', .: �: :�. :,<<QK��;.��,.�:;> �::�� ,>.�' �, ' �. ., Sign Control Free Free Stop �•¢ ••�x.•v,...°§:, *:r«^,mxz>,�:'-a,-•,p:-.+i'^,,i'' >�:^' .";:F':w,"sa,^,F+'^y-•,�,�x^°"'r'�sq;�zs�rm�'z"^rF'A.',`?..F::.«.:�^�.:��•`t',;F',:• f. �wS::G";t Ez•"�.F,.;Ttk.'i�,4','rso •• ':4 1s P*.F.`'" ^c K, - :i>n "ir• ,t5`r,':,Z -. Py -t2Kci-«- Y ^.,"y.,., �ntersect�on,Summary�r ",._. •,�_"-:•;�,.:� . ._ , ~�''� ,.,.��',.,.��;„, , .....,.:: ��`.�, .___.",.,.•s;�:z.:„ ,v�,,.._ . ..=.{w= .. ..nA.. ,,. ,. Area Type: Other _ '_ ;• *•-.n'--•-,•-,�,,,,,,<,... ,.�»,:rm'.. .zpn. .,.,� .:5"„ ».ys^Z<'�ar:g:ra c•r.-a; ':, :"<";w;a, ;. -..n.y., n.,%7. r".;�Gt' ::ir:�'t?."a? �"`�S+i°. ,�� •;ey'-v.'Ir�„�,Z'' 'x`4t, :t ! .�'n..3'v",.tY:,,:;�=',,•?:W;,�^'�' :,'"Y!�":;r;, {, ...c-,IfEiMro't'; .,i,'�t;: .'•'V, .Yt*.,.E1 ,' '- ,..:'":-'..,>?C_;'.';`f�✓ ;..u; U?::'';,:,.:^�,.»�RA .f. -t,M "s:"fA; .�: ntrol T e'.Urisi iialize �� :� u:,, � _�, �,�. '� ...,_u � �:,�,�-�,�:,�.�x.�._:::>:_.:r '., g� �",«''.�_Z.-`�=+US^.e,'�:.L:t"r%:" 4'•`Y c'�.,r�� .•v... N�..i+GL '�'��^ z.�`:si.--.;x;ss.;?-::�;.- �'1-._ ,v'..fiu .�::.-,L.:'-:s,.. Intersection Capacity Utilization 56.1% ICU Level of Service A a � • I i I I I= Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 3 HDRENGLVL7-FF51 2: Lake Washington Blvd & Ripley Lane 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak AAouemen �;=�.- N��:__-= „8B RE_ ._ :_ ,.R..4W4R.E.,SBL`°,: SBR�.}i:.M... c ;Mi�.�:��<, MZ.VW a max.ate, Lane Configurations 1, .: 'y;^rr•.; i�"-'.z�,;5*- ,i�"i _,sue..;i^ --a..ayj;-;.,�:, ::r!""...`'+;4.: �;•ie,-:,�:w:- ", yr;i=; i:;v;,u?rxf-3;:z,•w.�..v-�,�r:,:�`r^ ; SI rl>;=C001 Free ree-* l : StOt w ni £;,` s & AG+.. "n ;54r. ' ::,:.a� �a:a'...trt ir ..,d.&a.,.:a.'..1;C'�'.r.^...'.e''niWy�.C..:1.:s.d:S,.,.Jb:.....'t`, '.�vu.�nuL-.Ys`,.,-,ki?�k^a'd,�ii�,,..,:.w.n..,: x,.r,'.. .�=> ., Grade 0% 0% 0% ...,-w:.rr-(rnrnt-. a»�.r,s Y-,r-r;,u�,"�- w,-'ter:M,,�•' .k<d•'-•,-:t.c.rrm, :3v'��e.' a',-re'�r.:.•., - MAY e,...�, .F s, sa.;m d;f_;.,.'s.'"-'•,»;rti:`�F�;a.,'�.�5• ,,;r. Volume,'veli/tt�_,.,;j"x"�'`�ts;..�F�-;•rg�''`��.6�: - �692`�� -� 22�' c ��;27��'��,W.a;54s.'a�...x,'•6;`�.�,.: ;a. :� �� ,rt,F��;..��',;'�ydr=.�,d, �.=4�.�•` tom'< _ �.::.., :n�.t,.vo)„ -'�sA"� 1:Y:sdcS:afrlrx::�:.o-�ri.��4'w{.a,c,.,�:,:.�.�o--cC'•�J+,�;�,,.......�.'bras'�.+...:-..�.°�a:��=..uF,t''C...••d'�u:s.r�.:,' "?.r.+:�`lainf�"-_,..,tCP�..,,aav;.ma �::i..a,<ns+7,'�a��w:F.a`�,,.+� Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 fir:,, X _ ,. ,.A'_mT+;•ar.-c>.m,^...,•,-- ,.,-,.f ,ri.�,n�.•,,rHidfi' M.�Y ,.,,f��_� -_ a...Y.._..-.�;fi'�ii; s`r.'"�-.'a,�^':a"•, 7��`,�S;fi»� f<"??'t7L.' ?'S;�A.,...�-:+i", >� �io.Ur1 flow[ate('veFUh` a :,.7 .8.1:4 =:182.i` "4a: "': 79 9 Pn � .�.:.� 1.....,o.A.1,,:w,,a..�,-`��•�,�v,...,a? -:,..Z�.x„*�-am+afPi .�.,v 'r+ L :r, ir�-:�r Y.,s �.ua;.c�a::3„� �`, 'u�.Sx PedestriansEaev _ ..,i-w+^•--.734'v � air;+Ixrr:;F,tz,.'�G;x:w,^-^3��,,, n.r. *z, .:f. :`g;2,:.-'z%`.'"<. `r :wk,:,,. ,:y .,--,,..nF,;npr'f'w,-;L TPrdrr•g.g. ^a-i, '. ,,.sz::-..•_:;.. .1.+,� ,<4a-_c.; -,�: •.k �' `'�;;64 ', ,:,.' ,£" ,:> `. a";.t?; 2x•. t. .u,,t-;:Y,. ,:�,�;,.. ,'. :,.;e:;^!h.r:.a'sr'SR"`a.-&::: i,.aeew:,T-'��' � »''' e".iaF:` ...t'.SA`,xZ,zF,�, 'Y::rw}� 'sf�'`==-✓N:L �` S.,^�, �vn �i'x.».7.=zr. Walking Speed(ft/s) _ • ;=ega - .:1., yu` +�':7,5�,:. -,'.c.� 3'rt'l,7 _ s A 7:C.S `eft.,§77.-*,:A7,7:. .,,r. 4 .:�,. te- r '',.. .;:t G+;C`'+ •e`rCent^;BIOCK'dx�y8�7,.,r.'F2,a -'.'-`'-�:>-a` •`�w.1••` ...�',':: ., '>r?�.,:k�,;.,._ ta.: , +:;ass .:a .;T .;,.yam'". •;,n .;^:� +:.':',=k'.:rs:l.�a. .;:.�,•:ar�,.,ew.�.�.,.zn7.".k.,.xrc.:K_�,.,,w-e��».= `1:eFw7urxs<, � �'(�� -sroue:�. "_'�,�'.�..�.itt.,a'c:...:� ' i,.��"�� ua Right turn flare(veh) 'ii>> tt..r., n 4�:'•i „.'.«r�. a�53-'?"Fd``'�"�_`-�.�zfiS!a�`f.� ;r,„ ��G t:'';s i`ia. :4� �X: 3.:;,',,..:t,. �i:'...r�N'y�ti"`.t,�. Nledian<}h'�'�tn " `ors.". `ZG� :>'�ss�.:.diw�C.al7iz:rc c-�`i;.;4:Yi- ''N':3f�z1`�,-::u ,an�' ' 'r-,.�:::`;�ia.,u:<�„�.znz�s �.:,.�t.;.v�=-w. ,.rr:::sd+.�' 4v-.z!.t r�. r��:,e>rc��..,i:ct� 4:,•0..'3;+z'^: Median storage veh) -•:,;.a;,. .r-.,. .m�;.;;.-=- Y"P rc+-^ - :C�».cYs^,M-.;,a,. ¢i - F^q•,.;?-T':n-.tx t:'x'•z:scF;x. .i? rd;?'=ryy,:;Y,a`:C`�c',-r7.,."`�r +��^` -" v o f etin;volume : 222 h 1030 r 202, �I . "�.>��.,»ce...�,::�....e..a..,,:�e,.�' `° '�' s �1�shi ....�...�.t .d':,ue.,,..ar*:.:..z� a,rli.#:.i. `-:MWw:i:<u::i'uss;;.,....,rw.,.,.La&sL,:n.2,..,'%.:r5a.•�2�::ztw..z..,.;da.,m-.;1: vC1,stage 1 conf vol s:'^^ r;•q- _c.;or ,,,-t�;7g77 9':K:.�_`* ,T.y.,r ^=;a,:; "f„"-5 'y' r 7',R"??7,:;,:rar .'::,'B.:77T ' 'mr,'/+-.;:"'';1 vC25ta'e'2'cbrif:vol `��'�S.�-,�' -:.� ' ��q�.: r- �� , r�:;� :.:...k5.�c�_..� :v�,;:;.aw.,..�,...:,: tC,single(s) • 4.1 • 6.5 6.3 ;•,::'-'->3 •"`r•lf- .-sr7417PE' rmn:S+.? ,":7y R^n;'. "-?.;rM'i ,.,Py. :^t,^?: INTZ-,-.»,r••. wi71: (� „�,. Wiz- •�'�li,,,•t- ...�.:c. ,�,c: .�:.'X".��;'<`u"r;�`s:,.,. "s�":;L _ ,ar.';�q�,`,'��' ' +"ri..y 3r,;�, T,r�;.r^'� �.-z,;�„� Cyt2:Sta Q•i/'$ nN c r � 4.:;d a< :, : `'- , .;Fu. #d4:,P rin5;., 5, "..x. , , c:;:. ..`SL..� . .9,..,..1.�;;va' ab7+':,,-r„ �:k.. �-:.ha,xi-...,-u.w' � � � �..,.,i� tF(s) 2.2 • 3.6 3.4 x*•Mr.•...--.+r.>7n. •fir,:„4rxY.,•"r'r; ;,. ...{Fa.,..A..x,� >w-r�.ar rr::1 ny,;"` >.^..?. -q, ...i;;..>r:�sis.;•aF- - 1�.Q,_ ...,�.�».,.��'k�Lz..,�.e�.u._ 'l�-itc<.2t.<-:i•' u_,_w.�f�.:r..>..�"...�,i-:i.a.� ,.t,r,L_r�i...,.-'-�<�.'t%�.;:.�:.-- �.�':�:.. �";:..,,...i •..,:. cM capacity(veh/h) 1347 • 247- 816 _ - '`, q,€*�,s,'i;^, s •,z.-n{•: -i:'^�r''.,Y" .�7.. n a�:.' ,s,3:`..:.-:l ��',#'�'i#. BF :',;W:� ">r ,-1::`.. .."7t: S,J:f..,.<,�,.:�."Y:a;«r;'a,v,✓r'� "zt' '^, a`� ,h... a.k.a. "` RAC :..e�t,on,-.;^ahe.: .,. ,�a, ��;�E_ :.1;.,.s.P:,EB�2-.,�,.B.°�rK�•,�.SB, .. .,.,,'i ..,,. .. �,�:, �, -h .._..,.. Volume Total 7 814 222 88 s=...,, .;C . .�Iw:..a`.� ',ate-,' .�.-, .�E,h`:�LL T.� u�^+r .'.,i•-'A�`a r�..:-.. -.«n.3,-'.�=.r•,,-a C/9.luiil8'L2p. ... -•'J «.-,.::dam ros.�,�.>+�in.r-'.� .r.a..ax'.h...+>�°,s`a1ri,: �a�_�,:..r...-,.,..d:.:s.,g...�+t,,.j.,�...t�,�..:...;.a,La..,�,�.<�.;.�..::,..:'cw5:J54:Iasi,.�,:%;�,:_1�,4:!,�K.'....:..r.;e3 Volume Right aaxe0 a 0 ✓,�:s da.,~x40 ,..r.,..u'49 cC- u 7r,F _ yy,+' ` � � � r-:O.n, ,a- -07,, ,q°G _. 3g„ r5,.. Pi,,:^:4t a'K9 g:v ;I:,3£;->':r>., l-m+S,y r..,S- ,•R?i°3 h,• � {v, d Volume to Capacity 0.01 0.48 0.13 0.33 '-v.^+rK, ;,-y,..s,-.r^ _ _. .••�--.F;,_ Ja"`-`sv r.?::.;"rt:'::.-c":_,5.r- arF, ` +`ty eue i., - - ::,+-,��;•Tv. .•1 .Sz^' :`s�'`,'3.,�.;,,c;-.r>,� __ ;�,';3" •az.;s7aa':Y.- ";.' ,:w.. � �.-'r.: .;nr;;'>_a,�:'F:'s, 3.; + ;, Control Delay(s) 7.7 0.0 0.0 25.1 -.:?;�..-„�-:r'---'r;•Wr.,x�;��=, ;;w5,-rr.,;;�. �-•,,F...,,r„y...�,�;�:.� ;.��„-»,.a_,*�K��=°t,w�..r�'. ^��:' »""^y:i:',?-:rrs;�?3.. .,kyx;�.'m'�.\F^-t",:.�^-T.;r, 7�7fi::za+,x.,,s.��:r:.ye;u3-•'�trC�° •,-.6;.t.,adui�, Approach Delay(s) 0.1 0.0 25.1 �'„ .,A"d.'Q';s°.,i-^U.'§,,'�t" ,,�=.-£'•�.. .:�.:,, r �,,_�'�R,�a,. '.h�"r,;r=�+± ':+.zEF:'%;f`.'.F:...,.�>-.,»,.•. . r01Ch.'.LOS::..;•" -r �. -'�;•.r-. -..c:q4,. »...,...� � ,:.a"� ti.Y.,,«,�>nw�s�:;s`?",c:ke2�' .r�:..�.crs-._ ...m„�.....,,.-.._,.....:>.a,._':-r_ =:.:;�?:.i]'.-, k•, ..,a.-..,:e. `+-ak�.v.�di.:K;ifi�'"..+.t;:-:':`�;:ks�i;'�tc..L : ,z,. .,, ..sue' ;_kr `^ e`. ?P;r.-i• "� .z.'iKK3'��.k�i�:a, - �:sr" .�,�.t rr.:e."^."° - a"�,+.,:u;c e Ix ):k ::r:r, rya. r.;, tx' : r . r,,y. .3;sA.rw is aydw ,$ -:a..�:�'' ^':P=-.,y.:: t, c�w?`R'�i.;t3..c.,r,>•. s:^r,......,.r:?•�:,.w,_. ..�.'3.'.��'•�',.., .�_�.,':.v`.:'`ai.::d.:;:�a�,;:h:.:�,a'#.'�Y,:s.°�.',re.+rM`.w.�<i:h:Hi. :�":r:. Intersection Capacity Utilization 56.1% ICU Level of Service A =;F. ram.'.,'•'.��'±.'s2:��i"=':a, Y•^,�'�3 "'+° •in 4.x ti-'�.•fi„'..'�",a''��:,`_.aY >..,. �:- + .�',,. :';��':...ea��-,'Ya;-°•'.2<z,�-�•✓'-�s:"�Trs`��..., e. �- .:tsi::.��u''�`��-t'.4'+'�.':'�"f::;'n. PP�ep" ,� .`1.:±'ty;.,i.t;+..,4Y;<??1;;.. ,"":'a: I• :,)' -z i r' - '•.. • F. °�'�.,....•y..a:�-,.._....,..,,,_._�`�• .�._`;rdi.:`L"�;�r�.',�.:.:£�>r..e,r.,wcda.:,.,.tid>,r?.._..:�#+>:�.,_,.x:4:�,�8-�&�s�F'�.�-`:�.-�,.,.....rT,n�:"�s:; ..c..•.f,�s �;.eX€:i:. .k,. i �.'.s,��:.'�:,r;�:.��; Y.a;S • I Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 4 HDRENGLVL7-FF51 3: Lake Washington Blvd & 1-405 SB Offramp 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak z t t \* 1 I ; .;70.- ,:...z-x." ::cAP:r.-i':,t e';.K..-.` c$.,-;! i,{t:<': '+w�`�`. -. �:=' •' -9 `; .' «,., La'nekGroup:,�: �;.,:..,a. �::.�;�,..-.:EBL-:;�.�.:EBT�c,:�<•EBR. W....BL.G�:,:WBT >-:,:W:BRK}; ,.NBL �>;;_. T��,:.,NflR.;._��;8B ,,.,:.:SBT.:;.::,SBR Lane Configurations T, 1 + 4 r 4,_4q _.tT yt''? ':+ t:.t,,'>.. - .p... .-N,s, .., ,.j;.§tyr:AT'. .,k,T-.,....,i,.ltz a+ rA?,5.,-r.,-.,b Ide_ 1F ow;.' Fi"l rt;.; s . f 900' ry i 900' 1900-_ 19001900...-.4190Q`{''1;90:O;r 1900.-, 900� 1900 I ;190Q:;. '900 �a .�± ?P)� f..?,„,r�%,, -,Y,4... ,.�.,,..xe ,,,.v-.,�. �,.,� ,04,,,,,, .:..,.4_ ,: ...,, - ..,.,.,,,,ZI24" r,..,�„i." r. -...' '2.4....,:. . Storage Length(ft) 0 0 0 0 0 0 200 200 a .,7,- wear.. h,+r.•, >".;:.,,,, rm.•,,,.,..,}- -°�•;:,•k c:a.",:.v4:",- .:i74-1 t! ' wxaza ^,. �2.µzas, ;'•' /.-;,•. .iv,,, 8=.a'2 • 44.(°r " ':.° ,2 51ivf'at-,,'x.a.ldf' t; aK+lee a, A�iii�av,i,„ M. ,,sK.a :±1 ,e;71.., ."-y*.. ',',.,d 5,}}ora�ye.sl:anes.,��"aw• ti�`,a" ,Q a. ;c;xn,,,„l,'�a'}�f .k:�,,0 ,�.m- .rb..>,�;" ,,,.�Or'='`;tt.9i '0,. �x �.1..«,a..�..s,.,:, .,,z,. .zx'ard...,_*...,lis"K�:. :ut'�a:..*.-*r, ,�,u ,1 w ��-,.t,..:d:Auuf;�':e`.-':•.:..'zu ..c.:.f�,.dux.at� c::Rz�°-,r`.'k:e,'s'-�C-�ii.."�^ ."°��, V`a,.::1v"' q_ k`..A Total Lost Time(s) _ 5.0 5.0 5.0 5.0 5.0 f 5.0 5.0 5.0 5.0 5.0� 5.0 5.0 .iffi:•?.t'-Y ire" zd-,..nc' - ^;ef;•.a it • cl-'r�:.zo,W5 ; r' -„x�'. .. ,.f - �':.•'''nos: ,=::.?S=7r d€^.q;''':7+ iax?,.F-,_, '.tt r*- r-t'7 •j. .`r§' Turrnn S"eed:m h _�. 15.t •, °�, �4i.9 : r15'= '� '�9":..-��::r;z 5„�- .s'�.. f,.15;>' ,,- �t Y9 a,,.r,,,..,:>r.,g•�.�p �,�.w:.P�uur,..x,..�,,..,. .r.,,,,.,a'�°, Y,„i,�3�; �`„ , ,k::3,,,e,....brz'�. :'e't.,.�.�".ne��'Fs"..,x; ..,"w.,.,�,...•,t.Tt.+�•,&:,!. S,s:.l.:'ta.a�,,.;:t's'rE,,:�.c.:,:.i,1i�,..,,L.6aic:.�,*`•r�,�.�au i i Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 rf"y Fx.�`S;;7s,x t ,'r7,>..jr�•p '""n: .SS. :a" t1 w �:° .ram -rmm..,z �'?' `...f.P:,-,7s;>_+v :N" •!. P.'i`<" :"4..�1�, `-?�x.� �";:L.vw�•cf se`d "�'` ".'•: �,:�::�.=,,.:.'"Y'.^t z, ,re'x,-�..x^., d� "av�- _>.•-'i'. S l : ,...g.;, Yes„ ,k;� : 0:997 4 rv,>,r: . 'ac .,,¢=."r> •,".•::"'' - : `'.` ki,a, = `'x.„'-'4r::s0.850 ..,<.,fi�:.,_..!:rS,..rPFa:>=•s:.,..,-:w1t,..,-.,•-.-...._�.:<y<�,.....-r..i .,;.`•a cs;f��z>r:..-.._,:.a�� _v_e.,._..,•..T,,. >�."=„�._R.:�`A7c..e..,c-4:...+.,u .#s",e...c�:,�.�...s...k,:- .�..,v1.»r.=+ke Flt Protected 0.950 0.957 „f".,.z w .rntr t !fir- „.r ,vr;- ,...i»., ?k vvX MTf '.nrs ip,$..^^ ,e'fs,aq,.4•,w!4'r.sr:-gtz'Yrd' ,,,yti�:ij:Y'Y'•sas•r,.:.,""`"+meµ "."„`. ^^^,r, S'a d�=F o` ,""riot= ,,; ..,dam.. x. <b:` a,,,,3J:',K•; `w�,...sk t°770 ,. i863:w k :,,t.' g:, �. ,. :I*, I�->�P�r,.).�'t. „� � .�� °' "�,,..:�Q";�� f��.Q �0�,�.;� �0 ,�,� .�.'.�0:,,,:r 1'�6��,r...�i 5 �..w.�',.e ,>4,rrc;,n.,,arAt`x=�:&a,.�,ktil,wv. ,.�K•:s',:...�__,.+�.. ?„ _ :r,P,.*:ttw,r,.:.w•.v,c. a ,w�w;vu..�,..:su.sa .mn.;:x:..�.:n..`:. t::@u,os.vew=,r � .., ,.,~ Flt Permitted 0.950 0.957 ,• q.. aj ::a' -'4��`14 ._.,3 , :•.,•',7'"c - 70 `-rrk -, N 1. _•rk, ". CT-i: „_rtr,�'- °!z7' ,5a d:, !, ermj„t, 4 ,� 0;. 1839.N ' U i770 ;, 1`8G3 , �0 . ,,,,e t 0;.a ,f,,kr €Os-;',s1'765�' 568 T� = ��;�1,�.;,....,a; ...,a:sr3,`.,�^F'P•.��::' c...�.x5rii,., a �. = - :�.--.w. 7i';.;•.f ,c�±'+i.S:r�^s;�"4w,.�F'as,�t,,,,.:�.:esc..;6:ac,>:-s,�„Y,dc, :.5:;,:.z...i� ..�aa' au� Right Turn on Red Yes Yes Yes Yes ' :..,,,-.° '•-.' `�?.'"�+•(. �F7�'s`...;�:.tJ„tt;s�"S:.irfi�7., ?'"ap.€,, �";('�?Z�.","'i.'��?h3'"'A+,;'.��,,'�,``a`=o- rFt:,si:" Sg.. flow'RTOFi,i„' ::r:- -41 -Lklia s ", �: ;;r .<} ,_<. :��.:';� IG -` : . ;r124 e,..:.<,..�..� �,,:,..,.,�,.5.. .._sr�--+�� .#`;z,k:.:. .c,.>�sis.§�,r� T��.ti`t.� `�i:��` �� cs'x� :ii,.,�f2..,.^� = `�v"�s ,s,_e..A� -E..�z< Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1 tiK31e imi1?);�,.q�a,„-, r� `a lai2 »r 3g: 5ri..,. 4w 3K w 30T %Z _ Ak::,02bi�OTOP.Link Distance(ft) 288 572 1320 1319 rz•,.. .:tt' .....±7.,=r}�, 7., "r, .1,Yin4-.' 'r.mrb,•?s'.i?_ _,K";orp ;:;�'-;,' `.`;.74, "pi-m., .'�?'Zfrsc`a;•..,.;,:*c>,,- -E-674,"kr Tt •`° :.a+' ;g.-.,�- .; ,,4 ,:,";•., 300. x M- 30;0:> Travel . men.s.{', _ �.�:�T,t �79,, •:.�:`�'� 1`5_ • .'; � ..z".::x°, . „..�... ...a�,.,/,.:::::i'a�'.a' ">-..¢a.`'a,.r�..r,�.::,,�i.•_,..rt: .,:.�s'`ra�.,�>�::�r�t�z:�k..r...,..- .>.s.,", .,..a. , .`�,z..a.x,_ ,•u'u+, ._. ": r+;�: ,,,,.,.,...,_,., ..."..Yr°s"S3T.,; Volume(vph) • 0 732 14 377 77 0 0 0 0 48 6 72 ....n.Kt,;.•-,T.. ,'M1Yty^ - ;h C•,-.' SZ•5�`.Y"-•- f+.t._ .!?- , 9", 3`�c'r°.,.rv.'.-y'T,e.. "-.."i,%ratf^•'r..«8av1�..w-,., Peak,,----Faofor,;, 0.82? :,p`;8_2�. °a0 8 A---, s0.:93 :.0:93':s=:.:0.93>1 0 92 :' ,i.,- -..: `0:92;.,.'.0 58;: ,-ki,. ,;fi 0:68 Heavy Vehicles(%c) 3% 3% 3% 2% 2% 2% 2%0 2% 2% 3% 3% 3%O s,.--..x:;,..:r.,k r ".x�e-. ,,..-nv;- -n-«,r;A�.. .,;'''""."'.•'¢'",�'" :+�:�. .,.,�,.i<c•- ;�",*33K'""f'�t. r:+.,nc,,, :r:,'av<-' •it"+',.,,...,rsw;,'. €r,...,�.»...>v„ r�•� -:r'. .� s,,. ,�f '5-`:`�„��`3'Y:,�r. :'.0'`�;.. ,0.:'. 0:'-�•:, �.:.w0 ,*:x.: ,, .83': :�r,� •.�10 .f+.�,��i24 tl 1=19VVL�h)r�'.�.,. ::;�, ` 0' �893'�"� ,�>j,7i�r 40, '.<.�",�8 ,. c ,v � ;< :6�.�..f..:a.�,.;�.�:��:.�.:A.�o`y .,,,aa.�:,r�„s Lane Group Flow(vph) 0 910 0 405 • 83 0 0 0 0 0 93 124 Turn`rewr•- ,,,, ;u,.€c;;;� .-c F -+'3".' ,y-,.ttss?g . .-. ::'..:,."x,r5c.g-p_..,,rn - '-,•-,Ym-7s^tM,. ,777.,7;,,..e,...-. .., ^,•';"57,7 ;<;a•'; •^v .-.. -i iii _ n A7.: ,:F.rn,�. ,�: a t�;.��=_ "t �'Pein _,�,�s .,erin <T e::: _ ;.fi- ,� ;� �,a Prot.. .:;< -s� 5�, M�;.. (S :,.yC:mt�tin:.: ,.�w,a;eR4 :;;�u,ila"n3.=;.::.',e�' , ,.. �„r:._ «.No`d1�,'A ems. ,..w, .v. ..,fS,.*',.:�1.:. :.:�;ia....:.,'..�d,».:;,.';�::',;:,e`if,'i.;:,:w"K;,+:z.>�...,�ri/.ri."'*,"x`,m�ut„`�•.>�«�.'s7�Ft,}4" z.:u�.GtE.,w,......,, Protected Phases 4 3 8 6 -•m,^+-r>r Y:a'F'::-,... �lI ,,';6•. , -;.m-^u^t<,7-M- '.: s`,F;`"'..?-:rti' rot.•< <' . ^=i'«,---g ,;,>E:-r:t,r;� r:'-'7,r,c,-gt:,s.<..s,4`-.y;t _ » .3^, .2,-4,,.-,.- ."?.,4: JT. mY ,''.,, w.?,i,�'13,"*~. p"ri rkY , ,,.N:...a .. �y,�} :.K =;N :S �if,.: 1?ermitted:Phases ;' .z. �,. .,:� •r�: r ��• �.,_ ;;�"�;`r:�:�:d._ ^.,F �=L--: w'6 ��,��,. .r�.__�:..,r.:=.... ':�;w.�,.,",.,,._� %�e : yr;; .,�,.� �..,.,.�. _..w...rs.�>,,,��.>..:.:rc„m_....,,...kat:�. r....,,.. :,��;r.: ::;.:6 Minimum Split(s) 10.0 11.0 11.0 12.5 12.5 12.5 ' ;u ,... ToxS,plii1s1_ a _ 2 00:ax.5.701 . „ 0 . �8s 0 ,0:0at .00"��a:m0i 0.:..<� „:. .yw�74 ->. .4 'v;1.4,r, _ Total Split(%) 0O% 57% 0O% 29O/0 86% 0/ 0% 0% 0/ 14/ 14/ 14O/0 Yelw mey)�s)r : ;;- � : "'`; .?yrip4 0-�- sN,4:_vr:.=3 4-'0�.; : 4r"a�_.r, � „.^m,a �'+b �,;r � c��°4:0-s.n „4'03� "$40 ..,, , _� .,,.., ..u.u:,: .�"�:t.z:.Grss',-. ,..,%„_e'�:_e.a�� r: ,..,.,:Y...fa,:�:, 4: ,.,.. .1.�.:. t ? ,w-::,,x. �. ;.:w,,t;�.�.�.. 4-x: ;_.�:i...L,,,All-Red Time(s) 1.0 1.0 1.0 ;?�•:Y k•,:n t.;>:,I�:w,+a.sS"•.,. 1.0 1.0... 1.0 0 LeaiLa `),, ; ^ft^ ?F. {,�v :.;p ' �Lag.vp -�.: TLTe"atlp� r � :�.• ; =;�^- 'z-rv� _ r.' -nzasfi?,e:vY ^ _K �: s .�. . 7- a,LL14sw: . z, -l.a�-'Ln.�.. � , .�ia,... , �.�,_ ,;. :;�fia�..,�k>�,:..�LL !:��:.:> - --,2.,,�»,a;=�-;rrFz3 r:�:�;�»,-.,..t. ..--Nr . .Lead-Lag Optimize? Yes Yes ,,.s,..,f.;+.,,•-nvrr-r-"':`,m• •::r•:,sa-sa-M .,n"Y;•a,� ""+.scw-5:.•. ;.7T ..;K:-i`,(Zi•C" r";'. +F"?:tl,-i:s^:tv" x.�•, .*ag.,,.x. ,;a ,,.+�_ ,fic"?R,. „•r,, .�'c"'=^:r^.��7�:}�' 's: _.P•�id..�.i" .a- ";s��.x„ vay..;;'3':, ""� ActaEffcf:Greeri'','s .::�'_ ,=ri.. ��va" �52b` _.-.., �2,."_� r:.��1o�<,s...,r=;;��:>�",..�:.�_��.•.x��,.��.�",_:��• � ` .... '�.w,..r_� �<,�,: .ra:r•.� ,.. ��.,.,..1�,�.'�xx+aa�.. '-x..ra....i?�.......•-:.`�;a:. .-.,_- �u'•Yw`s�'et, .,Aa :.�tii;,:- x:��'ib:�.r reau:u:,,,�.,., .W.,>. Actuated g/C Ratio 0.52 0.24 0.81 • 0.09 0.09 vlP1 RatMio ,c , 2 3: 5;it: u r€ 0 95; �r 95, „0:064^.�.T• ' ay� 3�r,i +su M I � „;;�`- -6 5.87E 4 9 Uniform Delay,d1 22.8 37.4 1.9 43.7 0.0 %-{..,.�.zz- '3=,r.: ,;F'r=,:"xF;.es,^ ^"Y-_,� rgAY!': _a,^w.�z«,.,,..��-,, ,•s.'St�,";4' •£':�;,"', :T, � aT.?1.-z,,",s•�a,zs,� n,. >Y`.;I' 7�z•;,.._»- „ :. .r . 4-.j-tz. ''�S E ,.r r ` '`...i s.. ,`„".i';}w ;,, ...€3c a-, Rh,=_.''." a:li; °r -�; r;'S.rr. •Bela ,". -am �, . x,•~ `c=360'>3rn _�.�,r„�.,,•�53:4,. 1:•0; r �t>�;* �,;.,,�' �.��,t;;-...>.;��. , �':,,:, .r-,.�G,N46.7�.. �. 8:5 Y�:�::f ; ;::v .,el:.iw.Z1u�,��'�„?;ti�',r+•�:?.esv lt•L:-r:_s_..,v:d:.a;✓, b.�y':'�.I-: ;%'�'F'; ;'s:�,.tix:�:v `s•'*�`,.•„Yr�..rdz.'.E::_r. .�'sev.-r".� :,�h.:- _..n... LOS D D A D A ;."<: ,,-, ,K "r., n.S ,,,. 'Y',,, A�,..{ t{�om„:"z '':t+.;,:'t .X' `-,-:c.ta"✓ ."i,r4„5.1.'" ..,.. '�F.% '>er �/,„a7 :ji,� *,l,,r�/- _ '•4,r 6: s'i'ts-�'?� 'rf•5-rk�e�>='.,.tA :,L _ t4�>f..,7.d."6'ky." t 4; A '�oach"q'ela -� �� '� 3 b", =Fa":� '�' � , ry 24„_9--, PP.;-.,,.. .S:w'ii„;sz91SH� r'rr.:'t;.a°91„fi`.��.. _,S',`.S',5:z:=da'Rf."lu''.0 5.h3�,+&_�.z:7= sw.rs-�,G<.a..., .l.i}.:,__ :..a,.rd5:>Y3i.Y�`tr5"i:S:h.:se.. ...2.:•....,.:i r,. z.,Y, r<,. Approach LOS D D C x ,. :z '='tr'".`""2:�,."�-'-•v:;-x :�,. =K,:.,, .a:. "�:,, '".rg, �'F s'"' . .:e?:,ay:>3,.h,,...,..- _ v.;", �,^•; .r`r..=.i, '}»_ i.`=:' �.:Z ::' P, , ..tac>a. n3 Y47 TRS"�ak"T''`.'`k>'•�+„rt:r;'i'l-::;;^;- Iitersection'uliCYlfila r x? ',, :,:Fn:i.s:a;u 3 ,;.;ar...... t 8:w,N; <.s ::...,.. . .; r,J=;.. .,,, r, ,,,....,,, ":..p, ,-.,.9s 5.,3 ..,n .,., ,n ry.> Area Type: Other --v:^ w:;,..-� r^r.^yrr,++:.r.�6x,,:r%.sr;" :,;r,.•F, <u;'�r;'�a. eN•fi��vt^,-,.xs.%c .z vz r-.74.--`7•; .-f?.-s7t,�.:.f -r. n,,..,N.,,r;` - a`*;,.1,,, t^'�, ;rz Offset:72(72%), Referenced to phase 2:and 6:SBTL, Start of Green r: ,.. , « -.4,:a,xtsg -am' � w: ,. {ih t a_-_�yC64.65a %S: .,: .12v� r^ MTwE; as IF: v ��`,->H: , z h3 ," tA Control Type: Pretimed -•w,a:: -;,s:=8?'- ::.?....,,,»a,...n,..�..up. 'fiz-;,e..r'.?""_ u'".{YN,';T:,:ry u••ne; >+;,.4x 3a�� s:',?:`� �"'':,.•rzN•a+, as�v.,cr:.:�F^; .+.,Cc ;S?l. `..� ;sa •,e.x• .3',r?§30 : _:,i'•w:.a`":: Y° ,`77 rYd af£''`� . f iSe�,Y€'{•'.:c.,. "":`�.?.: :,'`• ;ft',:a.;" -4-. A.Aay�ry`yim<�%c RattosOcB� , y ,td,'. .,r ,,:.. wa <, xw+,-w _w< ' max;., Ev..."QLS.',.]..w..N..:i,w&,r,,,...x.,a..�a.,....x.r..,c'�`S,�is=a.,S'k.Y.Na':. '•�i:� ;« 5 ..%.:,:,R';s'ai,�:3 �," '6a'wF... a �.,3a.,. .•a-.:.k;>:s,:,.z,.,uw.. >;,�:'.au. ✓.4.�.ww.,,�a,.. awes.^��.u. Intersection Signal Delay:37.1 Intersection LOS: D 4 ' en-:+�,�aa.:,d«:*m•;a- ^^s..,•,.,-�,,}��;', r3�z��i "rm*^�:.,-F•.e•+,�,�,-.` r ny�,=^e_,!u �;c:�;*� ;'flx?'r•T�r€ rY*,-?�..,�z+, q- �� l�17•046ctio Capacity illlizafior 88.W,R :nng'.�; CUf evet7of ServicerDT��t°,'.Me :; ,"�.;,. , ;_ ZTA-F r. :; < Splits and Phases: 3: Lake Washington Blvd&1-405 SB Offramp 9r `'i+y'X.':t' :m�':--.41t' ',, -- 4. VAIMA:k xs„ '40a c:fr:1`^,:.** ?.4;tV.V.M.a:eg.11 a`:444,r;;' 1 Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 5 HDRENGLVL7-FF51 4: Lake Washington Blvd & NE44thSt 2OO5NnAction � Barbee Mill Property#11735'O01'OO2 Timing Plan:AM Peak _+ ^� °,� +— I �'. . . ' v -._--_ ---T -_-R _.__._- --_' _'__--_---.~ '_`'____- Lane Configurations T+ r � P8PmteoteU 0.950 0.950 0.997 0.998 \ FKPonnittod 0.850 0.850 0\897 0.898 � Right Turn on Red Yes --'--------- Yes '------------'Yes -- Yes ' Headway iT ^ .. Link Distance ' ' Heavy_ ` ~, ' Protected Phases 7 4 3 0 0 u 2 8 O - ' ' Total� Lead-Lag Optimize? Yes Yes Yes Yes 1319 ' ' Actuated Uniform Area Other OHse�o � (0%), Referenced to phase 2:NBTL,Start of Green Control Type: Pretimed , � Intersection Splits and Phases: /k Lake Washington Blvd&NE44thE8 -� o2 o6 _* o4 .3 . °' "~ ' M0 Gynchm5Report 8/27/2002 BVL Page HoRsNGLvL7-FF51 2005 P . M . Peak Hour LOS Calculations Without Project 1: N 36th St & Lake Washington Blvd 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak I. t t \* 1 4 i t)aneGrouc , . � �a4Y�� EBL �0EB7 'EBR �tNBL �'UVBT,aW R t*BL "-N"T, �NB� �4.SBL Lane Configurations 4, 4 4 4 .fi•-�vv,Yrc?-rxy«�t�-�r+-1: �;r,�� '-' "�.',,.—,- ^..."-"��,..,.�.,-«�...;.r.,..,..,_..,1..7.eS,,•.-�e-• 'n�-t.:x.-,-" .�.„� ,��c;' '.-,.��'`. _ [tl 7' ;B h ( .� :, =i 00 i9 ""`=19 0 �'1900. A s .:1. 4 ,,�� [ 9 00 .,. _ z.: 9Q0 t900 z >900=1.61 9....; �`,,:,,9k." .1.9(..0-�':`":`r.{0, � 4,. 0,,.�i�,w. ..'^_ia� ;n,4t"kav'"a..sa`�.;kc`ar�..n..>,.�x..ww�,,.:.w..,.�.. u.. ;.r„m:,��,,. ....,.4�;' s.�t�L,u,.. �'�..�..rm�+..,.., �'�` .u::;,',�,aw..;.�a ,.h ,r..s.E Cc»�:.�� Turning Speed(mph) 15 9 15 9 15 9 15 9 L'a e U t at or . M;^OA :i s'°Q '0 0. 7i 00, 005, a00 W. at0% g0ry ° 0k ;g v-0,:f ' 1 Frt ___ 0.955 0.883 0.993 0.995 /+.'ry.'P*� ^;A.*., •"'2"" ml� '.�. �iX:t *Yr.�'i 9,ah'! A";'>.i.'1,�., a7 �'�„c,'�+.,,; ,,�"; "``�! fit° �;a`nT ,+';z:. {, '� ^}^a2:�c'.^�t::r�"'""""•«-"'�'-�''�' ,�'?,�,.,,:g,'+.�'�,"'„' P_t"{f, eC#e,°IA .,.?. .- >.,0 J6C7!;.,'� i<*. r< 176, •'",` ;.., ,;,wt,.::,. ,,1440.7x. :x P,,s. ') .:: `0.990: .. ,; ��-2'"„>�v, e,� a•kcrz6'ah'Si.+.�...r.�£sm'��..dm..w,.,,.�;.�,c�,.�'..�S:nta.:..,J�,k :C�.�a.�� .a'�-•°� .,.�>.k �s,�sS.., ...r. �>.,. :.p7t,..v^,�:n'Js �:.u.:,.,r..�..>...;,,a Satd. Flow(prot) 0 1566 0 0 1645 0 0 1826 0 0 1835 0 I ^�1;^ , �:;;IT- x s; ^.,,. 73m.'tri°.F„� =:-,-4 .,?.=:.;,—fATC,=.°%fbr..7, 17..1.„sce,','�,_ 3 ;,. s�;^&7,4,; ay°` �,.,1 r�4.7,7 _ p -.,:z. ... ,, %;ay fu„�: �h,_�„ .� :4,.Al,,-. - .:1; :i?!1-riv..,r., ...t. ., ,eVir iLd--,4 :=x .3 ,i:- ,r.,,� .It ermined �:•� ��'= � " fr�;:�C1'9�4'=�. � ��.,....:;�, ,e.` 0;997" ,� �...,�:�4. �099p. eAb� _. '�'�' e'k7i::n',�:.'�' �," �,s 'w';,i:� Pr.. i:"-^ t _..H:.Y:sw...: ��,.-.�.r.E., tt�.. �«e ._i "tc'<r1m...:.xm,..w�,Fw'��''��w'�'�'-a"W' Satd. Flow(perm) 0 1566 0 0 1645 0 0 1826 0 0 1835 0 "°Crez+r.+. ^+e�;;r.�;<.f��a''�ro:'•��.. ':#=''le;r.� _ �.;,f,...,.�...„ _ ,`:ar.� .ram•z+^.*„c-fir v^t,,. .. -„t•.�„�...y.�. .�•y�rr-r,-,-.� ea wa'°. actort.,- c (.`0- = ~':X P d �, ,..��Y. ��,:o.�x�:. 7�00 ��oo .�1004`� :�o r�.�-,:�i::oo,`��;i.ao�.��=:��,00�"�'�i>oa �oo�ti�:::�� ooY=w:r-.i�o �,.a �• ,w ..:.ei:.u;- :'�cicauLk: - 'r«r,• t .�`. d ..`;_ yi, .,ti.m•,.... �� ems .:` s�,.ss.� Link Speed(mph) 30 30 25 25 i , inisfa�oSft r i? :. �» '320: . • �.i_sw!. . 7(..•(+.w-YiTk:'"� ;1320.'.-� : tiY�ti:a^iml' ? yy�.^2 Yf:: '.�, L. x. ..,.ra: Yi�r':i.� •.>wi_ v,.t. �k`�a.4 i,..:w :a>:;in4;t.:i 'ff. fin;.: � :szz�i�-.:. 7� r� i.,. ,,ik.: ;,,s•. Travel Time(s) 30.0 30.0 36.0 36.0 LC9Igras.�rs••v-.ra^ ?t. 'r?YU,'*1^�Lro';s'�+�-':�" - '??��— „`G+sMm 'nF'tt.� '"�,'^'+T.aa�a'' 's�rP �'a:�,,, cm yy�'tf' P�','`a':�+'.r.,,•�I - ? �, ,. 2.x, ,P•.' .:OT^�%`='.�.� fi:J.. .:,w. ' .;w. •.r, v'�. .��.: x.. ,W�.d' >s: 1'U. Peak Hour Factor 0.58 0.58 0.58 0.73 0.73 0.73 0.69 0.69 0.69 0.94 0.94 0.94 ; -,�,�,3':+y-4 ^"S^>-,: --�A�'TRF 2:3'•-,. ;'�F;�+"'7 - .p„...__•^. - •=k -^T-"5y ,;,;, 'o .�, �zff=i o"S o"' _o d'n�°�;�" %x;�r��,,. b r=x;'� �o�:� :o'•�,Y>ad:4.�ie p.,,;. ��o•,;,�>.T`.�: o' , o ilea Ile cl43.:✓o\..,� �,'-igiko'_' 14/o..r 1'49 .r:': g-610�• ;g17... 1e,.,4:: '3./0 fey„ 2 a :.•C04 �:'.,I.t'sti..r..•.., '�' `r. �..b.ev.�4"€.`�i�nt::.u,.,.4�-�' .�" .:..�.,s .a>=r,. •.ai,.t''-...,,..,...5:..&,.e:;<....„...�.ttiz::aS.t•..,.� a"'":"r•'".., m.r..�.,°.-.....:.a Adj. Flow(vph) 10 10 10 0 8 w 52 9 155 9 73 259 12 r�r,. ?s�� '�,^:�?!��" . .m :`r' ,'fir'°"'�-.`<",...,-: �-�y..,,.�,,.p..' +W t.,4'k� .�. .,,y ,"�,. �,',:•::;,, •"k'V ;i""sty s '"k:Grou 1=1ow�� `-h�.:�,. b ..��.�30".;::'. 0; .r'�iBO'"�=:, ,�:;`0. ...�-i� .17.3' �?'�> >:�=:x•0 :.::r;.394; ,<.�,�i0 Cam ...,.(?• (kP-.)..��•.>,�.��,�„':�� .<. ._....,.r ��._1.;�:,�°�,�Q.;.�u�.: ._._�..-._�:.E��:d. ,�>,�-�,�..::Y�':.:�:,_.�x...�.. ••. '' tea•.> -.:...�.� s :,.� '.�..�. Sign Control Stop Stop - Stop Stop > �rate '�C�Ot1 s m �" r ��;': ;``. a.�yat,,�,,4+"-•"tct�E i�'•��.'�,;..;� 3;;"-'i'� F� s �c"=- �•' + �r z' rse U..,,'� um ary� . . . ._�,.�..�:: ,a._;.n;'..,��r��'��.-��.��-�.��=.::�. , fv�.�, .�•. . ..- .��:. `�-.� -�•: ;ls. Area Type: Other ;. .,, F,; - = >�tr'o'.T e:>tJnsi—�77rialiied�;� �,..t.: ,gig,:. yp.,.. :k;�,:. :>�';��;� ��f, :,•., .�"F...yP .,..,7.�. -�.,�aia'v.s;.ss,aaL, uri.�_;Ys.i�,4b`:�`=..,.,i'.�'.,,e,:.�:.nx�;�a�::s�tr .....,:r<.�;'�'.°e:,:,';;�,:::.�a$w> r:•tS�.M.M:.,r-.»�u�`,;::w:�.;s�'?.3.,.,.?,a•.:s�.iY+.e.i �'"'..�...,.�E�.'.'S Intersection Capacity Utilization 43.7%U ICU Level of Service A 1 I r ' I - r r Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 1 HDRENGLVL7-FF51 1: N 36th St & Lake Washington Blvd 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak \* I...** '''''.7i7r-77."7;tBLY''':777.7a-TVIIE191P57-WBEr--1IATIBT7NV-r3W.7..g.-INr3-071TIF3117-WNBRY-i.F.TS-1-3Eqgl*MI-MTSB11 Lane Configurations 4+ 4. 4+ 4+ snop So Volume(veh/h) 6 6 6 0 6 38 _6 _ 197, _ Pe-akATOWPactaF..":"7: Wq1)7T-5;9'770?5787FV:75-9724K9'7d7f1;Tii:77.7-TOT.7-Tt7-.Z7597. -.:79769W4.:59,;:.P7094 .Q;941',!:,,:.1.1,0',94 Hourly flow rate(veh/h) 10 10 10 0 8 52 9 155 9 73 259 12 Volume Total(vph) 31 60 172 344 Qx,:,Fr. Jis , Volume Right(vph) 10 52 9 12 ag.APP-KCMg4•-.T • •— Departure Headway(s) 5.2 4.6 _ 4.5 4.4 ;,04?fisp.0:08 0:22 Capacity(veh/h) 628 710 772 804 POSItrgigeTiROTTE. Approach Delay(s) 8.4 7.9 8.7 10.4 • HCM roac ' • •, -77,77,77, _nLersee iorr _urn • -'4172`":4`' - . 4 Level of Service A iiifereiatiOVaPialitiffiffigkin-1,7gra7-77.'Y,74krk$7.fritt) • Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 2: NE 44th St & Ripley Lane 2005 No Action 1 Barbee Mill Property#11735-001-002 Timing Plan: PM Peak 4 '"�rS':re,Txi mS;.` N :twn� „4 ,,y"°??,v',cr tg^;. .*^ sT3 ,.r .•, ,w,.r"": g" "r '''''1 1.z " "r '4az.,:.; -,,,-- 1 �rl _rOl jn Y.., 1,: r'. =EB ,,, TD ,v v r, „3 ;i:;?"" ,,, = r.� 1.4' 3,r ,, i': .` s...,,,. .r.k,,,,v, ,.,.,r >' -s � eG.,-..{�»� �.>.,"..-.:k,.- �.,. . L.,..�;�_ :�,�WBT;,... , :B�R. .,,,.r;SBL .,:��:$$Fi:..;.N�w�.�,,,.�.,�,..� �,...t ,.._.a:.F..»,: t,.`:� ,-. :�..�� :� Lane Configurations ) + t 'lye ...F,,ie „%•FitS'';f,"n' .-7r;cr„.v«- ,t.a'aks"'""". -nr,.,,-...,„, R x. ', ,,r^z.. ,:;•,.I,ar:�,,.,„...3^`.-.'.4.L•+e�..Y.• .z'k� - ._.,.o ,. ,k ,: 9,00:-,,:,�90'0';;:,^.,,-,,,_, 1 .OQ-., 1.$.QO:e'� _.. t,,"; ..,5,•.. ., •:;?,:xF,... ,•,,_ "�,a{ Storage Length(ft) p200 0 0 0 �. ".;,q zr^(Vt rye;, sP., ,""_'`'nn%�cm7.•T'o'',"'..'''"�:r{s,,�,^"' 5?';e"."; a°"-' ':,far-",j,'�m,T' ,T:•- ;-a a= r,rr,.s.,c.. ml . :,,:;,,``:,.. E'" ,..,,, S ra e.lta eS .,r,. .ur.1, S�,•+;.Y'€F' .^; r•k�i0• �: „n r .-t,. ;.p';r;;€r;:` °�.•.'+,, ,x?,,.,. rv,�L,$ aa �vugJ.Y wab. � �+ �µ�xJTf,.r $ b a{ -.p• .k.n T'. �..,Y ^' k. 0.+ $'�� ;.•:�.i' :le"f. a..,�. ,. %;.. �:�:s :�.,�u"�...a,�'.":rd�a�a;:»;....� h..�,� `:�,. .as;;.,�:�,fM w.:�,w..d.u °�:,s: }.r,�, ,iix�.:�.e:.:;::.§ _.aa,�.�a�'+::,�, ll'�•�� i,� Turning Speed(mph) 15 _ 9 15 9 _ ._ .-'1----s"'. .• n�;..�•�r�t�:3mr _4.-...s,,.�.xr•-_""„us x�,'y.�" _ ";";.- �?&a.-~'` --;,-<.`;� A•�,��e`,`;?K'Z;,-'�rY77R;-`+s�,�;dtrn?�Y .rt, %fi,""., n :U(-F C—tOlT :Ec` =,t 1.0,(] '-ri.r ;1 ..'Y.'°.O '`y, ON.,gs'.,.. ,Il r %.t ,�.,:,`} •.4<. ,_`»l, aj.+ 3: W144: ��.r:sktfL::�wv.......^Y.`.r.`�4�'a��:ia�i7� l n&An�,.�Qo r r�:r:�� fu' � (�� fi °��:.�U��: �..fl,Q"`"y'T'��x;,.,;4-•.,^...�. ,w;.".,,�:,:, a'Y.,..;r :��", r I .�w,....:s ..,w., ,,,..`+'�:s.. rx'S.:.ae7�`+ as;;:,r�» ';y.;.�u..v.dr_ ert`:k:...fifi,... ki::;�.:1�.,�'�.�w✓�'�' ,,.c,;;.�.•.�t<:�€:�a-'.,:. Frt 0.989 0.970 'gig x24,1,::,�.p..�,� 6,(4 .,Y,' , ;7=7,s"-zrJ,r`^F m"g• "'7".. si,.,.f' `'r..",f.r^r.-!,-, k,".r%v;c::ar .;+a..7..--r• ,t�;,;(-� f..,( Grote, t o 0 9 Q $ ' 4 : . ,, 0 6 Mk•_: ':,. ,fli ..-i, ,. . .,, } t � ..r:�rsrueofsssa,'::n..,...x::,,:x..:., ��.. ;ss:: 5.a..e: w, - ,..�.�..=...n�.A;.e„4s�,it�, ..v.e.:�t•� �...t:: e�..�w`�am'�..��axua ,.+ „,,:�...x+.oY, Satd. Flow(prot) 1770 1863 1842 0 1542 0 ^- -z4. 4.4.:,.. ,7'*r3" .,!iv,7:;'s r!'.."'z¢.`%�.4^•ry%'� ci'a�:m "`.t Syr,-.,.,�„', ,,".^Y,".4zir., r•u;,:,3 -.7r<.,,,,":Y•> ,P." :Z.t,..:t., .r." a.szi:7 x ,r.tt ^S,^,�:aa�t r - arr ') .I.: '•.$`Y: x`h:•.° .:IVII;_,..,, s4...: -I l=t�e rnt,tt�`"-""_e, „R _ ,.. =095a, .� n� . ;>�,- ;=.�0952.� .�:�. °�� ;�.�� '�.� �a�` >"_ �.e.». � -; u .y:. ..�a�,.vrar..zx,:.",�a,� �'..�s;Y�€.��:.� .._. 'sa,a=.; :z;�.,zH..• e •fie s�_-5 � c� `4�Y� u:a.'��,.,� .9 b-', Satd. Flow(perm) 1770 1863 1842 0 1542 0 $ .a_ u" ; -r§> ••;�^* Ar. r.^^•;..rw.e«.^ ..m.z `rr,-,••^z,z :x r�•i�7"^ ;',r :3>. 'F'^'t:C,� .rx::.. �r..,s�;;• ti ? 'j'i'n'�"?`g7a ,l s' r,4 ;tom a "' :'' -,4 - . --. --4..a..-- ,.::1 1,00 > : 0 r_:of 00. : `:00:... :.1:OA•` z_ .°,.; --IS , ,s;; `> ..s,...,, ''''' -k- t:$- �� :z«.�«.,:,}.9t4,..:-' �'..,�. ':,,,,. �.�- »:$�:,.K...,..._,w;�.�,..en..,.,.t��u�'�,,..,......,fi�14.-v�.:sst�a` .�;,::��.'��:.` ,.::,.�.f `.�i.��., a� �zL:�z°�va3 Link Speed(mph) 25 25 25 ..ar't. ligi^+-FVa,: ,,. "a,.474',�"'c3e.'«: "'7 ••711,',,V.:7 -ro.. `..` rr:�.wr..;rg^ r+r x rr„��rykppbistanceff"3�a�.f,:;'=:�f�,-,, ,. ..;i`32'i:.,�.:��. ,�85°c:��,:.. �,. :3�`9 ?.�w, '.,.�:,.,��1.R�,��•�: ,a::<--t,��:,�� °,w�•�yw ,,.�-°,�K,.: 4{�t?,,.;;� ta�•..aka.,ne..,.«rvx�.�rn.n,...,..,<.tali: 'au;;:' ..,:,�.,:a�.cv::,,::>,�.:.rtxa,:u,.=...�. �i' ... ..�,r„Isrn, .•..,..�........e��.,.sz..,ks:.v�bk..�:;�...amC.,.r„a,,..m.�..o�S;,u.,.,:r..:�a,'.x�,a.. .e2a�*,.�:.0 Travel Time(s) 36.0 7.9 x 36.0 I n: ., ..$ F;., ��%-:^mot -"^yx.^..n^+ry, y, >..s.V: Nh,T.-.�`y`T.'-�r .t,. 1 .,;9.',Rr>-�. `'' • '-,r•4:rr `1,.:t:FS��7'TZ. <,,Z.V7 r ,- __ �/aiyme'�Ph�,. �:�°�" -��6..�, ,��155 t30i `g;��27- ��«-22:. ,�1 � y^�-: �, F;,..,,;:. ,..Fi, 3. frxYsz. ''m"."iz"'ro��`iy,9slT4a�t°;ae d:,: cw".w. r .:;t�i,;e,,.,iss ,'�.;sr:dw '`e�`.e"��:;x#"'1S}�`«„�i:Tdh.:.;:a'3.'.e....,,hv's::',.bw.k,'.:,.'ibs:J,:>`.�i�N1". Peak Hour Factor . 0.84 0.84 0.96 0.96 ' 0.68 0.68 .*evm+,-.,g-;°:.,,, ,.+.re�^:r:a:y r"'p„.af.a�.^`p ,:�,"eu. i*'^';.�^' rs xs=T-- ?`"Pf"".�.:'�'a�'.t Q ,,F,u:.,:r..^:a•"�H�;^rn.,..:,�,?•",r�,..; ^=s;.7�{�M x.:..::.r�:T� -_ e htcl" / ��>E ..�, <r 2/�-;' �2/0 u,�;2/0�. ,1 ;:�,:�.0•:=�;.«. ,�`•:r:,,,<:-gx'•.x,,. •,�, ,li,u; ^�3 av�y:b�:• ems{.-Q�,:..�:z;�;: -�.w�u .�::x ";�.,�v�w- �:�:::x 2!0'.�,��„5f4�,,9' 5/ �.;;�� ,r :. �.a.. . .,��,�w��.f��>�.��r..�-s, I Adj. Flow(vph) 7 185 314 28 32 94 Q w w� :z -' 1'.:t, •fie,•-'7772"-7 �.--'r'='`"".=F"'" ._,.r�, •av:- -r7;'��-� Ts-^fir. '^e•—,•. .,.��;.�',, kaneG'r'ou •F[ow:/.v hi.,� -7.-a;185.. �nA2,.:"gt ,0:�' ,.r.,,.?t1:-r,�.;:,�'�,0,:";,, .,• ::;�+,F:= :- a• ,.,,��.�:=",°a;.. - L,�,u,a..v......1,»��>,..wL:xe;..�iir�,�.:�-c�w-�,.:,�.,�, ,`,`�,u>tr".3_•kr.'.... ,......: ,..- s...,....,�s. - �,�:;4: �'...Ar....s.,.�,�;,..,....>i: �r1s:.,- ,.s,.,..�:� Sign Control Free Free ' Stop • , :; 'ma's _ -°:*q^ z3r ^„'�?,-r^gt•a O:^•�_ ._s;f'-.r'• .z:•O'S..`i�'.. .x,V 1`tersectio iSumma; ,.� ��•�4' �.�.��.Fr� "�,:£.e:.: -A:. � n.�•- :��.�>,K p..-.� .. . Area Type: Other ` '''''n' ' ..4-^m..-,_,-_•.;..:,.r-".-_.,.,""P-:'r°71—gg ' ` '";'":`.�:r:r,. ,... tg--• A,T.."`-rr'x ^- nta -',.-,-:.ir,,..<iri�..0 '?'�.,.-<s,-,:,•c-rr;.r� .;, :,,,,,.:u ykntrol T.;ype:;Unslgna1.izedf it' . : �` �., W.Y -,:: L».e '''' '.4,�'1 `'':' ', y ,.�.,......a...,.,.,S�ry _o.ax...., w-.L r.,-'iaM ...z.,. »„ ,.:.=f+:.a °- ;u ....•...a4;s. '. `:.; Intersection Capacity Utilization 29.9% • • ICU Level of Service A i . I I t I i Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 , ' BVL Page 3 ' 1 HDRENGLVL7-FF51 I I 2: NE 44th St& Ripley Lane 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak motirw�eva y,+., '..,.,',`., 5 u. ^--"--'-^ ,z "_...Tr;`ti°,4; -,.•'•'`1.,x,.' „''2°; :—dzi?ei>�';;';% '_z..�.�yrr;.,,, ;x;� ,.y:s.rr^";'Y' I4�'o..em,erat�h ... ��: ,EBL `EBa�'WBT WBR� BBL,.�.f•SBR � E �'��.;�_� N aye i„ks--- � t cx, r�x", c<k.':€ ,'��`A'��,�c�,, �zr;E;., r��'f:�;L.:. `*e d- ��. Lane Configurations '. V - --.cm+ tte�*c.-{ ara+--s.:t g Rr;x. da:? e—ev aka. r.:!:,'ij�;:m=-_roT�•>•,:','m-;t; :. pis.,-..},n'`,' .�'� ',S=-` .,'1"""`a:zxFr-- fi u . x. -gym :' .. ?;? ""^ as, I n�C'iQrl�r01°° �:'�xs- �<: `4.. �:.t, ,1'a@; •"�free*��rk,,��::�� =a.�$t0'4�'; �;'�.�� 'm` ;. :;�: . fs, � .;-l-n ��r` f Y� „�;��, �g.,.....N....,,.._.,... j±`v .;Y,a.'4w� f`l :u.si:� .P,m:�.;'.�.,�tr��..' �^',::'='�.'.:,..ti�sr::r: r4�C'3:.: Grade 0% 0% 0% ,,,-• ^�, ,,. . xw,++�3'.,9 �f ��,„ :.;r..:rr- .,.•� ,�w�p•-.•-;;xa;^aceY9• ..;, .,��Tq; r , .'-y;?; / • „ .:may; -mac` V�.` j".!4 Volume'vela/fi :. '„6 =:55 ' 301.a, =;27� 22,.0,:, 6 '� v -.,>.„.. ;" }., t,,fi,: _ •<,.., � S,., �,) ,�.�-.��,�'';�;,a. ... ��.�.:z,,.,.�.,�,o:e,k,�_ ,..,z. ��:.a `�- ..u.�' - .z�-..v„i��t„�r,�.,��.,.�.;m:t`:= �s. ,.z<.�? s.:�;:.E��.�r Peak Hour Factor 0.84q 0.84 0.96,r 0.96 0.68 0.68 `-..1.,]..;f vEi..J�;,•t<t` r _ t�i Y" ,'f`'�^qS,:"` ;,:. ri ;:fji.�., 4a'.a'u,r:t-n ":h..r` �."4:., �t"A; �,w.,,,Y xr��..:�z. h� •��.�- '�� ,.,�Yeas.,f:4 � t2$,=r.�_., �. � s;,. '.>.�.�: �� "�.�.,�.:�.. y��.. °�:,;,• .z x es. : m.r �.. Aa•„r ,.:-. ,,.L.:.�c,xti;.+ .W...Ht'cn ;.a•i;;:S,..+ 5'.ie,.`.�i4t3.: �ua.>tn"r"�..:s�s�a .+•�...:t�a., F.:..,, ,.a[i,.:w' , .uw,. Pedestrians - - �-.�,--,,,; ?c.'<r,)rr,;,-�&��..xr,�'f'-': .�., -;pc"=-=Win*' �r„t;R`"'`°',`.-'ks. ^_%�."a4:;^ �a?"'{ r=',."'!z•':,F�s�;.�-''o.'py".'.�",'=-.•�.� ..::1,. }..�"`�:�::"•�r:,z',^�`�Q^ .�....As,,."", sis`w%,r.,�;:%�vrar•.r :•L�:.a:Xs``4Kw��^�.•.,�`a�r.'>`,d€s.. rr�'.; 6�cd,; =t •., '�,�,.:�9.�r: �a r� a�tw €'. ,.,.�,:..:x4 ««�a.', "�''�°#:;'��:aX.'rs,a�r;+7ao:�`�£•-�:.:�z-.' ..^`.., :4 � :�ai4c»..::� .e,•i,::%h.,»<,vS:.�i+v:,�ti Walking Speed(ft/s) :,��„ Via.' :.- ,x��",r,, � .a'"--A'� r�-:�w'�y`mr�'>,&;r"?'�`.• 'r." ,*"w"`«w•`'sv "T':`4 -erceiit; locka e` . •.r: .. 1 y� ti . K. .y :,: :. 1 � .-�Aa ..a=�:I:•Y'o.�',.._�, 'rb,." s: �r„�:n=sn'"4..a:�r:rm, r.> '.,..::,w,S�:.�,.ea.:'sa„8•'..�,u';2$)`eo-..�?L' � `�{sz �� r,�".',-_i•;''..:; >:4 Right turn flare(veh) ..-,...r,».-.... Lkr�^v+^,; c*r°z^zm-^^�,•;. r.'^7T",S.";' �,fr sit. ti •v..,.,r•• "iaC" -..'r e;, ,k�,.^,rY,;t' .x .Y"2'fi°.,,' ^' sf,`;c,*"�.fiE'm �„;;� ;sr" �:;`':7•: ; s ., ..r�;: ,:�{.: ..�' ?'s� w, .,r„ _•:� '3r:r;. :�•''�`.'.':..�•+.,,. ",1r � ,,�,";,r:.,..,..t. ,w5,,x.^e *Aedian}}��m�e ,;:,,:,- � � :�`, ' '' ��;°=(�orfe�x`� v:.. �' '� ;; -•��r ,�:� � d�:.'::x`,.. -a. w� �"'.<:�.,..•:','k64'i:..,�.�r;.as, �c._�:C::J3`f�x'�;�i.,y'��..S�Y:ai+.r��»i «Y�,:s:+.>..r::e�+�. ,�.,�:.a<.'•,.,u:T.t,,',;�.-w�.as•'..u":?,ta�v,1 Median storage veh) rr-rr,�....-. .,y;.,•a�,+;,..?z�'? rr, ',•.,�"�". "...-'3-g a s";z,;-x r�"»„-':".x`` , W'ii�B=. `:_'"t`=' _- "`+£',*r'J,�i;x:s""y:. �. ""`...-,:..�,�°�'. ."3,',�t;'�;�r*..,,r";."Y'a"""`�a � .x � ,:526_ -328�: . ,... ;. �,,,. �, °`�•��,p �>;�;:£ffi�xsfi � ��„ �.��s��...,x.s.+t,c,e,Soui'�,�i':l��.'.,,,..,.,...'.'ref'�e.:J.i�a.4t3k:;:T..,,.� ,k�d4;3.�';.a',..t.,a4�s1Y`M^iu.; ..�u,'.::.�ws,,,.:,:.'..�.::...1.,3 $z:.z,>V;Fw_:s.,,......u�'.r�-:�}'• .:.:lSrt'r:»""E:�af;.'2:aP;;r,:w:s a.,.:..<.1k}r� vC1,stage 1 conf vol ' _ �1+-'fry ,�rtr.,-,�•�.:..�-;4�,-Mt::r:`t.:'cv.~-v'. .~. -Mrs+•s�,,;;*",:17>,'.-ee;�,•.��.e;�:,'.,"��:..o,- :;,%=' .',:iPC':::*-•.v'?"'si�+UC2 fage2;cohf=voE�`.,=x _ ,.�, .,.�.: . .�:�,�1,•- ,:_.,:.:.u "-`¢` .f Rrry s.r�c�. _ ;�1r.< :�-n, _ - .�;: .,� �'=„,<., ,r�•-.:. =,r::��-r:" z i -- r' .......:,na�;"�-_'..if`i;. a-tis ^s..., ,.:ka:.x,`>' _,..��s>: _,... ,"'i:,r'�.''a'..a......._• .':.�..:.,::nv...5..,...,., .-r:..:x:..i:.,. ;x:'�.:.«:S.:.r=...:t tC,single(s) 4.1 • 6.5 6.4 ^r+-.r,.,, � ^��.,.»,°Pa`%,,i::.,.:.... "r,csa?f7.' 's$;°7L.:xas^t ^.s'.-T' �.,,,y.�,. mnr,*.•.:,,,.,.,�..^:�n,,,'4..�7^sa,,.ertmrr.- ;.,�,.v.-� ,.-•.�'t;7.','M`^ 4'.s a".°M`,.'c'.^{ ry .a.., .'.0,' „a• .t3t}°0T•'�°S,,r ...�.rs,a,£;"„.r. y..._f .C:.. .y., 'r.t.',r r.f,.- •-r. .;t`: ,`r.�.:; .�;<'°t.s:'";.,. ,>..7W,..�).sLL,� -...,,3a._.= :��.:�«•;�..;:'2H:sa>�#�. ,.:.E'-.;x.:,,..=...4.. �iN.��,,,•"'a.'`�- ,= k...,.._.«d'i.�'='._:,e..__?Lv1:;s.,-.l'a'�:,'�'�3''<ax•' ,�c.�Y:z.>:%•:F:��.^.,:i`..,..•e".,..�;4 tF(s) 2.2 • 3.6 3.4 uw-:.O. t$:s.�#�';.: .;a,,�•-r.„.,s, ":��i,�, '-'.::.:.=:•,aw�•s+��.z'v=w ---ru,cs�=•,:a�.s;,',�-t;"c^�•awv+•y�'��wa f^:�.. s-1�:. /� __ _ .':i"i�� "'s:a'v ,;:%s't'. .�X,..�i":.r'r..: •;'.��°.,::,,s:- �s�ren,3.';.. '..TM.',�;;z•�a ».`_.1,:. �w.,x,�.»,.,..,_.....k-.;r2i<iS3:.. „e„sa'..:...,,.... ,..`�'.;�_ .,:.aF,:.Y;..�.,ck:.0 ,.a'.e_.,...�.7 u,:.,,.'.ia+::,..�.,_ ,iizi. '�`�w• .:r..,t � . • cM capacity(veh/h) 1217 487 685 irectiori;i:Lane;#, << s. DES=1 B;2 B:1 '; k �. `:. ,. Volume Total 7 185 342 - 41 '^f-,.'"^e«.:�,..ra"�.,s1s;Y'��'.?'.�,..K*- ".'T:,?,`t'..Ex�y m> ;:a,�'""iF're,-,.-y..,,.. 5• rr^zw i^:S: >. �,..^-,� .:.y;; t. ,c.�..:;r .., ,�r.:r-}. •-,u•.c.,r.,•,a r^. m.�,..r_: •-' ..-v.v.,.,' ..,..,....7,..=�..-..••..,' ,.�,��,.»�. ��.�a0'•.:'_�, 32r.�� z�:.,�_.,..�.'��x...;�,a;.�>�9i',r;�<.�a�,,...�..�:::_..:,:..._,._.,.-,. 3. ..7<.: - . .`�...,�'u;,,mi.'r; Volume Right 0 0 28 9 -.:' u, .t,+a ne'.; r,:'�' y;;-1' r•.�.€-'s;ii.;;ts:.� .�. :`;p!',e^•'sh:..$ �.V a.._ r✓as..d =�1700:id „5,:�9�"`°''°�+�., ., �n,�..� Ykr ^#. 'k:':"' ... •:a:. ,,;�.:as,'.. .�_,r..s..N�k.:cs: ,,....s.,�...,,sY s.��.r„z.,..e,.v,::;a ��r :.: �A+.'»�:.Y:".¢.�`S�(„ius,�`"s,l:.:{t:':'�fn', .:.�'.em.•.:a>:SA::S.U'�: ,�'�.,o,�,� ..vv�� Volume to Capacity 0.01 0.11 0.20 0.08 •--'—•-`+ ---:-Fo.r•z;�^r.�,r3',":="'a rr,-•_ :,_F -vvyv` 'r"'iy^,�S?;,. -v"•!.'�;:," �"S': 'F•:F••",-,-a -^:-L.:..r r.. - '»•��'ChE ^:5^R:R;^a.:^,^, ;^:�'i '>,r.: �F:,. �'a u- :N. �:.4�`sv�.-.:,F:3~'..; - '` - -•t`r An,a:.: Control Delay(s) 8.0 0.0 0.0 12.5 _ •rtigagr,- •"r-'x1Br.>,C-'3TS::=a";a;xvt,., ." ,#ti 'F'��" T- •+?,; "S", .vmr, vr.,7 �',.. ��i. �,r a�:%rN �f''•"&�',.r `::'3'•,;y,;°caiYix=' v, t',;R'. ry �•�,1a; =':'^,t" �{7;:=:�'t`r:.ss'm�,-'.",ny",,.:•,y>;�; �tf:.s-,•n.,,,,...< .�1y'.Aex Lanes�v'},� `�.�i�riA`��` ��,ss^;.`F'�s�,+.:a`:�vJi',rt.-;,:,� `�•;,aa� v•">W:r '``,�Q C. .r'�.:� r, : %;sf • ... ,r+„{;�• r _a ..{ Approach Delay(s) 0.3 0.0 12.5 r-n V-.,,1..,.•.--.f>•«, ,'yKi:�.',v.'�Y.�T; "?'a., a,S_ '^^,�'._" ,�,;r.."" �s:':a'=.'•.^"yy,., asc?' Wtr ";{:; .`pa. cy�'„ ,r :{',', 1',^ss.,.,-C 4"��':.�`,�3i.�• `S'*f�Y.�.,�.,Gm'.;y�,_x;,,•"ve�+�v5�.�>"",-T'is.""rn" .,.z�,:,.,:n. ,�a:�,a�... .`�,. ;�: `r�-,ems? •B '„ N ry w v�,'r�� .�. �,.�,...:: f,. yAp��._...W.x_....,..w,:.f�,k,.s.,<..ure .r��i<"v: ..zt ..,.,°.�.:a;'s+s;;,s. 'r s;,eaw, .;u»�.. .:'i1&`wi.�:.,s:i�_^:�a;. s•:,.aid;sz:>si4`,',,::zi.?:,`{e"ni.,,:f",a"I,>x;':u`.::,�1 aa.,. i.F '.>1.1,717'•:n`.F.=:".,• r.,..®,9 '" /� .,,2' i°w :.'�� r%ri"��. e"�-:_ :�,•�,,..�;:.x;t' 'k`n Y{"�dr.-... ;, r.4v— .sera e.0ea,/ -� rr d°:= r ,"r 1:;a;�.: _.�;;� � �<��F w.„ _f. _ '.,k ,�-.i..:k `�•��_:.,. g ,.� �.v.,..<....Y_.cs . l��..�..h�.,ya.;:,:aa75+.�.;P':.. akL'iriwu€,..w,.:z�.,,.. vt:`'.,. N:+.ua.,,.._„�1i.^�'s:K,,:,•n•".ni' "i'7.:-;•:.;z^�,..b:sJb�.�,,:-'::,«:G�.r,�..s::uit.� i'"•;::'s�„w«.we.m�c::';w.,zr:,..:.:`�`i.:r::zo Intersection Capacity Utilization 29.9% • ICU Level of Service A '�v4fsw;a.,,•.,,.;,.:.�"•;!t?,:Pi;,:.• .,r,r,.�"' ��g; z-.•..'�s d�':,r�: '"�"�'�` "p:..�'�'.,�,;:w•;r>�-�`,g;.,;,,'t.`..,•�-• ,.,. .}a„ - r.'d:�=:u:�,r F r,3$F,"e�'."��,`'' ?`� ,4_z� .>',._ ,dci,,.-t�„. - sx.`T•,,-i:;.r�i��wfi�n'•`§N.•_�;:rn��s-,>-ir:; '�n•,,..e a, ;`'l;'.�.i�w�•c+" -, :.�us��:xx?,k.a`.:+&a'...- �z:..,;C z;:3�:s�..1."-�:.t=.'S-�.;� �� .�L:�HKraxnti::iz.�C3�'?i. �:„;a��;��`..,,,:'�;e,'.' �nu:.a�>.�=x. ::.x.e�Zw�»r"..:.,"cP,.t�.�t:',,�<-°�. Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 4 HDRENGLVL7-FF51 3: NE 44th St& 1-405 SB Offramp . 2005 No Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak c 4-- 4.,... .4ish t t \* I 1 1 I.'. riO:IGt'.ORKW!fiWtSaN:ii. 13t2*:-ZT.tTEMr--.'Af3F1,;11-4-';7, 1'4)/11(34'474,-Wi37..rei:ZilifW,7575N; .87417Narla7-4:ST3riarg$IEITTTOTSTRI 1 Lane Configurations T+ ) t• 4 re IFelfrfailiNhArrgaWl6UOTSIVOTWEgliTafgairkaati'"jAWOMITOtirviVir7VOIPPIRITmargairoxibbti ,-..„..-..ti;,....... ..,, „; . ,iti.s. --1 ,, -.10-...---• A-..;,-.--3=,,zr. --11.4 •,,,,----..4, .;,.,-,-.14.,,,-;-:,,,,,, s.-.. ; ,,, ',..1.4 ....-,,,,,f.,,,',I'd 41.-.,„„a,,Z,1,,'„,,,,,„L,I,Ii.2,-; •.„0:x.. .: .,,, -- Storage Length(ft) 0 0 200 0 0 0 0 200 1 ; gfkgfArWCEEgETMSFIP3EFL,RRVLo:NEEL:reaEfRerfg3ZPZREFrZ.rdNFFRoTTPN4.,Wt5a 3...., .,,,...,1.-...A.,-..,.....,-......--AA-vi,..z...,- ,...,.1.6..,. _ , Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 tt.gfr674718,079ACYRIFSMI-SfraiNESOCOMMKOMV,N,91M1=5; :711153irab7.7.ri -A2.162721710, , Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 • 1.00 1.00 .t'i,tWWA,I,ETtrft--LM,IMLHF:Mrt,,q::§R-RStrPg'' .7.11W.,,,,ZatEre.22-7•gr7i,E,S,13*-W.FATI.7=7,7/i.,77,M,,,,_rc-rg'66 Flt Protected 0.950 0.954 Wtd7V,.grPY-arr:A;AVMlr,4PM:g.PTO.ZfXd;TiMk;g.ffr,I,TEKTXSIE.0,R;,f'g0t.EMCO:7-!PR5ragM-rif/''V'ifg: :- I Flt Permitted . 0.950 0.954 ;gala, cF1:6:43067,05RBIAHijaWAPIT6Y,33MtErf:MWOTAWORFTZ63,7-742791,767E71-0, 47r647PW, 7.,t-far.4 , • Right Turn on Red _Yes Yes Yes Yes ' $117C,PJAKM.-011a83grierkailLECPMatiflEgMffirZMIWWW:=0:TigMAT,7;f513, , , Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 PM,8,14.i.a.10j.ifib:4:::24TL A 2,161P-5E:7"755,7i, ,7;',.-ISP,§3:07.Tq7579;%075177:7-0Fr5wetiturgiReq 1 1 Link Distance(ft) 288 • 572 1320 , 1319 Wirif.C.COEFF,zi,TSMEZEIM9,7,441P172g.14NPEt5P,:a.?;.;';,TIZTERUPOTPLUE,115.0;:atr.g,T.RAD7,6Z5M1 Volume(vph) .0 155 21 197 , 138 0 0 . 0 0 176 6 190 • 1 regFIZirgergiWATArdiagelgi0,13-.2,3rPT.6Magfte.1(g-PVV•071-Fing.g,PW§Pa' 7103,11F-i1W7-07,AStIRRATO„ Adj. Flow(vph) 0 189 26 270 189 0 0 0 0 232 8 . 250 r:Atkqtagff;•Tk:KLW,ECFNOML'V3.1grS,VY.ffgVn;AO.SME:CrnM'iTf.;:;;,Wak,F72-Pltr,c,f6-To Turn Type Prot Perm Perm 1 , - ----,-o,„,,,,,,,,,,,,,,,,,,,,,,,,,,--•,,,,,•-•,,, WV, "-t,r;',',: ,,-- °Iv,,,-.''T,,,,-ir.,^rn,P),,rrrr,-,-,v°.r,x,,n ,Inr-,,,,,,,,',Wrts '..: '75777,,,, ' MfigrevelAilleVWL743-6P',0'V'''''''_'''r-='''''''4--''v,,,,--NV-14-09-,;,--f/r8%-•;-"=;?,` ,,,,' '---1-Y---,•-t-r i'-'' ''n,--,L,,,,,,' '-',4.X•-•'7' -'''A'5`-'1':F.t 1":.4.67-' 1.,..P.' J „..... i.),,-..«,......,IT .,ULWIZ:::,-;-.--6.7zia 41,-.-L',ii.,-L'eLZ--..,,fi.;4a4A14 :!nzel.-vit., :'`',:1§.:.,2'-'•::.;t',,Ii.t.I.:V.i0.1. "4451-''.5-'":::5;;,,;:?gt.,..1.42`14,..t. *,;sad.. ...c.+4,-•.'"::',2%.- ;,:a 1 Permitted Phases 6 6 Migaitif-81511ffiFf3WWWMV,TWAytff'Mt1WilfOIV,'',41:14:7 ,:'',.;`,7, 7.-4?.,77,-..y.wizpr ,:z.,=7,Tni-5,,t;,-,707:4-2,„. 0w.,,I.,.,,,T4 ,....: .,.,...,.....,,L,„.....„....„, :L.:Likitre.4-sa ;;Z&S>&.:a41 ...1.--4A:wl, ""'°;-gZA.7,,,,,...:4°::!::e...b.,:.....:::,,,....i-,t_. 2..i.l .j.,,12. 21,R,E.: - .14..-7( .1-,:,.... ....IVA,6...a.....414,<L'il4Z,If'.<ae, Total Split(s) 0.0 25.0 0.0 29.0 54.0 0.0 0.0 0.0 0.0 26.0 26.0 26.0 ' 1 Pagl$.1514M47:11r4afirt4(.61/4.210Z07:134:niOgV-Kft-tYY-0=4:°*fi•VRYZA7,4747SPNSEXVIZIW0INEW.A Yellow Time(s) 4.0 4.0 4.0 4.0 4.0 4.0 N.F.F1;Wrait,t1,;gir3FM,A;Mag1 Pka:1-lsgtaVfrP,M9T9N, ;:;:i.,W4:2ESSRMR,acaMt'rg.;MG:PN:K,Zg.IA Lead/Lag . Lead Lag , resoErgbvdoitfdy:,?,g,,kxfmryjj;-z7w5y2s,?-Tgy-evgtm-W-T;T-ci.rR5Tg,-T 'ZxMV;:7':"-Qri,,. '',V;',-T'7'fcr-T,--'R'g;''-'-'-'A9 ....,...„„... .'rezds'Z'a-N-,14.1Yth;W. .,?,, 4,66..,,Z,,..' ::0.,....r....4.-ii:i=h&411jas :''.,,..7.'7:.4 .',.1',..,',,- Act Effct Green(s) 20.0 • 24.0 , 49.0 21.0 21.0 W10110.ferggliairarteMaN,M.P5t,WCO740-eXelanfr74.7r.gal-NWSIEIVAlqia--,k4Y-0•VY12.0: v/c Ratio • , . , . 0.46 0.51 0.17 0.52 0.42 j OffittiriK,SAW:4;;WW.ViggreR:0347p•;;S:,n171M-8111,MA67.113-Niq.0,7M,221.X,WgriVWPIETZF,f,Cir,Mkti Delay 25.0 13.3 2.3 25.8 3.7 V.O:0125,41IFM' 1170,-EZIN2MiVel 7:TNI.1g-‘ ,25;01,1' MTIAMERELINMITAIT-RIgWa:R8 ' ' I Approach Delay 25.0 8.8 14.5 Ofrogfai:905W2-"74.122ELITIOITEZ,VAMPlakia21-L'7,TZ.E;STIEIZVLREPIA;72.07TEE,2'rli iiswg4-atErr-r:stitifiorilm.%satviatitiocon7L,,,lwrilgwiwia5-7.13WA27.4j-kearAfaaTioii.,. .ge-A 6M.ltiti*tglgWtMbtifaiei-IWIW,';SOSMA-tafig'g-E,iiLitf,,';',igtiAFZft?iktVSAatdEit':i2WYiaaill 1 .1 Cycle Length:80 k51.fflggEff.qikr6N,LaefZrai.a,kf3t,j4jRW076XEIPSZ.gktMg,MC,,WWMLMRIVE.RS;EMESS'iWaMil Natural Cycle:45 L 1 rolTiONTATMECISTAIWZFIRMERBVEMYMNittn,I, 'ZITIMITZEPTErginfER-74,71.700 i ; Maximum v/c Ratio:0.52 • ! ; ; 15.06-arn.(1810Cli[iNgragfinWY.,:rg..Majiltgr9,1645.14.$18:47AZZEMESCSEZZigaltREMg Intersection Capacity Utilization 52.2% ICU Level of Service A , ; ! Splits and Phases: 3: NE 44th St&1-405 SB Offramp I , ..... f 03 , ,i 1 : 08 g9rs1,• , , • 1v,*.,:';4541,A103*411CV. ..:- .!; , . :. 1,., ,N1 I 1 ; 1 -, Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 5 1 HDRENGLVL7-FF51 4: NE 44th St& Lake Washington Blvd 2005 No Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak t -► r `\ t t 4 d Larte7.0761.115Z7Z77 ti 7:EBL7.773.EBT. WEBRVWBIY-,--3°WBT:,::::.1NBFt: a7iNBLa;a��<NBT� A .4_ i, .. F! Lane Configurations ) 1 1 + r 4 4 h IdeaiFlow'(,v I.,,,;,. ; :1'900, ..j9tl i m=.1 900 - -„1 900': ,:1 r`1900 's:`'1900:;h;1900.'N.;1900•: 1900.':`:;;19Q0 :1 900 .._.4...._,..„..«,_: P�--.P'),_ w:ab.,.-�.:..,.,...�-::.,.: �_.�__r;r,.,�,..:.:.,.,aw.•: `900 �.� ._,,..._....�:>~:_._-.. Storage Length(ft) 200 0 0 0 0 0 0 0 ,r �.n" ,.n•�., "a,Y.:`x5e;4` 2'1oY"r,'� r.�.., s;5'-^•,r;• ;fia�:F:rv`f�"ura^e.,T`-....-.�.P.«;z.,,.. 7=--.p .,.^'+_^ .•vY,Y:a,3j�: ',gp�4... ..:'++`i4"r;r6�s ��`,•�,r „�:;. .:3:, +..,.. ^,5:.2.Y�.,. .:z"�.. ..rx<<,;,• is a.. •t;'' ��1 0.;� •t., t. 0 St ra e, anes. �,.�, �,¢:, ;:1.: :;.� { Total Lost Time(s) 5.0 5.0 5.0 5,0 5.0 5.0 5.0 5.0J 5.0 5.0 Y 5.0 5.0 ..,�,. <:,,` - - .•;,� - -:z•:- .rya..-._,•�;�i �`�rrc-- �..-��, -;r:; r n1. �;::t:,15 �;�`•° 9�` �='1.5... ,a�9. r. 9 Turn n 'S"eed;=i»`h: 5: .,t. '9s.' ;°z._. •�. � ,f,_=mac:� , �.•...,_ ..9.4,1?�>..,._.:Ch.,P_}:�:�:;>r�',:�r:��..,�,_�..��::�;:`-;:..., ,, .�,. rw_,.e:�. ':-��` ... _ram >..?.��'•°:�> �.<:.<,:,��•, .iw�:wu:. Lane Util. Factor 1.00 1.00 1.00J 1.00 1.00 1.00 y 1.00 1.00 1.00 1.00 1.00 1.00 � ro?ir �..2?3•:': '�:`'6:r �.SLz_,< =�`.:,�_"�-, ,.-�., _;;�rY^z.?;'xT,. ;.F�,• --:';r:-.>.. ;�;.�g� .,r.-,�.",F;'.i'.'-K-�-r„ .-;,� .rt, ta... .w>✓.w,�:�,,.:� .:.�N: k..:� v�n;�,�;, ,:.0:964.- �•, ;,0:850� ��>.��..ta:;.0.9.�6:..,i,�, ,�. ..:, -`.0:902 s.:'t ��• ..rx--,..,...,,........:...:.L'i$t,r::t✓,:?:.:.n..:,...,,.,».,-.-��.x-j.�.. ..r°��',.k+y<;.ce.y"a""«.rI,S..:y'�.ui.w,...-..-..,.>vt':4'ti%.�;:,,a"�,`,.s; ...:.:.�..._c-k.L...!•`asa. .,s�.,..,.,-w. - �..,-... ��:� Fit Protected~ 0.950 0.950 0.999 0.991 - -- - =?S""-r,.- ,w cx•y -*ra,;.- �;:�:: z�:�..eF -,._- -•r.9_,-.-..,.-:..z__`a" c�,:., ",:r<-_- _ a 3•re<4;,..-.: :K1760 O r:`a,..,•::r:0'_.:-,=:1.665'';=;.;7 0 Satd:-:F.,low. rot`- ^�',�1770 1796. ��0,��.,1n770�,�a�1863:„ �158 0 �. •� �„ ��„ Flt Permitted 0.950 _ 0.950 0.999 0.991 .�.t.. _-�.=�'_r.4r?�C --,y;':�-. �„2:' _ ss`....;r'+. _ „?`A"`�" -`rne.- ':,t>:i':.�f,..,_,�.. - ^-�,:.,--.-. - :',7a^s`a'%-, Sa+d:>F owr'er' •:1� 0`. 1796..�- ,0� r 1:770:• �.18,63=r^:1583� 0:- 1760`"` .�0�" �0:�`'165<>` t 1�.,..rfP�m}�-_<:� „'s:`� _. ,:,�?_,._.._:r�..... .�::�z,��,.<�,..v.�.rn:A��+��..� ..� _ w ,�.�:�::�-..,w.�u_..�.�._�:.�::�:�:'�:_.4..,._�_ �.u.:�..._,�.:,. ' Right Turn on Red Yes Yeses Yes •Yes """,:r,.;Hr.^•:l`" '-•,k. Ys�--• ....i,�,-::.e•"s`GW. �r>'.X':+'.`casw,�-;»-•,+i3 - �:?'r,,€r-;• ,,..Y><,•i"-.,•r{" 'rca.:r-i�.7:,��^ .»_,r.�,-.< -,�,-.;3rn „�: 'f4 .4 k�'=�f- ,.N'.;' 1, y.:.1„z..4,.•+i.h - :;i. `:'X""�•.:;. ,.'N--�:,'^':iu. Satd:=Flow.»RTOR- ��r.�;. 17•�='l. •rt:`39��;. - ;.44• , Headway Factor 1.00� » 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 , . Lmk,S eed m h : ,.�, -25'� ';25.`"'' ,: _ Link Distance_ (ft) 572 1320 w 1320 - 1319� - wr.,,;;�.'a 'r4 "'G: - .;,:"._ '7":"1,- ".,�;.y„ '"'u,; - y..L"r> •-:R^a. v..�r.•P,.,�.-_,.»..._«,:a^:' i'"t' „r Travel Time"s •`15.6�. ,36.0%`'=',<;- 30.0�_'':.°:-`-•' Volume(vph) 66 M202 63 69 126 32 11 245 170 48 y 27 199 our=Facto 6':88. '0 8y 0 88 a' ':0:82'#�` '6:82 0:82 .:n=' '88`'`=`:b0,88. `'.'.0:88``-�'' 0 82> .0:82:`"•'0.82 Adj. Flow(vph) 75 230 ,-, 72 84i 154 39 �12 278 193 59 33 243 Lane:Grou Flow:v`h `' .?71 30' 0: 84ry 154;' 3917 0:7'•"483`7:770'. - -0 `.835}: 0 Turn Type Prot Prot pm+ov Split Split yam.. 4.: '8 J6 02`a''�.. 2� 6..,._:„ .67 7°' P oteeted Phases°` '7� ::3 ' ,: Permitted Phases 8 ni • R ' : 1 - 110T� 100 �25=` . 18'5185' a �15 . 2Nimum S it s `, 1i0ii .10:0�, ; . ' : „ 1 . r:. '� 2 ;� 1 :5: Total Split(s) 14.0 20.0 0.0 11.0 17.0 19.0 30.0 30.0 0.0 19.0 19.0 0.0 ?' ,-�.jvik'e�-il•."' ',s` - 3:;4`r :n�.,�rv-,,,rr.,r„?f�^'^ O O• .^I, _,o.... ..O. ,.0, ,-.u,-, .+ �. .-O O''r'.• O `-O� O trvO Total.Smlit ,/o =' ..R18/O 25/7,:` :0%a. 14% g.21/o�:'T'.:24/o.-TZ:>:38/a:"' 38/o:,„�i`�`�':.0/:72;24/o-:.:->:24"/O 0/o. Yellow Time(s) 4.0 4.0u> 4.0 4.0 4.0 4.0 4.0 4.0 4.0 t, _ All-Red'.Ti "e,s: �1':0:�' 1:0: 1:0. ?-1':0.. O:t;�„�=� .0-�;-,;=;,:. ,.. _....... .,,,�»}.,LE' :. ' X:'k:=x ...,r'r�aa.r'<... ._, . �... ...:._ .... ... ...._ _ ..,�--,z::.::a:,�,....u,_...,p,.i,+_,.^.i.,r,:�S.,..t-.'sts.r:i•..... .._.:"sa... •,S�w;:v;-:._.ay. Lead/Lag Lag Lead Lag Lead ..,t_ r'; Lead=La ,.O tiiniie.:�.- Yi3s:�• Yes°- - -=�Yes':�`�;.:'Yes�.' ;= Act Effct Green(s)} 9.0 15.0 6.0 12.0� 31.0 25.0 1\4.0_ Actuated /6 Ratio: :0:.11• 019`= 0:08 ';`.0?1 0.39; eia:<;031. 0:18 v/c Ratio 0.38 0.86 0.63 0.55 0.06 0.83 0.82 -^.�s•:y - - �",;xr: '"�"'zi.;ttt_ -i^', ,^;3;s,Pa,-•_ ,....�,.��,<._ ._-yz._..._.„-n ,�, --{<P'�"."•:-"' -';,�2�^----ti'T'y-. niform Dela d1 32.9 ..256 - _ter .,>'-_ .8;4 •�:31z5 0,0:!T7 ' f,F23r1�'. 7 °<. 17,7 :r U. .......... ....Y�a-v,::[.i�.;.-a.::D.z..<>+.4`. .+:;:%an r:'."3b�S3 �,..rd:i+ ... ..s.. _,.,_,_.., v:F:. ...s<.+n3�.-:sF.:..."sr1�«"�-vz`,.:, t..ru,-.,«,....� Delay 25.6 30.3 46.4 32.2 5.6 29.6 26.2 L..eO«.«SS° , '...=,. ^_.. > a :3z: _ . :�;.t . `.. ..,rk«. . � ._ _ _- .;,� :. ,_ti ��,rc.tiF'ttc ;. .„... - -.7; w,.x : __ ,ti. • Approach Delay -,.mc . . _ ' 29.4 32.7 29.6 26.2 , ry, .Y=:vT. -,. .,_ � n.ye. , ;. .t . *.,•..i.': v .. _ - :hv y . • . -} � - R .t' f �Inf�,,,,,., -�•gin:-x ;�--;-�-�-••,'�-...„-;m� .per:- - -�.h,: �,:�,~,,..w,v.�< ��,:, ;:,�- erseotion'Summary�:�:F:::�.,.�.,. .. , . ,. , .. _.,.. _,.. -.. _<:��a!�r:��_.?� .0.?-,:�:::,;Y..,,..�, :��•:� •. � . her. „�� ,-- ,.YP„�,�-.. ,_>............... . ...u;�:(c,. ,.._-,..t`.�:..._ _w , '=�`: ._�. - ..,__,.. ..r.F+£'�:`'P' `-, < �.:':-;:_ �:�'. ..,..... .��"i„- .�s::::y;'<'t•�.a,..-�,S,,y`.;;•1�.-, Cycle Length:80� .--z^ -.-.rr-� :sr-'•'o-- -:."-'+r::-., _;;v,-� --,.:v'�':s- ;,,-frs- �.:�!a' :5� - 1, O+ .?4 ::F i=7 Off et..4'"•5/OO-��Refetehced�t`o"'"tease-2•�NBTL":`Start�of-Greer: n�c ,t� -�`�s�vT`'�"�•�._�,�-,`,-�i-;.:�> >:�';-y:�',��.:;�::�='-.�;•�.�:i; S c�.a ..!?:.L,,.,-m..<.._-..r.e_.s.+3..,..).P......v..,....,.,...,.._... t..-.,v..,..+.....r.?sY.,.....,,......,.<,...s., :='L:-"..-.,:,-: St:+'a:'1.,<.::^xi`.-r,n'nl.Yn.:_,tF:.n�........,.<-..,z..>,.� :-..«.-.- i._'r--w..'.,.a,.x., Natural Cycle:80 <'e�y..•i;F,': - - - _ _ ,•_^�'��.s;.i^ -r:G;':a- -_ - rk�- 'n�R f;;, wiyr u,r�� - -,y,.� on rol T" e:"I?r i'�-e= '=r.`f:C t _et d= "s 4�s=• Maximum v/c Ratio:0.86 - - G^Tn;•' r.'A'.,.n•°:.,-- '.,,jv": m,.t; *^£" -_ _ _ ,sri^x.:7:+ _-..y„_.r.,.,.m,.�?;s. .y�i.Yi••Ay�r•*^'t.;} 1ntersec4ron'�Sr na1D�e a{ -r29"4'��.Y era• -.Intersectiori�LOS ��= .3:�=•-z'��=2`�':="R�-��• -•r`F-=��-'nrr��••.`�,�� 5- �1v�...9<�. !_.Y:: ,....:GjL�o::..:�`^�:° ::�?Y...=.:�a`,:a •75kkr. .Y,.:y ..wt_es...,�h:w.,::,-�.-,.:..C��1>v�..,'�;::�.._,.�,..w.._.,.•_E ti,,:�,...,:.1:1:..t:a Intersection Capacity Utilization 84.8% ICU Level of Service D Splits and Phases: 4: NE 44th St&�Laake Washington Blvd _Y 02 't 06 04 '` 33 30r1Millate 1«�� 1:'-,;::41974 .,,°4_ J`. ..i20.a sl.:':;;?ufaiji-s�.. 4,_,,, 0s .� 07 Y:\TLienau\Barbee Mill Property\Barbee_2005_NA_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 6 HDRENGLVL7-FF51 i 2005 A. M . Peak Hour LOS Calculations With Project 1: N 36th St& Lake Washington Blvd 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak --*** —N. N, (- 41— \* 4/ 'ArrreldricaFWOM-Ar4effEttite.. -0.1.-31gtakTAWB17.5a-MTANTIA.27.WEIVANE31.47:NITEOPVSK.',;;MS_Bt.-:,ST8g171 Lane Configurations 4+ 4+ gigiffi0/7ffiralifiatliffiniMP0IfigaMfg90 slr.91COK_FOOPPIWOOMil:9,9707E9'9225,4V0747-Tgad Turning Speed(mph) 15 9 15 9 15 9 15 9 PIVPIltr46761741075aPPTSE60746672,72102Z15-CEINDTXPERK0773.7171.557.P 4-467.-NW471:35.0311 Frt 0.955 0.870 0.998 PI-I-PlrrnTatiaagikr7i1VM4'MTPITO-B47:Ttrit'44 -4:474FR-77/77:Ervz77-'"171-9-zwtrgr97;77,ri-ATWAWIT..ggif, -27g,1 - ' Satd. Flow(prot) 0 1750 0 0 1621 0 0 1839 0 0 1852 0 PPRlbit7.Ed3RWGfgFE4'kM7g4-.84-7MgM7V13=Ne:V at-ViltIPPIgkialW=AY04-945Mfiti Satd. Flow(perm) 0 1750 0 0 1621 0 0 1839 0 r 0 1852 0 EI:ekliergrki.W:74 Aff6'0751367714:6772.7.66742f9:03.17EICTWOMP.OWItfiWilFznriffa,MIA -- Link Speed(mph) 30 30 25 25 ! grOVIirifaiWOMFAV5272aF1045,17-75W-770r132-6M45:77.LSZIWOYMgrIVS2M7.0.07-103 Travel Time(s) 30.0 30.0 36.0 36.0 41040,0teaSTENTREfiZOTE . :74§,§;TEPTqfg-FO;;TY-e1/2:140677511,71;077.1/4.k4,:?;:g5.1,PPRI-72-0,374.70: Peak Hour Factor 0.40 0.40 0.40 0.87 0.87 0.87 0-.88 0.88 0.88 0.69 -0.69 -6.69 FrearyVerlitiFsMWOFZEWW2X:iff:4757S2.CrAWZN:2-647773--Raig-V-075MWW:TOZS2a2-PIEra Adj. Flow(vph) 15 15 15 0 7 202 7 534 7 23 183 0 PiiielgiaijkfA01.iaVr-M,76aKV::f5,72*70:ZPI.KUF.'209T:!.i.SEITXFVV-7g-4F4NTkiSgc;',$izzRTOZM:72:p6ZZW,VQ` Sign Control Stop ' Stop. Stop Stop Filef4e0Riafitlifila61WiLfta§Z440,41Z72-;767:5175MTaii.44,WN7tiic".17177:354Yaw, Area Type: Other Intersection Capacity Utilization 53.4% ICU Level of Service A Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 1 HDRENGLVL7-FF51 1: N 36th St& Lake Washington Blvd 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak c t t ► 1 4/ _ '�_-.��E�L,_.�.��:EB7',.;,�-_a EBR�.,":W.BL°.�,�NBT .,� ,�:,�:.�,4VBL �=pNB,�a�4.;'�I R':'r.�' :,w T;��SBR Lane Configurations 4 4 4 4. r,.n+�x-r-,.. -r..y,.,r'•'t.^.ehY .:T :uw^:� fRE"'=--....: .�µ,` '?i�;t:•;t -we+�« ;• � �7,,+rr.,py."?,a."`,,c s^, "" '�", ""^""> �',"." '^m2i:r SI n:Control,z,,: , t, .+ ?a?§. t9 }�,, >.?t+.� .a_t; =„ ,„:Yn.'A.gf = z;gt7::i,tf St0 .: a9;,,�,ss,,.,a _,.�'?'t,...c..x,,.=-,�.a,.. �k,�'M,Eu,.:......,H..��S..A•4'r...'��t5.,,a.:.,..�,,..:w".k'�`C.:»,....s.......dY.f_-f�-.:356�^"; "..w-..w,,..;,. ,p��:r^^:h'i`.i�r`�.ar:vA:%zs'�n=r,.`n::,,,,at'.v',.s+u..,.,.1'>=. Volume(veh/h) 6 6 6 0 6 176 6 470 6 16 126 0 - - tY,." :':39�."s..l`..z _..X� rtG 'iy,.-`^'-:�'YP'.�...,n. .-.f;�.�.. r.....:��.-.+.. ��...�;�r,=.,__ P 1Fit ur`_'a ors,-; :µ °0 40. 1A r f0 40Eilg:�. 0:87 `6.17 . 0:88..<; 0,88. .0.88•�, ea...:$.��:�:t ,.c,�"arr.�..��a:�.:�u u..:..�:5:.,. £.�i:w...a,,..✓s &a.a. ,»c,k.,��.w.� ::,w�:� ,:M«�'-..�-vv ,3sw'..'rv. .T.L.:,v.,� Hourly flow rate(veh/h) 15 15 15 0 7 202 7 534 7 23 183 0 x^,� •.�,€, •��.�.irti^�^a; .rsc'cs�^ trz "_"","""`;..,�,.w ��„';�.h'��?;i"•"*?'"^"?i;\.";�.�'�':t4:<:��"`q"i`r°'`."' ,,,.. ^w,�,:+.-:.+,,�.;�ri. w ;. ^ �i ectton,�.:aqe#;>,��, > ��_ B:��f ;'WB�1��;..�:NB'�1�;��SB. . :�:��: ��„ H��.�: �,.�.._.:�� .:�:;�� ;-�.>:=K4:-�_�.��. YAIT`E,._ Volume Total(vph) 45 209 548 206 ,,,-.r^r.+.,•^,�rrr.•^....�,:x .xr �';zi!. '?�rroa: i^ps��+ _ rvm s,. +r-�•�r;z.:;^: +,-.;rt r:?w�'i,'fiC?";;T.. r`rm" N75 tt .:yetsF,+^".z.''r;�&,''�4,';74 er-AT-:S: .7-WRZT SMvTIM,x--.e,`,'tif;.-.. ��€€''''yy{�jj��-., ��,� t5z�n:� �0 7_ 23�;��,% y� >•'� �.�,• .,:�. � �z�= � z�.=: �.,.. .�.�w}':�k. 4-;r..� ...cs:�. >:zv"u:Ld.::n .=:�i2�,.:+�+1r�a �s..�:ti:�'�1 ...:,.'�r "��;mu:'�;-,�.s::vt,.:s,..�,: `�s �ie.ta.syr' Volume Right(vph) 15 202� 7 0 .„'z ":c; '."t:.= 'c°^�ht-,^ -xr• T: .-,- ..•. :^. -:'.ire.,?'-, ".>;s ".^ ;:i '.:? :`"' 3s..��E;�i,-'j}'._ht" ?:r,F;'�:`C" ;a';;, „`? rod:« �.udea4 r .r.CL.0 .vs,:kt:L;:��a.`w.:..a+«Ctt:,..� m.�&t+�+,•..ww �``z:�.n;B:ai:.,au`..i'x,wa:a:�:...t�..m a u•.��u, .QidL�: Departure Headway(s) 6.0 5.2 4.9 5.3 vil� :._00 ;;;37, g-075�'Lmtu0:qq ' ; w 4.wt'1.� . Capacity(veh/h) 524 625 k.: t..4.:;:'•r,�,,J:,a:'.rl�:t.q: .��,F-'.',•+�.,r.:�716 637 I � �e,,a^rr.,e -•'�^"'m ,a 3' -,s-wrar�•r�- -,�;�. kCs-_ %z:: aw.,�r-...-..��+.v;�"7-^.,,x. E... � ^^�uws ;4a'rX:,.,..•.,., U i'm"am,r•; ,h..4. T:'._\ .E r1':",'`,'.. .t,.,, s; 4•';:l?;1:- ."'T"_•� 11 „c: .3;°'..: .,.:"k: b ..YC+.'z' , *�c^ O T. �.•.c....e:t-t .'t\:rn�,:�.:'C. C ¢ ae.j C',° t' t'.`'s: �_ A �ontroiAelaY;�$),��,.�.�::�a' �?�w�i05;:��;�w�' 0:6 � f. ..= au_$ ,n .k:; ;� .�°..� =r<� t ..._ � • &� Li ;5�,..;,.�a�;d�c'sW,.,:,�...s....u.:,.:>. ,c�.S�>:, 'a.�,,..,..:.'�:..a-�.,"4..•i�e`4i '�,' .., .�...,...:,P Approach Delay(s) 9.4 10.5 20.8 10.6 -�^,wa;t�.,+�n,.�-x�-..�.._..»ez..-,,.-,,;,,�._r��..Q�m t�s:.; ngtc^;s�r ..e.;�.-..,s?`^;g'T,;.F 1S":< ^„?3,✓r.;..�^:tT�"' srn.^^^.�^e,rc;'.;",,.�.,i:=z'i.` ..-.,-'r-?ss^� APPro46aOS•° .,. _ A:TIC:41377. �: C' �4B;-,p, 72 x. - .7;7, , e: ,> -;M, ,. ,,�.<• ln'---,r.�.-r>.�. .vn: .r+srnr•�, .,�a�tiw _.��y.. "tr> Y .�,a R.,, �•a-:�s.x.ai�.�,�.,.,:�'?'„'C7� �. -. ,��a .,.. tersect�on;Surmary ,... .-:4. s:.. <s :. :dwxR:<,z:Y ..... , 4 ...,., ;: .� ::1 wwJ,.m1�.�3L��s�?.<",'h.,s"�.;:si;�/•.i'.:w...n..r..,4:�+.�:.ati,�3'u�.:r<,°>z�N:..a:..!<.. .:e�tw.:w..,,`t.�'.>�a::::.::..aw..,,.�'-.;«'+ ,.........w�,.23.hma":�w'.'»,:.,'E.a^,. „., ":t..�'-t�2:�w;,v+..�. ,:.;::i:.r_-.'.... �- '.hla: HCM Levef of Service C 'iqz ,,:�A :4 ,;�t,.w ,, C. 'vel of ervic WT2FZ ;.<.; ,;, -;A:::..r;'�S. �':,:r,.''i=r ..�s. 1,.efsecto'�Ca aci "Ut lzation � `53 ./o:-.w>, ,_ l;Le,�, „S= ;.,..e. ,��,:„,� ., ,.�„-.�,.,;�_�. �.t.�..u.�. �� . ;i; M�z �.. ... .-�.w ., �. .. . - �.:.-:�s�.,a:ai :sr.,z��.�: :.#yecme...•e,.��r..'o�..i:: I , • li • I , • Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 2: NE 44th St& Ripley Lane 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak f -.• 4— 4-- \IN. 41 1 trifireW:(6137,F71.7.0MEMREgETIEBT'7.:ANBT7711:0E3Fr;v:78tiEwrgi3Tir407tuz:M",77:71zr-5777,71rrxmirpwzrAv.77.s.r.--7,71 Lane Configurations ) + .r. 'V Ectcro fFTAWf0,IBTM-ZElfaggtgcrafgKtR93ICFZ§V6Mf,KKE,FfMSNAaiaand-'7-17 -V7o7- Storage Length(ft) 200 0 0 0 Sfo'rgrTe'lrah'e'es4T--:',T.7:-TWr-:e,-r,:tr.-fmrop•',37:-, ;•,,,g',..r,Aq,-,,,:„,„,„,-„,„, „m,,,,,F,17-5-;:-TA-7,,,,,,7r4,:•=7,1-7:571,737-71V%,‘:;,:-•,',•r,,-7-s•v,,,', 7,•';:elwiwr-,:•,r7;,fm'mirrmrsi „„--,.....o..0.4...,,,,,,--7-wAgvaa-Iftvzo4A.4z;z.,4,:mktx,i.•::.‘t,440.m.Zo..,:;;44,..,4, 1Vid.'„*ciall,-. .-121,,,e„!!..frzLIAS:;,..1,-ag,Ta,•,-- titf. .13'24di-It-gi'lli?" 14,riadi,: fklts:1 Turning Speed(mph) 15 9 15 9 giiiyrifilwayammwewattitywwf to- i-xittfrvatiowtt-tpmfrotopFxrpfpnvykrp,,n;74,r,75.7.4.1wArwmalAwm,m,77,, ,--- —,-,, ,.....—,..--2.*,. :.:7,036se.,,,,..s.- g ,. r..-4 '..--...idible,a,-*Aitif;A=1"‘,- -z Frt 0.971 0.988 PIPTOTte4,432Pf-:4•Clir§-4-W9 7".5'071E',"*M11 ..--*'S,S*9577-4,7P7-r4r ,7%"-,17;;;VrwAiTit,vf ,'57r,r477,,7474,1m,s7-4 , , , lk•--.. -/A,%.,..:: P,,,Waktkee,,,,, ..,,,:-61 --: :).....,L,,,,„,-,41-4,„;A:te,,,:i,... ',,-1,t,alt.,.42.etI,:k..v'...i..../'''''?- zwiv•zz.:,::ig,,,,4-,,,,!&t-:„-,-,'•,--ez,vilfilt.:1 1 ' Satd. Flow(prot) 1770 1863 1693 0 1618 0 Fli4P-fFln-atid7n7g7i,lrO''05r;;zr-T:n:477fli•r3r,° rkmf 0,9617,7,7 ,7„'*',s-5,-re .,,•,. _:,'e•-mgfm,3t•Mfrxz,;pr,- ,r7p:r-•,,,T„=,:7-w•-r-,•-A, i a.„..r....,...,-, "4,JAZA.aill'Z' '''•'''`1-,, ,a3''',s' lai:,:ie'C ''''''''1*.ik14.i.4' ''''',Vi'V''-' iL14,,,UWA;;4'Ll'if'52''.:i'&:''' .la., k Fal, ;'444ja:241,....PIW'''4alleiafikiks'Yi k 46,4a . 1 1 Satd. Flow(perm) 1770 1863 1693 0 1618 0 , 171'9:gri/WF4elrtaTVS:lnsMrrtVTWtj(ffgr•T-'0-017, 9F-Pffr0-(P3T717t5Vw'r7ir,'aM,I='1.01-97T-er,'Wg-ZrXr-tFP'ssTh.,Agln:lr'WfAvT-714 „..-i-, t.•• '.,...',- . • --L,a. P.,t,I,,,z--,..I .:::. .Va& 'A'Zik;<VPti..ntt.,..-1,ii'h-eg4,-',/E•Zt.fatia:;e:=,Z, Z,A ; Link Speed(mph) 25 25 25 tinliDiparicellf.PW4-4713WGP'747a8713-87',47•7PAITri,#717TIVI-WW7,T,F•rirs-,7,:w. -,,,7F4,, T,Attn,!r7-?7,-rrin-Mr-r- rtemll , :,..„,-„,,,,,,,,, ,,•(..az„.,•„,„-,--4,,,,,..,.„,;:4‘y..::.=tfk:; .. ,g•‘6:,•-•,•,,••,k.,-.Age•Aata=.t, J.,,i.%--k;*,a,:,..:. .,oL',..- "-A•zdeiti;:v,,L4, ,,:f,,,,,,:it.:,:aortc.....a.cz-,, ,;.,,,i1;= , , lTravel Time(s) 36.0 7.9 36.0 , 1 W---19.;„7,1114-717611.g:::, ILYL'V',,,at'rLITgT&F'-rd'.I...gk-2...7;77'78-82':Mgrlr,2M7g'rP7'a•Lz:"w:,FH-i:W.!.,-Vj',i'W'''''.j'I'ir'r'q:tJlz'T''r:i-,i,o:S,sl'• ---''Ir'7'''A;L Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 ffea*Vefircieiffrin!-Tir". 17:Mral'-',7•W-g' zi,,wrgc7/7•T.,,,•••,,T;;;:ys7-..u.ff b,,,,--sti,, ,,,4w,,,,,,,;:pmzio,71.,77,,,z;,,c,776.77: 7, ,,,,,,,n1 „„..,-- - ,41, ' 9ki.',.: t 2.kr,./ 2 ',;:i--SA'A., :,'"7.32,,.i....S2liiiii-41:.2,9,11,18 .;f49,4E;,,;: t151.1V,Il'i-A•LTAI ::IL. '174ZVAItj Adj. Flow(vph) 8 825 182 49 129 13 1 , EkilkGitkiFloiniTiptiPP7r3VZ,-1 82577-:•5:72-11'i.:,'%.7,74-637C7',,,;I:TMs77,7ifF,F•717771-7,-W-1-7,7*If75-.7A,17,714777,74, ,...•,., .,..-,., .. ,t,,,,,-,,,:.'.•....,,--.:=.-..m. ,..a.,•:::,,zi,•:..,.,-z.-::•,4.:, -..;-.4;6; 1.4- 4-da-.;:,,,,....„&zi*:,,...... ,,.: :...42.,,,, ,ari,:„./ishi-;,..,i.,,,, ,,,,:z.ht,,:iff.-,--;, -,4,-.);4,1:7....:.1-,-,:&.i.,,i.agA Sign Control Free Free Stop )ijretfe'WOVSWrFatVagZVLMMTIE:': ,T7H:• •45,ZE4',T;'$'.X2•46'53F;TiqF77:7,7i:4=•,T4Mt'P-74-77.'''IW,-Mi4077 ,gi0,,FAZ:47,..M , Area Type: Other . ,4 O'''',"F"'N,WrP..r..i,,e',-.`,"r.i''''...ir.....7Z'Z'W•r`i3""'"''''''''404Th--v, :63,MtfikellatrialVedt514—fiSTES''IljQtgaliii;;eiN.S',f ,Z.2`iea:272:.0,;',„;:lkis.;?;%'::alar::ti, 11,1,az&idtiela Intersection Capacity Utilization 59.7% ICU Level of Service A I • I i , 1 I , ! , 1 I I I , i I , 1 I I Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 1 1 BVL Page 3 'HDRENGLVL7-FF51 --' 2: NE 44th St & Ripley Lane 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak 4-- \s. MoiRp_tativ,.-444,_&7iy,:373ATERWMFBIRWAMBr;'.17WT31717V51.a;fikS.E3.FigT&"!`.*%i:- ., Lane Configurations vs- Witiiiitliii7M-75.570-1zysoowe're-eagriagt71,;;NITSibli,WRIgialtnatf.P7MWS:47gEgnaglg.:siS4;pa% Grade 0% 0% 0% VOWiie(31.111117))7713§-q'XZTiCi77,feWthisgr,42-27--RiSINF88-7,A4'—;o144,7P,,,ss"Z„,s. „0, • -• Peak Hour Factor 0.85 0.85 0.67 0.67 0.68 0.68 th , • ▪ • Pedestrians s ., s ejA Zoo 24•ACT-Mt4a• ' a` • Walking Speed(ft/s) PrratiallalagleTENTA ,!e-,vv,s'sWg'qP7-AVT-Vii„A.W.:140-;rp7sTs.Ye.i,ses-,e_s4 „.„ ittikkaa.‘ ' = • Right turn flare(veh) -7,7,s7vmmilf,r7s,F,„ •,r• ty424a121,40,14iPSAAY;• • Median storage veh) 37C7'!-VOIII6iiiTialiiiii6-13$9FT2TRT27142-'1,., , vC1,stage 1 conf vol '17a7fiti-F2WOWfVOl°7--W2411.7• 71F-ME-4:11:P-: s tC,single(s) 4.1 6.5 6.3 , • • — • .4••nt tF(s) 2.2 3.6 3.4 bIfcldeire'ffire'e -t- Ti""4WggTkcgrr/-7-rNg'3-7-Ntr-NTMt-V'Tss-,;f67g,T.y7ggy;ts'f;•,t, ';-s7,3sS,Tccjr.,7;E2-i,k7;ffXsfy,yn.: 557,:R cM •'• irAn, • • capacity(veh/h) 1336 241 811 • _ sss-- • Volume Total 8 825 231 143 . . iybifilife'rerffM77.F7,727— 7 id''',470127rESSV‘WarFT;197,:skR7c,* 77,q, i',VA.'s*?,' • '•• t Volume Right • 0 0 49 13 3-6751:117,:03),M1120-707:2-2- Volume to Capacity 0.01 0.49 0.14 0.55 • aireVeM661621ALTR723Arrb:79-„r0,13;Varg.7497EA:,7, Control Delay(s) _ 7.7 0.0 0.0 34.9 kl5M6MM'fiN: r.g-VOT:7517M3r,"1,77,,f7FF:r.:7,WWF71.:77414,1WiPiN7.T'74 Approach Delay(s) • 0.1 0.0 34.9 AverageDelay fergiidaii.Tar'-nar-Y7 *-4*VaiierVsr,` '',.*'&!QsZaiMtg$0,;;nss: s70-MstIV, „4,),7,7Ati 4,1r: Intersection Capacity Utilization 59.7% ICU Level of Service A 57-sTiftW7P:S;747P.W-47.Ps,MIZ,Wir:Mgina,st,ww.,":ags 's';..i:',-P,Aes .1 s.,s,s,„.,e-s.,• 6;4 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 4 HDRENGLVL7-FF51 ( , 3: NE 44th St & 1-405 SB Offramp 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak ...4 -1.• ---i. t.... 4,,,, t /IP \* it/ . • . , Lirfe-GliklPigflrarir-';'E '''-`471."',E0r*YfEBR`a ." B-vki-W-BT7'lltiT3-1,777-"7"iiifgr7-11"-ikrns',''17ge12B-r----BBA', __.._ ____...r..,,,,,,,„.,-„,.,. Eit. _-_-,.- .''11tr..* ;4,,,,KW E.,-;•.*_ , A?•41.7",,T,:i... A,-,..;--,-; , -,,-;,-.4,,,,_ ,-,,%,R,,,,,,,_B...,,..44=4 . .•'; ',4-,i•A i'ii:Fsl-Ate.,,. A , Lane Configurations 1•) ) + 4 r ,- --,--, --s-.7,---4-,-, ' WealT1,9„CyphPhfifiti- 6,6=AP,P,Sla0.9P91,?,44P.OP,Ityl.9,99,A.ttlgpgymit9.9,9Z•Jr.,499(M.41 900'citIt1,900,-it,,',41900'•CLS, .4900,47W1900 _.....,,,A.A.•-.,,,A„,.....,„..A.' - ..,,,.....s.,=-..,..,,,,,,,,,-........,...A.AzQ...;„...„.....,... , Storage Length(ft) 0 0 200 0 0 0 0 200 • 1 „,..--,,,,,....1,,,,,,,,,_,,,,,,wzm7,•,•_,417,74mAzfr ,:,..A.,;f,m,g(!,-,*--. ....v.v77,ric.4.:,,..1.,-„,•mq.c.--pw.'.7.,73,-',x..7,-;-.,1n•AN•''A•,---ri7,z,7.,;•:-.•'7',-g-z-'dr/rAr.;.i.,-."twA.;yrnp-3•,:..w.y.:T-.7.r-.z7T,i.-..Tqrw-T.,t,..,-,A.•,sp..‘,f,7,--, 9.:,..CIag.9. 1.1.,ftiliZMF.UQA.4a1411`4•.Y.24M.A:MIK:7, -":•;)1,1•To.:-..:•/14it:A.V."1-,,A50-", 4.R.,:kA,:•J4c';')Y .- 4:"4',1..,t..0" Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 tifirltr.g0.0,301411.30241i. 1•5) EMON:','AtOMPA§7,4Mit,M.49AKON.arilit-P7'M:W'' '''n§Wra-t''''''M;77XMT7V§ .-.....,.,„....., 4fi.vi;...:,&41.:,?•.;S;:X., ...,;"".JL'-. .-.:,.S.,i,.d.,l',14..'.;'. 4'A,_aL.. , Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 , 1 Flt Protected 0.950 0.957 8-aTrPrOW30.61P70,72W7VAWOMIT8.3§t`7•WAVAIMW(6-6Trly417-5W7176147 :1!1'67i5A7:7767$1n7F0- 91-6-67•37•718"6.6 ,.,.......,•;,..:,.,...•., „.,,,,..„-A.-10/4,:,,,i47 ,,,,,,,, ,..L. ..,,,•,-4.,,...k...--,..-..4,--..A.,iti...•i,...,. .../...v.:,..4::::"..-......k...,-...-•'-.4di0'Zi4.,.. .i•';,....&siallik4,4-1'.6,44,....'..J,,W.g.k.11,"?'%'..-1‘.4'..test'l.,.i•,,...a:;-,,Ii.,.-., , , Fit Permitted 0.950 0.957 811FF1070E-rifirem7.47101;m7f6....,*3-rf,Tag.gw44,76 -77,51W-cliffirfgfriwol:470,77,351-r",Tc5,767,3237.7677g,7•11-6W-Ttfgai ! , ::-.,....,..:.,,,-.s...-..;„,,,4.;4; -,,.._:.,g:,,,A-..;.'.,,-,„, ,s.m.at--go,,,y4,,,-;:z,. ..,....,,- Right Turn on Red Yes Yes Yes Yes ' TalalgfcrAffrdifiti.tki7MTMA`1447MV;e:?i5.-4.7X74-1P*V-r -,A1,,k4,7,7p•';;WATMgAW-4".. M.$AW•it'rca7. 7,70,-fimc,--,T.". 4,74-70-'-miTI-.d'il ,...,,,, „t,,,,,,,,,,,,,...,i,..1-.4....A.4.-4,1V, ,,... 4,T3Z4f.=.;'.'Z,,'•,•,.,A•IR.i.,,.',',,t.'.e ...,f•C.},a4. i.•`,..";itikil'' ,;•=i4M,:iig,2;4*;.•V'Al••=,,MktIV-.22.-•,.4.'.:.:72.ii.a.-4,4 .4.1":4-.S.,;..,•'-as..'..VA'Wz.1.&,-...,,,,r , Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Ofegtigtanifigtir77q.-7M,ft.voz?:••P' ttglir267.vt:•?An=,,•,r,nr47,..•• •:37,7,735-4A.-,,•Tt';‘,Tc. .77.•;-.3',.1-7r-'.sWWV.7:4774:74-,,,---M7..W7AA.17-2.78-(1, 21M __, ,..J.-r..,....A....:., ..,.b&,,r-...tIkAli,',11*1,-RazI.V4'6, 9'...',,,„4:•.;.k, d,.401:-J:i0Alall.'41.0". 4,ft7,t.A•4.'60.!..'ik,.• Zil,111;Ani.Lii%•%ia......,ZaL.:',41•.,:- A.V.....,Afai..§:r..&34,..,...aV. ,:i,A4 Link Distance(ft) .. 288 572 1320 1319 977,77:47=2:51k4f NA ,‘-w•Tig,-67,•TERT-777.7,.,-" ,fir:/_167,6•757;77 733 0•57,57.7.7,7467677,•••51,77.1 • , Volume(vph) . 0 774 15 377 81 0 0 0 0 48 6 76 fIe'471i-?RiKi.i:!Fiel:97.;4.FirLILMZOT6r.;;Y;T(K8VZO.1.31i;:s.'12:Pall-,7:07§ 3:§a743:7.§giffai,M72(42T174.5T643,7016-6aftil§:6; • Heavy Vehicles(%) 3% 3% 3% 2% 2% 2% 2% 2% 2% 3% 3% 3% gaiillgia*17527S:VNP:41.71.?"(57A,',10-4:44MitatiW4145g:Siii.3-1,;E:007W161,7 §SITSR§55,56PAITI,Org-FciWil Lane Group Flow(vph) 0 962 0 • 405 87 • 0 0 0 0 0 93 131 . , Treifirriiiin•-n•Fwprg•!7."-. 4;',.--•grfz:k;z" ..":•-.;.;•;-4'.r,i7:Ps•Fii-vw.p",rb•-ti.d,,,..,z ,4,. - -•-.A.*''?,•:•=-'.,q..7.•,•;••.•:,z-,F,;?.,.. i9q,in.71;,,p•-.•nr,c-..',, :1;•.".:171-vfe:44,-e-T.-e-•1..;:t•-;.-.47-777.7.. :40--iffi , '' . :,,•x”..,'Xci.,,,,4:uiliarAti, 4,4',),,,,::.,',.ffA,'Fa,*i';.,:',' ,14ZaL;a1.47,7.-.in. ,',,,,..,..A7,"3..":';'4-&-,`,,&:,-,,*1:1';',-,A',..:1.=;:!&,-,;,,,,sfre,,,-.;.,, ,:t.,,,Ii.,:,,,-,°,2,x, ,,,,-,,,,„_“„,. ..,.1-',:e0,,,L9,_., Protected Phases 4 3 ' 8 • 6 iseriiiiiiFellsfigeri.7-1FMWEn.•;i7Y4mF-a-•,'.7:cYwr-ri7gr-7---rq?". 77,-.VT.We-41;'-ZAT• 77.----'.77,r7TiM7';'•76717M47,1r7,-J717-776' ....,..---......AL2-,_ ..-... .,..:A,..:.kg.-•&A,...:,-,-,t,•... A41-.,:,-,..••A:':,,,-..FAg,"--r.r.•.,x,,:-.:,..-,•,;44... ..,2,.. 0,64...i-,:-..A•i,. k,72-%.4"..:41g,;: ::.itf‘vt,5:4:41.da:^.24,,,,i'.,V,'.z7.: ,•..;,':.k'.......,.....:=1,%.,,,kkn".:a.V.11:•!:4CS-'.L., , • Minimum Split(s) 10.0 11.0 11.0 12.5 12.5 12.5 TiWkliffir,N.20:7.0.. 0:73-4,7,0710,,,W(0,5161W.:711,3:6-1)::%71,0707,,Z0107010.11-1,-LorifEN),5747,1•P:70:47,107:345i ._ Total Split(%) 0% 58% 0% 28% 86% 0% 0% 0°/.. 0% 14% 14% 14% Y:ei_IT6Vntill:(,Cg'gfEMWIMIE'fr4.'.:P.:7,':'z'r-Aii'M'A.Tcf.Mg;.E.-t','4:YA,a,nlzikusvgryegfw,::;:ojf;7;f.-dWfif:tig,3TfP:W-d , All-Red Time(s) 1.0 1.0 1.0 1.0 1.0 1.0 freaffiCgerIc7.57,4PAUMPR:VMNFM424-'''z","•":'..-T3::-.7f-,ffl'ag:,V.,4-5.•77.71,7;r0,'-'. ..w.1•71,747..., L'Ff:',77:77;23TV:Fiff.:K7577,7;37:1,71711,1,ST-q. , i ..,,......;......_,:i.,,,,-,,,:.;2z;Lt.:,,/....,L7:,--z„...,:-..,,, ,,, ',.1.Ai.r....._. ......`,,..j..,- --. ':•,,,:-2;_;2.:-.- ,;•hQ.e.fag.•25..:651-.:,%11%•6,..t.,,Aii•-;,...,.;;;‘,.11:-. .-,41.:."-4...i...-a ..1. i.,,,_4•,...-:,,:."42.-•--:,-1;1•5....:“..•,n-.44,Ls• di.t.i•-41 • Lead-Lag Optimize? Yes Yes 'Igr'gfgtWe'g,gre,;9.';ii.E5:a:iAR:W;-'7,27)50',.P'eRt'M:*Mg-,S;'d.i:'FaA,t,:';i';ZBLS',7-i'aEF,Ut:,-R'TA73.g'>ir-=n!.,ba_7P„FZ:,W, Actuated g/C Ratio . . 0.53 0.23 0.81 . • 0.09 0.09 . . •'inrfjtiii'o,tp-,•:-'';'.F.,:-'-..*..,V,A' zf..;'z'.;-nir,..,1r(y'o'b •.'-r;,:---'-, . ;.•..'-',,./:-Aroo'::r.' T.o--''o-6-"'w.;,"iA•sf',:r.'izcz' Ats.,,'.:'wg.-c'AKKw•l,:.,:;-.g.g.-FA.T.•p-' -,.--,1,,,rJ:-7,17 15-Atg:TAT.6,r6-,5 , ki,,,- .,,,..,...e..4, ,,,,N..,,,,,A3,,, ,,,,,,,, ;6-ktfrdiZ-S4.41,isni,,,,, i':atin„'1 ,,`,.'..'..,(:`,1-1-,14Ifiaa....,,, ,, F1:::?.i.;,.g24:,,1Z.ViaVA.:1,;..iri.V.,:1 .,., ,,L.,,,, Uniform Delay,d1 23.1 38.4 1.9 43.7 0.0 DiraTIAMMIMMTEA:5.4:4R-7.AKOIO--ARMW1674.EfflifioMMI157271RITSZERtai-71721217.5,4767rag2 LOS D - E A D A ...'-f,A7,'-31;,-,:k4i,.7.,7,-44746.,TW97,,,,W,,r,i3,..2",,,'T-.'4:75-2-1Z-7,1;,7e.f.,,-317.1.77,•;••.??,7,..,A..s;;VrAn,;%71-1::,;','"9,vv.:5W. T.W2-1r.o7.,..-,A''.'.h7J-7•:4-7.:1;21 647.06050.16.3.a.a'a.....:.H.:, ,,,i.,&•!,.,"'1,,,,t-,,,,d.......„'io,4::,,,,,,,1::i4k,,,;,,,,i, ,":77.--• " .1,14,,c,,,,,,,,_:.,,,,‘,-4,1,2,;,.-g43je,,.-50a.. .iz.:,..,,,,,..k1,,,,,,,,,A,,„,;^,,,,,,s,4,:,,,,-;,,,, ,,,,,,,,,,, ,,,,a.„..!, I Approach LOS D D C rifiTeWe.WAT$TtirtifirAa'giTiagaZili&-':374K:ArAVWF5714,•11tWii.M.aliii,'SATAFAZAMMMOiZi$5•717;17;. .4 ' : • . . Area Type: Other , agkigniflin:PDFUELITEZ2Z1Z02,,MCC.talitat.,W.:STV-Sf5532:1.;.511(gSENM5N-IIWNITA Offset:72(72%), Referenced to phase 2:and 6:SBTL,Start of Green , .„,,,,f,,,,,,;,•:,,,,,:z.-,,,,77,07.„•-ar.7,77,740.7.e7:4:eirAPAP71 R4.0..PE.0,14974:01;. V-P7i.i.NWIETV,K;50.03Ciallisffilran.WIRWITENtf-.41.01.4...trg,:w41, .... .;; ;•, _:,1-,:thoz....:•vn , , • .,.. Control Type: Pretimed - . ttaiThifigiN344Cf•rdtriWriL:MEXIMUMR•grt.;.t.tanrear470.1E112a.-7-0-TEL7:?. 70ffrill7.71AYITA Intersection Signal Delay:43.4 Intersection LOS: D --1..,..r,,,,m,nm,,,T.••••---,#--Al„,,RMV,,,,,,,3_;,, r '':Nr4:7,11 rtirelikliiin,TajWifflEirliff6V61T§67:galiWN,Fagit11-76VeTOTES-aiiiiCe'itf v-:i:j6: ., .,r;•,1-q,..,- ,...,',,,,,,i, ,, ...,-,,„,=,,,1,...„ _., j 1 1 ! Splits and Phases: 3: NE 44th St&1-405 SB Offramp .-- 08 . Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 1 . BVL Page 5 HDRENGLVL7-FF51 . , . 4: NE 44th St & Lake Washington Blvd 2005 Action Barbee Mill Property#11735-001-002 Timing Plan:AM Peak L£n' .Gco0` ;;••"; ,••. .FEBL`°- >?EBYT EBR°, .VV-.8"L:!u.ABT<¢,:.:-!WBR'::= :'iV 30.:`,.NBT;;,,_rNBR.;,r 'fSBILV-79;SBT •= BR Lane Configurations ) T4 ) ' t r 4 4', - "=S,K',i+:,y:{;;: "`5; '3:.v _ �_?,.t _..+-y"._. :,;y.:r " Y'i" _6"z;C"r-' -... e"IL FI W:':v`hpl _ J 1900'k'.,1.900=�"'K'v=1 0' '';: 00. , r'10 0`F�'=1900.. .�;1900:" 1900 ':�r9 9o0��=r'5 9.00 :.1900'':z�19 wdea,. .�' .�.�P:,P,,.)"*,�� ,..�.,_.�., �..�:{.<<�..:,.- =z.:� 9 Q..,_i.9 r:. ...�0.�r�._,.,,. ��._r.r~ ae.>r..-.,._<,-s��:� _-..�_ _,.,,. ,�:,,._., „-.OQ Storage Length(ft) 200 0 0 0 0, 0 "0 0 �`;._. _.x, y:. � ",-fir'' ;s3, .,�,."�a:'_'-".;_-;��,. Stowe a es., ..t�.� roi::: hz�,r� .��•,; _, " ., ,_. ... .0; Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0" 5.0 5.0 5.0 5.0 5.0 ',:Y';: -*aC•,: �:`�rvr,-,.r.�:E; !e1,^! gip_ _•YJi ".,Y,'., ,..,�k:e: r,fy n••-'�wvD..�,. .,C!"'M".c "QiT,.'P,,» Turnm ' eed�"'in h' ,1°5_• gig? 1:5;:" .'1. _-:'x9;:�: .,.15r.,:::z 9:,.r.... 4�_;.;_ ;,g ,. -w9 -Pam,.., �.C.. p ) �_�.:. . ,.. ,:_ ',�,.-:�� ... ��:'. _,r:.- .. ,�u�..r�::,�rc�'�,�:...,.�..�•�:�� .,:.,,�::';.' �,�,:z;_°;��,� Lane Util. Factor L1.00 1.00K 1.00t 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 �.9 -;N,s"�- ""F;.'<�<::--'"'' •- :� -;>f;;�":nr. ;'f+= -r'�; _ ..'?ki-:.=.�;.'s'--- .=.l^1 f✓F:<'Sr..,=:--:-•--^;a:� ,•'';'�",�_ ��.,.". fir'- =i7'-- `"r':h. ;Cy,•"'" i?t?':';;�..-„- ..a .,N"' '%. s .s=rr?„ �2`S3a•:., .<:,t^Y".r.. c r s .`�,.f, Fit'•_ :�},< _,•:€'::� .,�%: '.0.887`' i,�. '0:850,=a�;r•>> �0:950:;::-' •3mt :.0:878 �,, .x, s :::�i�a.�' . ..;;?3;,i2a=.�n,.w ,n....r,,..,.....c<:::.hz'"`-„w.�::-£.:``�..4,mwx":`.s:�;,'.:::,:`,`r,.,..,a.:-.<.,,,_..-...�:.e,;,.,e.'cdH.:,,,�� a.,".,�-�:-s:, 2�.�,�h��Y.".:t�..>':..a:x•,....,...:...: ..esd�' ,:,, Flt Protected 0.950 n 0.950 0.997 0.998 S'atd:'.Ftow< ':ot`` =�.:1,752;�V "636:- 0:.�.:r 1;770 �y'18G3r: �1583, .,�:;0;==; 74 .0� �,"�'.,0. '16 2 .:^._,'. .-.,.a1P ...:u: ._..»,.-... .-..:,�,.., .v''Jf,. ..,,�.. i%�.'Mir�....,�,,. ,,.. _�» ..,,..__,.,.�...,.�wn...a�.::.?:f t."r..,...,..w..4.-.,., ::�x..-•.,, •t'.az3�:,�„>�.-:,:,',,_,a:itr._:, Flt Permitted 0.950 0.950 0.997 0.998 t.y1 �+.•Y,�y!',:y y-i�':' °.}"�• ;i.'f .,., �7".^Y :ij� yi: ''.;tip. � n'Es�.,:' ,r�y �r"r4 aN a,4'J, 0:ii6 Flow i erm' .3 ; °:.1,P.D.1636 : I) 1770: 1.8fi3 150141 .'.;:.w..:u0 a . 47; •: :.0: ,._<. .:0;:'>'.w:1632" :.,=. ,0, .L;.... .,.-::.lP,.. _)��,..,._.....�:ssr...._<.,,_.,,,<;c?..a .,..=s.,�'- :.... '.:�..,._.,,..,.._._a.._.....z:.rs..:. -_.u�...,._......:x.:e:•.:....,......�,.. 7,. ^�.at.��.,_,..."..._.�.....,.�_...�•n..�.....:.. Right Turn on Red Yes Yes Yes Yes Sa='Fow'R• .OEt 1 4.,. 5 ., .,_ t=` °,78"� �.: 26: � •--, .,361:. =;Fxh„ Headway Factor 1.00 1.00_ 1.00 1.00 1.00w 1.00 1.00 1.00 1.00 f 1.00 1.00 ti 1.00 _ - rk:a-Y» 1..�,..••--.. .,-.few,,..-. -y.;''�;::'<y.'a^�. -:-�y.� _ _�M}";.--, .,��...�,., _ _ •30.p i -ed�m=li . 5-: �25: 0�°`-'<:r'��_v. �;'.;;;,;:. Lnk�S e t' 3 ',.' -�``..,»,.,__...a. �:� �:_e�:r., ,. >...ri,�»",.,�r�'w'v,.. .-,., .,...._,.... ...._�.`�.��;�':�"ra. �.�.�;.�._:.' .v,-...., _..�",-mow', Link Distance(ft) 572 1320 1320 1319 _..:-,.,,;<,-;-:-,.,.,..,�..,,-°��•�.,,..�..r,,;-:,,.-`;=mar s,'t{ - w.��_.4r .,.,;.r• - c: -- :.�;�� v§r.11m - .4r :,' ':15:6: 6.0' _ _ Y30.0<: Tra e s� ,:=-: -�` `3 ::F:�•_ 30:0°=':';��:" 4�_••.r Volume(vph) _ 409 101 313 112 130 69 11 107 69 11 22 318 Peak:-FourFa'ctor: 0:81r<N 0:81. 0 81. 0:'89• _0;89` -0 8'9='' '0:76;.`= ','0.70; 0.76 -0:88,.`- � 0:88" 0:88 .�'`..d,.t.,._u:. -.,., x> .. {.;�?:d',... ...:.'s:S:,S _r. ...._., .^.,.xrr..: . ,.,..u- +:.'°`wYJ..,.. .-+JM h_eh.:nw.._.e:...w.wn-,.ax.n.w.,:.'u.i,::•.,. .'-� Y .-e,...'.a. -�.-... t.'i.,.+.n.....n. ':-.. ._. Heavy Vehicles(%) 3% 3% 3% 2% 2% 2% 3% 3% 3%y 3% 2% µ2% 2% .FloJv r; _ '<a,5 05s�� :='125=^ :f386=f.:.7. `126r .0 n:. <14 ^78„ j4. :141:•.;,;;.,:,, 91 1_2. %:25' °361i Lane Group Flow(vph) �505 511 0 126 146 78 0Kj uY246 0 0 398 0 Tu n T e - ,-�.;. Prot-�^' _ z�.a }Prot m+ov: :'�S}"lit' =.�;, r -�:; �:,,<. Slit=`;':u`.g .;i Protected Phases7 4 3 8 6 2 2 6 6 .;,{.:4�.• ;�,r e_r�'�' '%:I=. _:;7:::t',F;: ...��'r .'fig-r«�. 4'e,' Permitted:Phases: ;� '��•. ",-" �8`�`-: , Minimum Split(s) 11.0 10.0 11.0A 10.0. 12.5 �18.5u4 18.5 12.5 T 12.5 TotahS`liRsP . 40.0.; ;4:1:0 7; "0;0=,>.'�:.1'S:O,• �16:0�=�'•�M20Ox' 24.0•. <� 24.0�:��w-,1,0:0 20:0.�`�z r20.0 -�'r:'0:0 Total Split(%) 40% 41% 0% 15%J 16% 20% 24% 24% 0% 20%� 20%° »0% __>: _ flow=Time`. `4•:0': - .:4:0'r'""{.. °'4: 0 :'4 _ "0'<;:�;+ ;�4: -,�j,,::�a Ye S` YY: � �.�. -�<< 0 .-Q ��-:_40.,. .i4:Os�:.:<.•:.rt<.;:�::< "��ti4. Os,.:; a....„, .(.�j,� ::ta.,.L��::,, _��,- < .,,.,� � .�. _s,.r. ....'.�;"`'�.2?: _.. .. ... .xcsr:<.Lh':"z�a�,,, ::aC,.i<f<.;:W,_.,_.,._,a._,. All-Red Time(s) 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 La /La ^ n7 6 l^' 1 ad-:2.a: ead:k i - S... 'Laf ::La_ , ,...., __.. ,... » ,= i ...�:,.�..J`..v::.h, -,.fiS .,Y. yw^ , . „ "- Lead-Lag Optimize? , i Yes Yes Yes Yes �t f z' �4 ; Act E fct'�Gr`een s -:`t 35':0' ,36:0' :.10:0::�°::1' :0• ='2 ;0 � ••19'0" _=< " 150=>' Actuated g/C Ratio 0.35 0.36 0.10 0.11 0.26 0.19 A 0.15 :. . 'fir v%=-Ration": t-•"•'0.82 ; :0:73 t • ��0.71•-=�: � ,.r•,- _ � -_0:71 i'0::1.7,;_.:.,�. :;0;70x:r:.t;,;;;�=;�:• 'f,:.,.,,,._..,., .0:72 + ,. . ::tC:�a�',t`� �?a s.s.•,..0 .. • �:'�'x'�::.C. v,.s*:. ,.;:c,.: ._._,.. .�: �._',�`s,..,... ,.._s...,.... _�._ Uniform Delay,d1 29.7 17.5 43.6 42.9 0.0 33.6 3.5 D I` ;i a. 0. _ '; e a °'1:5:8:' ;5. ,52. '. 50.5 r3:7'. ;35:9 ' `iw=`�=;�6.7': 'r �°:'.`ram (��3 � Y,�_ 5.,, LOS B, . A:: D D. .A., D .A A 'roach`_Rela � >�_,s�: >>r;.. ,..10r4•:�',H:'� h•�:40:9 .��ri r�35:9; �<�..t '-6:7�;',•« ..PP.:_.__ _Y___ ;.' „_J'J:L3r"%C"�.i.e:.._......._.. ,.._t:v._.«.:z�y_.,....... .x.�..-.,., _,.;,1,�,`�._. _ --..,:.c,..'a,t.,._,,...... wt'_'-...�..,._,_:.".:r:v:��:.:`.4:e'.��. � .,.. ..,.'..:3:',', Approach LOS B D D+ A lnterseotion-Su mat r '-, :x::w" -k :33 Area Type: Other _ _�.,.. • .,�: 'iL�°-^2Ci.':%w -""`:Y,^. .L". `.k'.}.TNS:.;. - ":.fi',»^JE^F="L=;r st�F:.R::,.'- -�i;Vt:�. h'••.1'• t,t 4,: ..FW••;;r'�\i_' ::$-fit .;b+.1:y! `�l'•:F. :s' ....a,:5 ..i z.`^,;,.1 .. +`-ti' ._..y„ �.,.-...._ -. , -•'..Gyr .r_.�=..J ��.i'. '.., _.. ,.._-._._'`__,.-,..,.... , ._.......;�:.tea:.sF,aer.,....,.:.,�.t`a"::;. �,;..;mi=`'.�.:•.�.�,«-:.:i:iS..'..�z`,��c�:.�� Offset:0(0%), Referenced to phase 2:NBTL, Start of Green _ ��r°r•`-rs.-. ,.,�a•- '^�,�.�*:^�'ar�..; ,2'Y^�'^.^ ^9.rr�:.-:-:•;�:"dtix„' ;viv,:: --.4::�r qr,.a ;"As1tr �.r�`-nr' .^t�r,�i^�"33:��^ r_%7°:a:.r;_„-..,.� ;.1- - .f.r�,ur;,.#.='s. ;.n, "�s`- s,. .1.�5" �3s?S`r,}:��:=>a".",: ,rr.. c.a-: Natural: ele:;70_:°r:-�' .t -. .5=• , ; r. 'ti :;.- - , „Y.,,,. _ ..,,_z„��:�•x;...,::J::� _., ._-. ..L:4�<,..:�z z= ,,,.�,�.>-. .. ,e::-�,_ ....ism:_ �'...s.w«._�,.,..d.,...,,._,..�V,..�.�.:.,�,::c�. ti;.:�,,.��.,:_...�,.,.. Control Type: Pretimed aximu. sv/c`'Ratio:�,0: u:�_`" :�r��° ,. M 2•. -,. z.,... _ ,.s,.�... , � ,_., '�is:.,... ..,�i:�'�..T,: ..,�;t;;.r.,: .`i��,. �`^isr�:::�YsY.x..:,7?vt...,..,c_,.,.^`:�c::�('s:..:...,.?F.,-,a„oa,a:�.:a.'.;;r!,:;r��i:'.ina<,�:::rts� Intersection Signal Delay: 18.1 Intersection LOS: B IwiRr...ction Ga`aci Utiliiatiori.79:T!?.g.r . „fir r,Y,,N=: ,,_.: ::3.-41 n;`2,':,P,;f'-•"h'" ,.. ,., ...._. ...�.�.P,,.,tY�<.•�.�_,....�..,�,..,_....�,-...,_,._� �-��. N., ....., ..'.i;GU�;L`evel�;'of�Seivice:.C•., `P k �::�: -: �':. t ... ,. ..- a.'�iw�•-.._.�t- -�`'..,�„.:.:t:��iiHis s;�:' .�t�n+«>:'sr'r..:�J6".r Splits and Phases: 4: NE 44th St&Lake Washington Blvd Y 02 $ 06 •"► 04 1. 03 24.7= : _= . 1 . 11204 : 1 = ,14TTsYSWA :rltiV k f•,: .11' ert:ME ,'•%'1 += m7 o8 401MA .cWWATP ALV!:.yi16 1 S-1-....1 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 6 HDRENGLVL7-FF51 5: NE 44th St & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak .� 4•. \i. F�.-�amnwe�>aGrow� ..�..� �*�...�:,�.,�. .._EBL...,:�..,EST"_:,1`N�B�=F,,�,;.WB .-�'�ri�SBL'�. ;-SBR'��::�.� �:r�h;;.•;;m �::;,."°��,a', .w-�'�,��,-� � :%;;��,. - ..z p>s- ... ... .. .�, . •� , r i «.a. >I�,� .�..s, ��.. l,.fi.>. .- > «��§:•...:�?:�;•,54:.��.,.., a.,fis'•,. .,r.'.,.#a.,ma's,! Lane Configurations 4 I, V .�' -'a.'R'r '1�vq+*�,r'+ :�`r . '^` , rt,,::i""'_ wL?4r�*_�s• ideal F.lo Jv... �,a �pp00'` ':1900,. .,1900:-.�:1900s:1.�D0... ..i900, �:.m:' 'X:i: - `•,} ;t.<: ; . ut , .,. =1„• C ..:. a,-R3e .•,»Y•• R w.a.w„xa7 ,aw.xs.;ra:-.3t.,...,+rneo•.:sew.. .r.,. ,�°<�.:,.. .,` .;a,;-`",:.' ':..w-;.? ..s:.N drl'isi ':.., ?.;t. ;.<Fa rr Turning Speed(mph) 15 9 �15 9 • .'.' ,;e,y:.'.:'4gr_:s. u-7— ka `P 5 .-.7 = ",a i.""" `{. - "-°5,:,•'"',r^'_'?TT"";',. {, ',,.+"$�.&':c ?"' ';v..a..,•�.t '.^, .};?,'"x,s -'."^ ', h.9 i -a�;UtiT F�ct;.r.'<�; �,��"'?" '"�°00" ' -1:00. :�`"�`i•�00,3 /� 1;0� k;;r�"00'• aw� j� r�5. ,.:n` .�•4E F =f s...t,. ��s�...f.<�7� .7..w.w"` S.>� t��•..��.x: '..:.N..aL.�""tiw. .eS�"�tr�« � Frt 0.998 0.988 -.;-T-x,.-,-_. >:j,:� .•x,„a.*;M,;. ':': ` :^ ; a.ZA .' ,:a ,.rr:, - .5., 1 r`. •�F'"sr''"."' - .::-".-", (� _ &.r.� �� ry `:�` (�;°1� >?L°e 7 „i~�"•a->,M� :.2 4';j.r- .�'fi: ..'2 r.}::.7 It ' ,- ;Fz 'w`z-s`�'.�r�._s i.ycs�F ,x ;,,';�. .,fs',Ot95 ?�;,�:�t �y�,u,�q,.,t_ �*,,r:�:L;='�s }_ :t�`< ��F '';=` s''`+ �.;.:�..�.w_� dad..,? <:�:.`s'�°,.a.: ��h'Ss,».a.m:,,.,..,.r-tiat��3,.�c..ux._ li��u'`�d'�:c.+`�..s"-�•'ac+'t�':. :� .,.�='i 1 Satd. Flow(prot) 0 1863 1859 0 R 1761 0 p 3^'nm- �R' uPn R'tC..a., G];�.' ^?,: �YS?Y' r?;C -`C!-• ;7},7.•� .,''_, '4�b-,;:lT'F�'•+fr'.t . , r.G';; f, u' :arc°�.,,"'v"i'':�#.a .F�,`�,•,._ s.5%tt�:�,.. f:d'tir".;. ,-. :;K.•z`e�r�r,:.,f 't? I-1t,�Permitted$.:, ,;a;Ma.,?:?,.y. ':.,.''r.'.di,*v g'' ':.. ,,- r,v' .•# :,0,.9,.57'.'�.,'-r ra,,; „x.H.: L- is jk3a;. t'r es, ysr'�'.`�',.'"9 a` , - ' �' ,zs w. �..:,�.c��:. .�,s sto;n.+�fP�/.�3,.v..v,�4:°.u�.iA: YnF.�P A,;t�is`�'�(>.uJt..,h}.,.r!:..us..:K a'�,.,...6..�tatl,nd.:�--%la:......'�' Satd. Flow(perm) 0 1863 1859 0 1761 0 ter," ,,-'�.,� �" ".�.: e Z_' �.x � ,�s 4)..�'s�„ '.�*:�-:,,',.�:�="t;.�s'.,.M '=^?' r3. K�..rh'; �5;•-• _ b ead,�,a�,FaCtoe; ,�;;� •:�t,00 ,�`�1.00a: ':��OQ��, =1 00�; �, Q0.....:��1�00" _ '� �=,. �. ,.. jkn... � ,,o, "'}:,.,;f�' "`.:�` `4'�..:, .trvai' '+ew c: 5:m' .��Ya':.:i✓�:.cs+�t:r<`?��`.��,.pia:;.�,r,r...=.L•.:S,ra;:.:' rc Link Speed(mph)+ 25 25 25 -r k. "P.� �^t.�"',,,a.>� r�;a'rr.-~nw ;je±-W^ �.,,,r�„�� ,mow,�,-,�`�•-;�-�-.., ^r1.,. r; ,.. y,�s:.,-�* ^w'"`�i.::. G;-...x+�f' .�'�� `�„;;�'f'-.;`!2.. Likl1 nce 03`." : , 3 is 618 13 ,.Zi ,.. .:. � 621-1 .n _�r 1 . cav,.�'� .� wah:iazm'tzwr (s:�+r<:;:.7"}& .asi,m.aF..u.,e,rz�':-"& ��s% �,sd'r-.u�:. -::&X�:d» .��:`...x,�iYh`+C:.:e=...�.:r..s»� .�Nds�' ,s..t:.N:.. Travel Time(s) 19.2 16.9 36.1 -•r`^- �;.»-�,,. ,�"�'.�:.;irtui.,�s•'.., +'r�;1r'.r--"". ,,.,.�y`�•-� •.�-;F r y' ::t.:�rr'.y �+�"..,,�„.'r •^�'^-XN•� '1,¢�� fral, ^*.'K�€ag+r,_ ,� � - n3�' '+� '�,�^:„''S' �.i, Ar:�� >:.':. 'z 5'r':,.,;�.,;3 Yi<"-car'•' - �l'<',i',y.4 ��- alumty 4.:?�w+a >4.P ��: -z.rF��;a,Y�• '"e�.��3�. :: :- -, ,ha7:u.� .r..c,�,.fi-a,fi`�-° i�d�.t._.aJ,,;.i..:tku';, ..,'.c?�`:,..:�a:r.,:a;Au.%,.��s::v. e�",_,•Ian.z''�+.:�:;v§..;."�w�s�Yas=,�.�:;:::��'`�'i`:�.iif.:%,;u � Peak Hour Factor 0.92 0.92 0.92 0.92 0.92 0.92 1'"`^,'7?.".-^s.,$.,,.`��rc;'"'".�;,;�,.''''•,�'°.,�i'+`,:,7`�#,a�u *,�.' .Y, �,+;•aXr +r.a"�,?f,?.—"a t','h >...,a.f.� F.»,'i•- x"i,.',: m.'.s4:% q.. ,^V..�... ' ='FI vv..v . .> 0. x.76O ,"140u^.s'. :�2c ,,,.,:10 , .; ter::;,, r z`g �, r;:;.,,.,. ,r .,•, g,r: +, .✓.) Lb.¢e..�- 7:..= ;...1:..�ets ra, .y„yn :sa,t11,..-a.als;:7t'u..�R. ,:sue-�,Lr�;a,�'u,��.:�,::t::�.... �'�•� 14:.a Lane Group Flow(vph) 0 760 142 0 11 .0 ---n^.�-'�^:..w..,.+- nr. ..r_.Y.... .�.. x�.ns^.r;4-*t v.•=r r"y;t'r':;`. =.a.� -s.'t"z^tr;.+,�;,r 'p,;-a:s'M..,f^as�„•,:.gF -r;:'' t:e .'7P:,'_.. ?�„r. '�''.;7E ..ur Tst-3?FZI IE-ol,s 8inn.Gantrola_ b� ,Fr2e•:.c. .:Fr82 -.4.�,x.: 50 ,:.� ti4 r..;._„,;; +,.....7,,:•...= ..a.s...a........•. ..:...:.....«-.a,..,a"T3:Mw:e:,.,.m.,.,r.,"..,aJ,,...,.,.,,.,_,+,w...,..,a.14,-..,.:.r<_,�«.:,�R�' ..,...,�.P»at.�" ^is?sts..`�*�`::1=z"�i�rX„>,..s.�raz:S{.'a�.Y.. .�':tr.,u,rtz�:z,....,,a-J.,...at_-.._,....1,",4"-xz: 'K•'^.", ., ,••.x*a+ a"iy«M_.c ..£: <r_',,,-'am,..,: wr.M1;F2.•S a:�`'f",A>' 'r,'R '...°,, },.o•,b 1 :: ^' • w:-'3"`,..z, �ti4'ac°'_;^-, «,,,' :,£. ':?`'-r`'%$S�"".=: ''»nt��lk',+-tirr riz'3°'c .•' ' 'F:, :�tiu�,d's intersectforl..S.umma'ry.>+ _x, :.;.. :>. ,. ..F. .,., <„ -. .�,�_ . '�._ . 5 dx` '+v ".}...s-A u7i .",t ;...�,,:,.,5:. --.+r,'!;'�q: •r�u':.;r�:-��e `tt.?!i�' ,��':=�:.'.ij,:a, �.k:M 'ir. =+ ,5^= ;.,.,. '-ntiZ::d°`...,,-:.*::.�- `7. u.,Y._i.�t:'.a'i�h- - e:;-..*E� ..,,Y;. ,_.z"_-%:,:'."ceay�Pe•�..�...,,.� ,..Other -� .,, �,�.. . �� .��.. �. ..._, ��,,� ��__ ,�x�..,_.�,.�..k,,,..�,a,�,. .�. ,.�.,.� ,.,. �..._x.r<.�...� ..,;.:'yY.�^�''•".a�'_�:i_.xs.,..r«,.e.,� '^"»ts'viz.', , .+..*�acx.�r':w3`-S •:.'�...� �;;�:.. :�,�-.' ttYa ,t'�;.•�:--`$.`�...' Control Type: Unsignalized ..e*:;.eR-,;z:.�.y.....,,�..arr�+.�sn.y,^.�o..r-,�=n w_..,.,y- z-..,�,,,.�, ;,yx•, :�T, .....- z,;-,rr^-sr:'�r=-t;�:-.:n—;r'�m' y�Mz'.r7.. 'q?^';�,;y�?',�•s"-:fi; 'i�-;;�,� L O ai•. 4 'ter'' ' ;a I'nf`"erseet�Qn..Ga aaf �Utilization;=51�7��x �,',��n'. 1CUxevel nf�=Service�,A ;�:�,�. •_.; �. ,.,w.a': N.4--}�:�`'r�'��:: <v�'� 2 .3r.°, ,� Yam.,-. '..,t;.:. :3,zsu.:.i:, :v .s`".i3x- ;«,.....atu� +;6:,M..,.za. c-< s3xrw .:>.::- tC;✓=.5:,:�.r,:.:a.7 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 , BVL Page 7 HDRENGLVL7-FF51 • 5: NE 44th St & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan:AM Peak t �VlovrPgin , --,.8;?'Y'-'-i1117:` ;<a, -,-�'. r, ,,._..p�..:y,•,"` <"lqe 7,17Z,,,-s=W:,,., iz° `-,wx= r •,i 41/4, :•.0'r:�'" errlent EBL - BT WB7` IVBR< SL' , $BR...` . ' err., a.: k �' "�aatFw<�.. �; r '. -s��`-. •-�-�� c;: s�s�r, ram.� v..,-�1 Lane Configurations 4 T. V - x'--�':;°`:, •3� ».S�,V�"'zr .K-a;f,=^•-•..uy+r r-! ,;'-r�t*.�Mee�,. .d';.:..,__ ^4-�,�»..-.,%fn; .e:�.�'�r--,- �y ''��-;-y,�n n; '^'�'t ,n F7 ..+�S.w:-n..:...w.,......�.<..,r.;.a,:%'i7.E':�:�z'$'. ,�+X.`32a,La},w..-�.•,�oL��: ar,r, !.,h.,d,'i��.w2�Y�:x`-0�ii"�.°_�.<„e'�,., ,�p.c-,.±: i;d.:.µia,3v:>�:ter,:�JiuCrsk,A.�it�:.'.3ffiaA,c+r Y.'• i''°�,Y,:i..:'t:,;, �yYs,-��'.r� •'�':.�3;,,. S Grade 0% 0% 0% n•m�• ^:°iG:t..t. fir.---:: ..e rti.',.^'."f.:;.r, 'eT(w".^, P,� �olurri¢ �eh%h�1�.Mf�. � g 0 :699.: � 2Q9,:,. ��_ .:2a `�'��'9 ,,�4 1 ��..�a�=R<--� •r••.-� � 6:,,a-¢+�: .s'. ,,.w.:..�- �.:4.�.:.`�t'¢-``ita::t„n'.;�+&«'s.'.�,{�,'•a... «.c.,=., :xw�`` ,��.�'n'd�..u,., *;.�.,�.`",.- ..�`,..,,.;.;", ::.�.a..:r, v..�.in.•.i��r_,��.,.,.`i..`'r.,._.. a...,..t,:,.'S-:r�:a Peak Hour Factor 0.92 0.92 0.92 0.92 0.92 0.92 -,'�Cre r,;x: r F, .;r,�-.° ."v4 _ �r^Y;',ex�., ��:-r<;•R,.m,yv+k_ sa;�.` 'r�''.�,�iX L'3%£� ',�C"",`,c1T�"�'t st, .tom' 4a:..:,.. {>,,.y.,t_ .... a. N >.��,•a.�.,i xfa,,, ......�s.."='',a�., .5 ,o.�.'��:x.,u ,:.trxazu.�-,�-...w.:xS;' .e :�a€s".:,,aitir2:,�.�.,x;.�.,sa��"wc:..,...A,�;�.i;` Pedestrians ;;:,;r. f •s .. +-,r,,nt-'.r^t:.33#"' "",."^'r""'..y- 't,'.,'.-n' u±r'^a cc-z', hY, �_,�r-ar,':..p,...• ••• ."• .=;.sx«�ai,•sH`�'�.-•zd'..c,.;3Cc,`=`%x-'_:�.-,saa'$a�fL>:w:3Yx}'.-R...,, ,r.u::�m.�,ua�;.t=1:3 Walking Speed(ft/s) ,u,.-mac•. az.,re- .g"�'rraa"�`� ';�• ;,; ��, ".m% '.�,,• .,.',.,�:az+a"^°•":m;.,;r�--s„y�a"`�' � cr.. ar.4.++�.. ercent',gl4cka,e. ,;x .� .,s.,.. .•.9 �;�J�"'"'' �+a'&�'' �;.�3.ass2�gai1„�d:n�..�',dkas:.�N,�S�,Y''.•'��k..:=F:r{,uu#..r,>;�at»!4i':;c;:.}r .:�„u?';Nac'"�:�"`:ar.'�,^a,:`uvi�.,.ttia�-:��..:.&u�,.=x.,,,w;»wru ��'t':;ie;.�.,.xi+� Right turn flare(veh) • >•.:r•:t7n-...,.•,»Y.r_•�.^,-;:,Y;m*a k '�'s�'-i[a a;, ;:h?C;'+-�"__, ,,.�-,..'�.• '�"?:a ..a. ma+-�;'�?',r??�C�'j_ ,..;��'�:z's.?3t ▪ r„'�r .ry:. >},�-.�'�;;�•;,-�,*.,"L'%,�.,��-a. -�a;y;,m.; edian. e: ,+"-= 'rL _ - . , t' ..., 't.-. 'ta :ram.-•':a=:;a °.erg ,, �s::;�,�Za' ..u'a::�..,�.�. s -•� '�� ..,"._..:%.;.�.�,�" �,�,�� Median storage veh)R _ • �sfl; ;,: : . :1 .r.-.;-.Fir,. r:�q7 ..at, nYr^---:a., a="t=:;s.. ;;. �.> r "`?',C". ;', ,, ^}T• 'w", ,t.l.'.'' fr -,q a..,; ` '.',.n:L> ,�:�., > a, :ak,.- .Z;. UIUITIe„ ^` z:' 4�. .: " 4`L ,8r 9()1 = Via. oru:.r F 9"P v: t. fit: ''i:.=, , : ; ,r • ,�,..a..'w;kzkr'r4tt,-w�....a.....:3 :ris.�.�.... ;'�'x'': 1,4','�' ^s..r�.�.•.yaw•�:.:.�Fl � " 'C '�''�� .�+�..".>,..,.•..,n.'� vC1,stage 1 conf vol yC2sta a of,.ol.: f ��,, ,,� z �. �,' .:..:,: • :.. ,� �. ,: •.-:-: t !'L.......g.,<s.=,.P ^�;z:`' ta= R;�:iisYs'�,.Yt � ,�t.,z:is�:.:,.,.:;:_;sa.,aS'. _« ,,:.�.:,t�,�' »s'.�.=�:`x:;:aa:,sv'�.�::.;.nu.;`s:.�'r:[:,';�r`:•.,i.::: �z':"..�:....,.,,.5 tC;single(s) 4.1 6.4 6.2 tC-•_•^zl^-^-;,c^.w -- 'i r. .rrok, +njr�.•. ,� p1-ate F j» „s„hkz:,.,..,.,,�,.:.,'[r:rzr.r,:,n' ^.."a"e," :7-,+" .-"° "rr-'if";t ro ',^`a`F.4'v°„^"°.: `e ,^y_. p.�-,�:�",s/. „,'le' -:..€:`:i i:$;, <.1, ..'1>ia, r4'x '2•. ta^�@'.§' ''t,:i•.. ..;5`, .,eo....a ' f:a::. ;,'-l":=..vz`^, rv.o ``s„ ,'`"=o:"-k, ::b"•.t,2 ,.�,a;y."° E'e4;rx�;...,:.'.�,;w,;:+v„-ems i �;,n, ..i w. ..,ry.�.:,\..�e,".:'...�.<�•c•,�>,.�:�s;:.,,� �.�.:s.^;:�'v::xvr:_*-.�,,.:.;u%+"�:�::�i°;:,'z�'�`'at3.'*''��:-'as,as;�'��`�;� '- ..z»�``i�.:s'x'3',�..zax�.•=*�:.e..dk�rr::....a:�...�,,.s�'�"a:,�. .,,: tF(s) 2.2 3.5 3.3' • ' • „0:m^ >,,.•„-,-8;::","•S;"..>"'A°+, 'x 5A ,-7`.''�'`was^, ,,'F:�.'. ;.. _'^ :^ ;'rr -atp- "'"" ?• r'r .* ry 'ml,:'.. •+.,- ,. ,,dic, `5;`'.je;... ;;,�%'*':.x m> $.- „A,'.. r,s: _>';;+,,h-r,,:,• • .: ueue free=/a-.-=- i ; 100 •, 97r:` .100 • .?t;•`�.�. - ti>=>� ,.-_ •`7�.>...1 • ....;`- ;za�. E'�'v,.�,,.ut„<:::;.�r8tta.,*�.• i,:.:'�',';a.: ...',``'v`''.t-.:,::..»:�t... - ,.-._...,:';. §•:.'..�^:..w��s�;.: '-•`'��`,a�,.�e=,u;.,�=•i.�'':=•••.y.,,..rtw,��etc cM capacity(veh/h) 1440 309 907 plrec"'..; ;. .°,` '�t.'s....; '.fy -"""°• '-" ,,'+;>: :=i '"'�°,,,";.,::dU"• '..a�, ";�'.;", r:x W,-=-`d^.;^aa;�,y:• .,,sx..rr -a s., � � ."'.3''b'5-ti,<?j ;,E-A, .., ;. »,i <; Fk,'' i.p. ,,Ni.,:.'fie^;"a::#',"tt,�y'y 4 ,-,7�;fir .cks�.¢,5':'*, ton,,t_ane,x#��.t ,,,,>=,...tia_ B ,. .WB,;1,,.�SB�1„�.. ,..;;;,r: ;zr;i^„-..w , '.�•: >::s-�. .x:;d;9�'a,� : ,.�..ln n,, . ...,ex.�' �, a�a':.t:r,._��5..'n?n°. .:C ^•��'' Volume Total 760 142 11 ''Yx"--,-�� ,zr'FF,`.;.-i=.,Y4.:�°- ;'`G.�^'y :s:,:,. '''+z r-t .fir:ti� .:-'K+�'c,��'..t�,,.'S'a"�`='.�.• e.V;s.M"x:. .� .•^^:,�.;°t'r�s"%�-"=;s1.�T;"^.-�.,.s=-'sb�r_,t'r:.-. r F.a;,'.:�b: �oluriSe`.Left'�. „�w..,a_4 ?. O.a<• > 0 is ,10i. s-E.<�.{w .,c. :• a«.:..r.. Volume Right 0 2 1 �, x,.r..._ :r^-•�r x:'. s:4Mr:"�aR;"x`,� - ,:t.`�,�",-'^ ,;:: „�•�fr...^,x^^`�, „ Mt•, ,,, `;'. :. .rz:A'gin,o,+,.`,''".�•',s."""`+.:Y'::f,.;;:Hgg �1.440:• '«17'0•. 330,.k. �,.� �; ,:� �._ �:«�,.,>;�< ._ ,�i;"�w�;:iti' �,�-,•,� .A,,:s .r.,�� .>,.�r:.. �::�?a�•4.-.w.�;::r.,�::�:'r.�°.a�:�...w�;....v..y>�.,..i�;�:s1.��`Irk...?�;'.�.a..�;.a,,:�n.�f>�=',�:;::..:.,,�,.>.�:,;,,.•.,.,,:.+ Volume to Capacity 0.00 0.08 0.03 a...�+Ter-.G--` .-.•,�•- `S:.r t'.'.._::,ae"•.,�."^,Tf"",,'.'tj: ,n',"x=`F,' 7:' - .�z ',. :,�»Fer•�..: .r«�,n .q«-r-:=.•rr!.K� -."C,',T:� s,., �^^iv'.,.u�<,=�•:_-�.,.il;;l .z� „Y� c:.,.:�,.:�,�;:'�F�,..-+Jx=:. .Z•`�.;>;v :.<ir,t��mn�'ti.,..•-,r�:'-r.,�"-,;�_�_ QUeue=Lengt�i:,(ft[. �w•r•. :.,�>�,�ir�0: ,� ;0:>,,,,:�;M=:3._ ,�..:.�;., ,`�� _ ;�.. -,;�ir• ;.: .=,.;,�•a -�- ...I..::i,'s...Y..-n�....c,,.... t.u--. _ ar�7.r. �, .,�3i... ,Yst,;:�w..-_-.-,...s:+,- :=a-�.•,.,a,�r,«z.;,r,,✓....w,.;:�.a.,a...ru..:k...,�SA.n..,,St..,a:`i-i��':K'i:^is_+,k:,<=v."'- .....-,a_� , Control Delay(s) 0.0 0.0 16.3 C -rx±a7*-r;,;x•. c•r r^;:mfi �.<'<O ,rra,T wu,a;Z W,P,T7 :',M,,.77=7:r«Cgr;:;.., .cr,16: n^•.,:' 7�1;a;e?:.7.1: ,?3'q"'<".7,ip'';-, t= Lailp L�� " 3l` 'q�r '&ivr3�$*"r"gg C�tf (j r'�<..�,=, `� s•4 ';�tp,n'h�+;,rk: ',rX^ 'en -�,"p,d, 'r'..tg�p�n=_•'•`: .d,,. ,. • S�w� ,�;�'�`st,':"w:k�+s � '`.'°?'snX. .3+�'Y �t '"';..:-..a,' 3 �x "•�,..s«'•ttw°5.�4,."�' .ii�'.$i514.at�w:a.� �.�5.,.:,..:s:.w' Approach Delay(s) 0.0 0.0 16.3 7-m.*•,^�..,ro-^c-r :1:," -.x� � -r�• �ir+�;'F M•`4!'r r {cm.,�z.,n:,s;.;, �r�v;c:sY-.s-�_i w� ems. t`-'r.v;:��-.ra-�-,•-;;"ta:t�".,,.,m a nroach=CD�S`�: :::ter:.. -a�.��p -.�.�.�. ..G.� - � .-�_�- ��._,^-: - ,�� :•:--�•�;�w�.,-_ .:�.: �. s3� �.r2;�:. ,-�.,��•c'=�,,-,e...;.`*`''". � si _ w.,.. .,. �•:.�.:>ti- -. . r C s,; �:ntetectolSmmarY te, I �v':•e3�'.,S.d.��'y.'�r,� r:�c=;ii't=;?:'&'n' '�a� i.�J.t�„ L.i .-a;, :x.,f�^„; as's. �*r„�z<;:€::t.Y'w;"r'. 32t �:b '"4;,{ny°,+ ,`�y d:�:,.� ,+vy,i .:Pant-i .'+u`{.a..:rL.»:��`x=r. :.}� ..�;;,:s,� �rt.�q�`,.z::•;'�:.�A Intersection Capacity Utilization 51.7% ICU Level of Service A • �;�'•'�.xxc: z3•'i:'<`'.ix r ;x�P:atyo�..�'t'-' :.r:::X"'. :a."Bs97"y�","^,-,°F`rrn a'='�? i.i-= ":- tom:, axt= *•�• :.u'"'li: '�v :,cx" {' �'-�xM�A�'tn`.! ,�i,�'.,":•a`'�'nE :; x rYlr4=:rr:.xaGa�: �a�-.-',�.rs 'Y. ,�,y ' ��rza;=..':- �•„J.�Js:a:,,.-�..;.�'t�.i,..izir.�;:� ci,..-`�E,�st�- ..s«'>v w..:,.. ...r�h.:�c' ..a a�o"�. w.- .;,,.3:r.':«'e;. `'�`��7r +n P,,;�,t.7.•aa;^z;`v Msf�: • ,':°n,:.,.c�'• ..,�,:...,c,-a�m,.,a::ea.:z.�r �"" ro�k:,•- .:r,r'�':�:5: • Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_AM.sy6 Synchro 5 Report 3/27/2002 BVL Page 8 IiI HDRENGLVL7-FF51 2005 P. M . Peak Hour LOS Calculations With Project 1: N3Oth2D & Lake Washington Blvd 2005AoUon Barbee Mill Property#11735'DU1-0U2 Timing Plan: PM Peak - / =Lane Configurations 4+ .- | / Turning~ i / uotd. Flow � ( / �--- / ' / Peak Hour Factor 0.58 0.58 0.58 073 0J3 0J3 0.69 0.69 0.69 0.94 0.94 0.4 � Sign Control -_- -- t, . / _ � Area Tvpe: Other | � � Intersection' Capacity. Utilization_ —44.5% ICU Level of Service A - � | ) / | � / ' ! - }� | � | / - | � � | � � | � | |-' Y:\TLona�Ba�ooN0| Pmpe ��y0 SynuhmeRopo� 3��oouz | � ' � � 1 Page 8VL _ HDRENGLVL7-FF51 � / | 1: N 36th St & Lake Washington Blvd 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak `WBT.` �:WE�R�=•�...,NB.J~� N �:<.- NBR. SOLr..�S�llovement��,:�r;:=...,�..,�,..x-:�:_ .,EBI�.:...,EBT=.'.> 'EBR s�f=`:=�WBL�.� ... B, � ��:, gT.'.;,„..,;SBR Lane Configurations 4, 4r 4► 4 n�:Gontr l<_ �:` :�;; r�;°°. _�:=Sto' `to ,;.. -:Sto •.,,« ;#� ;<�:�:'::;�: _�,:: �.�., ' ; �. �Ps: SSP:� :w •:.�,..>w.._,,,.:._<.��:.::��:;:�.,.�.�Pa=:.��•.� Volume(veh/h) 6 6 6 0 6 40 6 112 6 70 246 11 ,,_,.,�°fl�°,__,.9_ �eak��loui�F�etor,'" �,�0�58� ;0 58 �-.Q58°'.. ;On73 073 u,�073`�.w..4.69.-••5=`�0:69�,' ..wQa.69,.::�0'94,-w,� 94 0 .,,m,..sw• trie�.i,a'a.,,'a�«."4.;�- ,..sr'.� �:s�:-,...—• "'s?4:,`.,.,_ �.-' a.....,,.;,:�:,.w.M,.muL�K^n�-'e 'fires, ,. � �F�..�na::i.':zC�::`m.�:w-�.,,. Hourly flow rate(veh/h) 10 10 10 0 8 55 9 162 9 74 262 12 ty,;e _,_- - ",. *:�5»..„, ,#,,' :,-:',`•'.' .;.":ry,m ems:-s-rtz'y�'T:arirti";:•�:&?x". -:.:?r?'�„'f,, _,r�S:;�`;-,as t`F, ':Sx?i t?irect...n,'i:a r e�t.'� '� �irB i,- �1N.B p1,��-`g;i., �z:SB:1, `�;�--v , ,� �� z:.«,:'. ,�.,.,�� y�.., .,� ,.�,P. .:� S1_.z �'.;cr.;;�, ... X„ . _.„.. '� .. _ p'srv:-::<�,°�.,-;ems._ , .,. . ....,.,x":�'s-. r. f-�>.,..-.�,.�.�, :�'�..._,<�, .,s.: , Volume Total(vph) 31 63 180 348 .�-.,.�,..,. .r:r;r: ,-•t,>a,:y,a,,,�x�:,..• ;;yyv�.w.a.,,:, •ar,+r;_,°.r. .,xtst�s- - ,r•n+TMz'Sucr'• ..>r.,�':r:.r�:.':-ta- ,ss,. Volume Right(vph) 10� 55 9 12 :.... .h ,./71nLdv`<1;F... gRIr=,.-.., A'7:a..�.:.,�':cF'i: . .,�..,n:. ,.:,sl::H±;�,'.,:�,.L_,.i;a',k',u'vzauv'��:au� Tm,v7-7- 2Ki«+��;.'..... 7,°a_,,.,-,a::`:.�° ;...,,.:,-, Departure Headway(s) 5.2 4.6 4.5 4.4 " '.YX.r n..;v-•+v�,... aY�n - .m�£tr�a'KrdY=k.:�•�:'*?C^;':" wF:f;"fi.1 v7{x'«u `e ee.:'tJt� zat o =<x.� c•:; .0. �"0:08�r��023 0:4 ,t''":;;- :,. �.�f��: e»h�..s. ...............a....w. „_ .... m_r,�L'.'.aroaF.':::v+.'.¢u'a`:�..wrG,...._._..Z,."�:-,.,.,•..,,......x.;.,..-.,...a..2.._.,&.»�+�,.:w;`',�n.,..>:...cie.�,;».9".::,wa`..w'.x,:aY.,aaS Y �.d-nau ru...:,v�u...:....::...»,L. - �.. ,v>r.«..,�,s„' .s._Y,a' „ `Jm;.&:+a.r:3t' i• ,.....'".:...�..c� ...,t:•, ,,. Capacity(veh/h) 623�. 706 770 801 o'trot 85. w8"0 8:8, .�,•,. s.,�::�,:�a w3:�:t,:.�k":,"':,x;¢v..u�..ss2.�3°.,-:..mow:.,." '":'n•� �"� ...,»«.....», r.-L„',.:::.ti;:,,�.3f.'fi:'�;«, .�f&.',=a,.e�� ,.s.,.,:,.m.z ,,, Approach Delay(s) 8.5 8.0 8.8 10.5 r,..y,.....�.,,,^n.,«..+rj.,,.^'^'vW .,«%ra•,-y...,,'ar*,eJ.,.-.g„ �«<.......--„-;,.-..x,,:•-::.:*,....... S_Y"',F»;A'„' _,4^x" - `.'S ..,.t'p:,..�..:...._..,.�,._,,..°.,..:..:�:.i.:c�;;��.t.c,�-�.-:;tts.�,,�.,»a»:.,..»rw.,-=..._.v :-.,__�..,. .•.•.......a,,,...,;::2Ya::...,.'.::�x ...a9;�Yr�.''�:��:s'.c,�,=...z;,;>:5...�.,,�....,....>ss:a.:.:a:+.�;,:r::.,.�..:,��rw'..,�;.:.i„�:�;�.,s.S ,:C"ca - ..,aye.. � w•attT F ,'L":, !nt rSeGt�On�:SU a' �...,x-.: ':..,z.,.: n:. ,x�:�. ... •. ':.,,°'m;..t, .F• �.. .. ., '.,�{ a 9.HCM Level of Service A i °,..°..fr•.:.-..:-_....-v:....:....<r..,,....._✓.�.,.._�».....,„v,�,_.:.y..l.,..n..._ .ut"yr^P°�;':4'.'.r.. ...�, +.d"'. )ntersec ionrCa acit Ufi ization. :44' „ • • • • Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 2 HDRENGLVL7-FF51 2: Lake Washington Blvd & Ripley Lane 2005 Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak —o. 4— k \•.• 73tielotALiogi,-,niegVet,,.::47-737ET3L7- BT&nvvEli-Aliv,BR-oitsiiwsellw.ciu-r4gro.7.0,17,swIt-taz.ww,74373.7n _ Lane Configurations lgditqoEtfih15.,D,I,ITEEEEEP-aEPPPT9Yafg6M§tjztMTV,FD:§00-' a75-31a7Mxo7,*w- 57-'-43'-FAF9 Storage Length(ft) 200 0 0 0 Pl§.4gigarlACIA:77;...z.:71144r 44-ktIfiragEiTe. 1577FOTAW/E1PITAPIY.Fr' 47‘2;77M77717;4/ 5-7r/VH/„.."-P" Turning Speed(mph) 15 9 15 9 '74641-11ir agaire',1'A O.' .3g9TYMIVOINV-476:3Wif0114F,Zirebnrforror-,dzip.75,7,51,-FurAmipzvaRcnwgtvirex747,--.74,7171, . J vi4 Frt 0.979 0.973 FitTP176fibte'r,M,4-TAIMW§g67.211'w-77r- itMa:T.ZW,T(Irgyffl,,ivi.fm. ,-;=e71.-rir.`"MPATERf772 -7;m:75,977,17-i- ,.0737.7,n7FgR Satd. Flow(prot) 1770 1863 1824 0 1545 0 -t-tepro.r.-71,-37,4wirq towq..11.0 "-" 1414: Satd. Flow(perm) 1770 1863 1824 0 1545 0 Efeng0/4:ffeta;t377-AMME1700, 73:0677-talT7--RfaTigigaYiliW75.7.247-FTWP27,76;UWte-74, ZWIANA Link Speed(mph) 25 25 25 ,,,ETIF:ffilreaRtFEMISMINEM615-7LVA-341122nEgg:WROT2:2;74:KairPWZIEFEFPTFTWZO Travel Time(s) 36.0 7.9 36.0 iggl.::qfafM;7ZFFNZY.,BiCF2rqM9Z'ZAKFW5Vj,U,LY6.TF:4Z2:r737:fREMEWZ:XTMSM.F,q;g, Peak Hour Factor 0.84 0.84 0.96 0.96 0.68 0.68 ligarAibrarektigNiF5:4,7g64.13,37.igek:72Ar:figag.W.T6°2921;k3W,gERNEMYZIT.ITOPk';'n,M3171M3 Adj. Flow(vph) 14 189 314 59 53 13 QTE4jd:T89r:'F'B70Ib'a-6-67;3?;;N:CW:afaEW,M'j:'iaV2'grj:',T;A;Z-1AF.",77,2. Sign Control Free Free Stop frfaVrtearSiWaWVg'teff.;T'k4gt':,.'ZV'';17t:'tW'5.7'F;Diilr:,WZT47Air'ggi',r' tgf,Falt'Wrg41 Area Type: ' Other glr51V6TSI-P.RWlkf.raVkV::aIWA-RCMI:fat:ES:3LZgig'WEZLTg'ga',:fKEVTFY:CP'235VZZigirvPT Intersection Capacity Utilization 32.2% ICU Level of Service A I ) Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 3 HDRENGLVL7-FF51 � / J 2: Lake Washington Blvd & Ripley Lana 200 Action Barbee Mill Property#11735-OU1-OO2 Timing Plan: PMPeak 4 .� Peak Hour Factor 0.84 ��4- ` Pedestrians � Walking Right turn flare(veh) 51131 CA Median storage veh) dN capacity(voh/h) 1180 402 671 .� � Volume Total 14 189 373 06 ' Volume Right OWO � | _~--___n*Z---, Intersection Capacity Utilization 32.2% ICU Level oi Service A - � ` ^ � — ' — ' ` � Y:\ruenauxyarbeoM0 .vye Gynohm5Report 8/27/2002 BVL Page ' HDRENGLVL7-FF51 3: Lake Washington Blvd & |'405SBOfhamp 2005AcUon . Barbee Mill Property#11735-OO1'O02 Timing Plan: PMPeak 4 _/ pW 1 Wu/ Rmu 0 9 INK, mp�rm�m`�uBR Lane Configurations + Lane UbiFactor 1.00 1.00 1I0 1.00 1.00 1.00 1.00 1l0 1.00 1/0 1.00 1%0Fit Protected 0.950 0.954 ( ! / Fit Permitted - 0.9500.954Right Turn on Red Yes Yes Yes Yes __ . / HeadwayVolume | ' ! � Turn Type Prot Perm Perm | � | Permitted Phases 0 O /vm/ / ! | PRT, _ Lead/Lag / wtRoUu 0.49 0.51 0.18 0.54 0.43 � ' pp f"tbis678"Cycle Length:80 x,w�"""' / Of Natural Cycle:45 | ^ ' Maximum mt Ratio:O.54 | ~ -- ~~~�~~~^- -^�~~--�----- ------- | .Intersection Capacity Utilization_-4- -- --- - Servic e A Splits and Phases: 8: Lake Washington Blvd&1-4O5GBOff ramp i —�o4 .3 - �=�0 06 �� !. _ | �0P �oy0 Synchm5Repo� 8�7/2OO2 ' '--------- --`-------'- ��-- BVL Page � HDRENGLVL7FF51 4: NE 44th St & Lake Washington Blvd 2005 Action Barbee Mill Property#11735-001-002 Timing Plan: PM Peak 1,.-- 4- 4,.. 4\ t t \°' / 4/ aiief0-35:613EST•"::-Ti..FIRF:ZTERLEceEIP-.;'!.51:TE-riRTZWBV.FA-BrIliTVErif;',N,B177,aNBIXTNITR7A-SBEZATS-BM-4'Zgal Lane Configurations ) I+ '11 t r 4. 4. INwr,o-§:, FryT?'hiczmwo'ooqa,?fTo:9s.i,ztifg.66NN:qqq'B'I/ifgqCgi.ggtMDPPT.AfggPEgqqn5.:,9o3PVDT991.aTSgq,0 Storage Length(ft) 200 ' 0 0 0 0 0 0 0 :8174-471-46477770CMFleTrilgaRrag.!,ZOMPTIza-EF:gry'3•kr.O.F2EPSYM±:-'3•012F, 7:67a;102;;;Vinfigi:743): Total Lost Time(s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 Vitr.11110,1g0Irtgfa.14FERVIOPiatgitaNags.KNZ..sV4I0.5-M1,7§70,:;:igaMiPtiar§.31271if,74.i-A Lane Util. Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 're:Y.S.-7.47,F!,!•°3: :-N;•••;WiT1^17,1,7,.z.'n'741-?1,7-.7T-rOjyrb647. 17:72g74:i1;,27.-i•:;7A,Agz:-?. pgrity.,,6kb•• ,:-,.'17.:=7,,,,,-7h-,,T6-!,T,A.T.iverg,TrAv,rAtz.m,777..prty,-65:r..7,•,'..:•:72•?7,11 ,:et,:x4-.. -ar.I.,,,,:4..:-...,,,,,:-.„:, -,,,a,(:•;I: L.....4.,..s.. ..,,,:taf. :-..,,,:,..•?......,a.,,,e,- ,--,--....&,. .::::, -,:z1.,•,,,,-.,.: : ,'AL..,....,..,..,r;z_51,,s.,,z • Flt Protected 0.950 0.950 0.999 0.992 gOKTF10.-Ciiifiiri'5,775FiltiZ,107. .71-1:976 ."7.-1)73.1POSH.T.OPTEI5PFA5-672MOTZFAT)STAPra.-@. :7;Rlil Fit Permitted 0.950 0.950 0.999 0.992 8-4ial•ProVrikiiiii271 ;:f1;IV:'1;f7T0117-1T779-6371•ZSAWriViriO7, 1.-8077.7;176"8-3Ix•Wz•767FR9-7-6•07KT.-.7-'7677.777,70- T6-657.A77(i ,..,-...,..,-::.“-,.....t.,4,-,.........,..: .--1'..,.. i.:, ,I.S:.:...,,,.....,-,';‘,-,'-',-',,,,,,,,,,...1a1-,V,:,... • ""'-- :.4...44t,•...V. ; - ',..'"al`2Z...:Lift :2k.i...1;.V.;.:. .,V,..5,;'!"-%,1,,,,,..... Right Turn on Red Yes Yes Yes Yes , 0i€10.7gc:),-E.07T6,111./FX:2NT$V2PT•fr*V4MERFT.E. •:',7,F,:gst•LE5a.qa:';');M:,7T14.$711.77F:q714.7Fg.POSTRFErd Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 .cafiK-gliqkaI'FiiK-EE;F7U-Fr•ZF:TfKIT.:T.ffETZ:N.'.73:fatP-;7. ::::77.072Z:236-7:1a57.;;Zit-P-f-717.77LT:01.T,f7:57.al Link Distance(ft) 572. 1320 1320 1319 ITFigtnrr-14:gPFEEE7271SZED676 117X:".-.57a31:!Id0i:.,?:.,..4Z-T;'.I7f2P7Cfa-:i7,0:-,0:072517°,„7-5,IpTZT:gti-._27.74.2 Volume(vph) 69 212 66 69 132 32 12 245 '170 48 27 208 .11414S55:1Friali.Srq.:405•WFOT887A-70:8T7.1:00.7nag71:43:07P;;;:ff.0141:7!7(t0:.{MKS.071761.67050-6:7ff-176:627:r•--:0 ? Adj. Flow(vph) . 78 241 75 84 161 39 14 278 193 59 33 - 254 ilalle7,0.40:1?.'1RE-42.iitlETANRIZCZ1401:767:1 60V8:4-277,.1761:::',Z24C:051:03,0146:$37-72,:ZETFli7972g§,i1V.D5fig Turn Type Prot • Prot pm+ov _Split _ ... • Split 116,t6.004:14tr4WeaT2A7144ii•- :T,4:5::;iAir-Mi:51.0.-D1F•fli..T.:81 -27.g:PfaZg;. ---2,,,LELF5•1-2.76.-P72:1-07ra-23 Permitted Phases 8 06,1014CP,1311tTAV.CVikatig..:0-7APTIO.-MKkE.S1la:rai49:477-',12.::$.,IIIKV-?:cg.:3:7ZP. 17:',70,iir6'fAri.11:5,i2:1',32 Total Split(s) 11.0 20.0 , 0.0 11.0 20.0 19.0 30.0 30.0 0.0 19.0 19.0 0.0 2438°/.. ,N1-4179311TErkii OP:icaZi.-7gligirci:VID.TO2W.V.Z,ZWISX-'3 ,...:5AA-ifj;,. `W,.‘',Vf;.0::ETgc.i,:-I-at.97:7;0..i l'gaciLliitiqn-afgaiMi Yellow Time(s) 4.0 4.0 4.0 4.0 4.0 4.0 4.0 4.0 4.0 Lead/Lag.., Lag Lead Lag Lead gr,641SaV.;q15fkli .7-iY- --:t'T?:Z7X:423:11Y,45 .YEZ21;g06731:1Y:07 7.0-5;7:?..Sii2235,772,T2F: 7.i37.3.217AFE27-773 Act Effct Green(s) 6.0 15.0 6.0 15.0 34.0 • 25.0 14.0 ''kfggfq.atjg,05'71-''F::-;?;:Z7OT.(.gf'F-;qj?f6.L547K:ZFO:A8-';'T,.0rl•97.-'TC:64TOMK."':•Fi•7',F7,6;.:0:-' f1:7,7:;;;;EFHEI.7,,T;i75-Z,71157i-87;27.L.E4 v/c Ratio 0.59 0.90 • 0.63 0.46 0.06 0.84 • 0.83 - • Phffiriti7Dilayri'd,11. 172Eg6W-510751E;W;F:35r6:71.T.'2T37§ 6707-i3;:,,U5.7F270:41-27:57,Z0Z7iNFEIPTOPT•72 Delay 34.2 36.8 46.4 29.5 4.9 29.9 _ 27.0 f-,-N-d.-,t,f7-,;,,Ta.r7.=:;:•.,r,wn.t,.5-,,:a7,74-,-.r,r:d.-?,,T,77-:[5-Fz.,,,.7”,zi,-,E,wz,IEF.,:rp:7-6.-.,,, ,,:•,p...7A7'7'!-:,;•.7;r,'.YF5,-Fig7Y,,!',••d7g'!';;:::T:;;'.7fml,;:'e::',o;:;,.-77,.-,.:!,77-i,T-4.7z,F...•Tc<,.7.1 ,i,...Y.. ,...,:...,:::.g....,.,:,. .:ii.v.v.,•%,...'afs':.,.,-.--,.. ...,..43...t....',...±L-1.,:,,,,zi-4,,-,,.:,:i-- ..,....1. 13:m.....,.i... ..,•4i;,.t:.,. ,-..:;‘. .....,;:z1.c..,Q;s...k.,,..;,..'3,--3,.....-... ..ca...:1,- /,,..:-.:--! ;-.,',::,,,y... .,.:szL.. Approach Delay 36.3 31.1 29.9 • 27.0 KI?licii•:6i'6h7g0.,STFCE:f7=7:74:: :7;:'-'7F7.:F17:D.7,:f“,rgf•;;;F„,„427,p7,5.7:7,,\??:r.;:61-5K7f,.7-,2;',7).!OKE„E.1.76P,E,,v*I;s•:•;1715-,;;TPfj5-6:::',70,";.-.1 ffit'efieetkir'-"T-SiliTiTia•Wjt,44';;914MtV,f,U. 21,-.7,"•;--,,,i, .',..:4•„!;.,• :,,:,=:,•,..„ IM,7:;•77:35,17..-773,1M7:-,.-V•-,047,77,,,77:::, -,itgria, :•„-;; :gAt4i9 '8ft0.4ITS1134.46:22Z42410igiLifig:Mgegigae.'Ifiegt.:',LI•ifigitki:COLttiN:•Zat:NEMV:VEigicg:PaRiaii5-:`&22 Cycle Length:80 bffiqg41654F-Ffe-rer:6116601(0.1:Oggliiknifif.$14.47offgfelealrCii:R-.x.eZa7/MAiniEfi-DEZ-KSZY747,711PRa ..... Natural Cycle:75,,„ ,, . , . _.• , , . , __. „ . 06i,ifiorTypiepf'4,tirriger:4,:';:Vgri':-Ar4-•°!-PAP,;-,Y0:,;.-:,4a.,5 •!.,•, ,c---.,-.7-q'','VY:i FtW.,-;,';?-1I,F.,,,"-Ili;',7ii:.7-'-n` ,7',',1`.,*.z.-.9 ,t,,,-,La...,& ,,,,, 4,I.,,,Ire.L'4;,!ii.V.,i,t4-14:, Maximum v/c Ratio:0.90 ifatigardyi7816ifarbggyr8fil•rqiinz,',47104, 7-Ctriln.1?..';'7..W.Aiiigi'ggoirdh`-:C(5•8';',Teirr.ce-34.-7M7-,,,--74: 7•Xr.q47fr.F3.57?gZ-.1".-iW'if7.7447;;;-3..,..:TY...7. ----.....-,.......... ......,...,-.,......,L,...„..,a-,.4.‘,:,-.0,-;.,,,,:-.,,,,,...0•3.-.....,.---i. ......4.);?,,y4,,*,,J....t.,,,,...,,,..,-...,„......... ....,......,-,..,-,?,--;;,,, ;,..a,r.ar,lf.,:,..silv,•,:_--,:v... .,,,,,,,z,.,,E.;,,A Intersection Capacity Utilization 86.4% ICU Level of Service D Splits and Phases: 4: NE 44th St&Lake Washington Blvd ..., lill 02 $ 06 -II" 04 'I 03 9C4T-4401, 47-44f4W-44API•;•••,.419,,IMIC4-4-AVV.-'.--11120,i0,11k5444V1014-:-',1111.10i7491 -,* 08 _, 07 20i71104c4kWeigiVi•-:-- V Pim':---..-1 Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 6 HDRENGLVL7-FF51 5: Lake Washington Blvd & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak _ 4" �. \ ""�':i:`r_.,^, �zsias`;as'•a�' "— y tgiA4ir,«^;ya;"':':a;;';..s '..-". 'per '.z,_.t e,li" kWg an�"°;Giii�ti � •-, "> ,�, E8 BTW,BT��;WBR �-:.SBL�"� §. s .�,M �: �= e' p^��x��.d��r��.-,� ,r:�_ .�,x�4SBR.:...� �..,... r� � -� =m-a�'� �; = ,r�. Lane Configurations a V -•nx�•,^.,. -„,.r..„, °'=gt.r""a..�': .:;!,�,r,-7';m Y,eR V«-:Fi`�!a': 'r,',-. '---^wr,, f;'- ':'—' ''n 'F L.. Ate"", x-c�.T' � :,;.,..m ,.....r,4v:^R�-?F..•si a-:. v ' � 'P. 'C _..�,- `n F^ "'v .�` t'»` .,a`.y fir,.. r`de IFiowff'y .i I\\ • ,:.. n,1.900= 900.=. 1900 ::1'9.00. :ei'900 i900 v ,r".�',•s > � ' ;.:'.;• 3. t:?,- ,:,w ..::�...,..a _1...�-/�u`��sz .»�- ,..R.� ,.u*.�w;J:�;ct.�u,._,....y:.�'krn..,.....��,.,-. ,c..#f•.�...r�..i�u.._�-h.`i'i:.tc':� ':��:as�,,....+✓c,Qt�..c.urrorti:..'�.:z.�,.,...1'.�.;.Lc''1.tr u::...f.3+' Turning Speed(mph) 15 9 15 9 ,. ,- ;,, ;. "Y: �'ti':;f ,i`` .sm d r°, `;r^.",« ....�.,d4>< .:xyzyq<-,..tfi��. ;;,°r,,,; ,�.t;...,,;':' ;-.}".;�"a�:::, .,N.,,•: --- L:'F t'r y . 'y, u f ':1.00;�.„,'.: 9 =%<1:U0,• "1:00F, =a 0. A:' -" .,:,},,. .,,.k:..'Lan�GU..,.�,�Coe �� ..u:Y°_fit -;:_�.. � �,,0 00.�`�,._ ,.-� .t�� •;;�. ... c,.+.:. ' w,aS;.wx�•_, ....w:...s�;ka�s'ws....,.,!�+:?t«.- ..;rti;;2J,,.t,,,..... ;,ua:,:;.:.w,n.ct ,,.,�.ws�«.a...,-YeG:".w„��`',., '."e�.F..rx."e'sG'•,-::`.':e'iu3':f.�:� Frt 0.996 0.973 ,fir � 7--.• w' ;."' ,�""q'-,.tyw,�., "?;- S� �.-;`" � „ •k``�. .t'��3-. .;is`. _ %�AC14 ;rb.,':.:.:.L�Y•.:r. •• "�tw'�� .. �,�vss.. rs$:�,:F:4Y,.eii�.,:w.ri,�:Y.a::..,.:,:v.�`�'"-�F�vxv:�'S..t.:y;Sid:;"�'»sr. `:»•tiar»Y�,..�-�:a�w�*�,r''.�`�,..»'`^'...::;s�tdc Satd. Flow(prot) 0 1863 1855 0 1744 0 WeAl`"' 'i.x�,.'7,. . �yLM„C>:; .:;F_. »»fir yY�'� -'-^'9=*:rivrsrSp,r:Yx¢°, vvv¢t°a:^"=3>. s-w;.v`� <;;i' "':; •,?. :.,, ,-7514 ;47 :Y'.pj£-.•Yvi.r=$,�-,' 3 }).a .'..� �:£"sk.,: - I S/� " ':'" :.ii may �'' y � lLGM I, k+f•r.'.2..;..r ` 3.(�,.� 6truF.a��a-� ..:.aid��..:a:Sl.•f,•+�s��;aa`v,;.•W" n�°a;:.::»:i..•w�.�:'a` :wr-:�::,...il..s...��i. '.r ";.:3.a.;^.:.�'�-�>»,.a..;T,za£is:ac.::.,:�.G:y�'=.-,:x.�s?±�,..�. '7...'Itru..sa�'ua.s��i Satd. Flow(perm) 0 1863 1855 0 1744 0 ."'""ei F;" "f` i:.'^�fr,;"..,... - -..,,_:?t'' a,.;F�':^,:vcae^ ,zµ•$`'.:.f v,�," z •*n" s�:�r r •-.s?. ,css-e,-�+.:�:,-� .-,.m*m,..«,..s+,. •..xr.r.;.�:^�r-^. •—fir.-?>. -ra.: rxrx" :�� ead a.'<<�'ae"£ar '�f�=•' �'- ?F,� � 0°.,;�,� 0'^:m��f:00� -,.1:00"aF;S';1:00:,�:n�.:,�., �.; .�;. _.�,:,.. w:.�u>,....... '�iS�.,u...�«..nala:Y>.r:� ,.' ,i.r:;:..�..ax.e..77.:,bS:...•ti"a -�,'zw�v„�Sx.. :�tw.�,..-.»,. c.�s,.:,... ,-. »:E'E:a.Y�',c f:C,;:ri°a�fr''1-z",�a•m..a�.u3:F.ta'� e`k�w'' '�� Link Speed(mph) 25 25 25 '•Le.-es-' .��-. *'4p-,,,.+, ,�P4: -' ;? r'a.t, w. - ,g f ' .,.:*`•'z:y ..t ,aetaJiC^a, ..r.....-.-rrk :,fig-.. fiR.s- .`�^�,'�` s; .!fit.;=` `"` ..�.+ icta:t^;.:r"•.;!";,5=y. '>7 ;<, ;ti °°'$15` ems 1322 `.; -ia::.�kv' fw;'ttr3.S•...,m:$':s,..�:w+.aa„i.^�3:c` `:� ...,.tra.�r..�.'„d. au,:- Travel Time(s) 21.1 16.8 36.1 •z��, ram•;:�; -�•'�"'�'ry`^ v *--h.,�y ,� _'_,�•-s=.�;# '•••°� '#:.� '+'�.:id'r�^}:',,,?i�°,�r;*`*'•".sC?:?2wr--�".'9�'�^_�•'•"sr ,:�'�-^^:M^�"�F.'N "�'Xrt't`�.t?'M•�:i�'•:*"F'.' �;,, =fit f 0 U�rt2� � �. .zw 1;�,: l"62: �, �3f0;, 'f��8a4.-s • m4r,. �r..t �1 �. ,. .-,<..: ,fir.._ ,?fir <;... .�w ,.r. '� i .r„ � :1zsL��i-sr.,,:..�;r..,,,;u� ,:, ,:::�:�'i,: -.::s« 't.�:i��r..��.,•,-.�,:�:�..rv::� �:'L.,;;.�fi'c.:.��;.ct�r.Y��".::Y,.s;3:::-.a:S�.w�'avd,....,�..e.> .:;r,:.. _�t.:�t:ar`;�a; Peak Hour Factor 0.92 0.92 0.92 0.92 0.92 0.92 m::�: '' ";'�iii'1"•P'"z i+e.�^."?cA ,• ";T", ,-...„zr•.- -;`TiS.."j—` .,,,.. ,ro.,.�,,..,,:r ;•x, ..,: ^""G;,r r.'VC^^^;'y;^'a..r�-.yyrrgrr �y :,,MV04?,;r' *.. n1-', f _c- .+„'. i+r a ",'S c x, 1 >.5' ,s 4 ~r "�..z 7 5ca 4 r •'' • k','„ {'i 1' Aid.;Fiov+r( h wWuw„ 'a �i r;4J6�.,,^. .337z, �9,= 4 „ 1 r ;'-: : a.F�r,' fz wG.:• .,,.s,�:,.., .+ '�% :'�z�. ._ ...«wS.�. +. , .��ffi° r_ „v. '.',��i..1«s_#.w -,. �'f.4fi, '�'.f�.: E,.... .;,�a.�,.,,..,...»,...�' a?`"-��_... Lane Group Flow(vph) 0 177 346 0 5 0 z"- 6'°?rt' Ftc. �,• - '*K%•;:.ems ",,-n.��.,R.p.�;... :',r.- •-� ';•..^nz.T-. ?»;,:•:t24.,. =r n',d•Ty,,,,f,� ae IS --y., <. +..gym r N, ....�Si fi;:.:.- ::4 t 'L [.7�'»r>>Wit` Si"ri�;�antrol:` M,�: :�� Sto' ;Sto'" :Sto .=:� �; �:�' . .,.� >..,9�,-��.,.^.�. .��..�::.:��:��..,� � :�,..w.:."u-.:P��t...�....P�< ..��.a' P:k �.,..... k` • �1 �� n �:;��_.�...,,,.. �. nerseeCt b q,S mm RO Flag r t 'Ir 70:3—': rr S "5raf a M,�•„�,; ;7*. , � .r:M-n w..,74":""'�.=«'x":.1:.a.^s•a� i • "-ys •:F?-� �-k" _ .rse1-»�� `{Tii� �,F?S�-�'y;''.3T.i: }�%.2 i.�..`r:-• ..4^.,'S's'xw AC :a'T"'��.�.. r��. :,Other,. :�.r .';;:�;•',:��_` r:,;= ..::,.,a.�.,>« ,L; _ _ •,��<yp,.,.�.� =. �..�.�: �, � :; _,..F.�...�;�:��:�..�-:_..,;�: �...:,.,,�„�.:�,�.�...,.��rz•�.�....-,�.�. :� Control Type: Unsignalized ersecedt ,'c°r at tioCapacityU.1trzation299:10:. vW .z_ r: 1C.17LeJel'�;of,Senice . ,< s �5 . : -.: - r.'.: • ; _;,� f;: 'v :. Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 7 HDRENGLVL7-FF51 5: Lake Washington Blvd & Proposed Driveway 2005 Action Barbee Mill Property#1 1 735-001-002 Timing Plan: PM Peak J _ k- drove ent��:�. w�y�:�-,�:�EBL .fBT._�•..W,BT�'`�tfVB "SBL�,,�-, B. � �t�r=.�a �Y+. rIl ;� 's£rif",:.�s s::, �:- 1�: .�_.w->..>..,�.�_:• . :. " ;.... e:?:r:;�-, :�t:..';��;..._ Lane Configurations �. I +yi7va - :.x..:a�� !,C":y4e}t:x _ ..,fM^' x k• 'a.�Y,', 7w.•etvs..+J°^, tY"•r'n...+a.> '-ysiSsF, ';�.,+,.�:;;',• i`C';;Y4;. ,',"�;�;?��" ;",^Gi.R` , f 1 ^ J` ;`d �9 ,,r^,. ,i Y•:w'r .h."1•.ik 'r'e.. '4. ;rv,., sf F,,:,Vf:<c A:-., S�••tn.C_iifroi. :;�, y�' ..Stott �+'�•01� .,�r"".,�.�,-:�Sto t.. �. � >,..>.,t,. ,s, �:�.�;%•;: ...�, e...:g., ksx,.x,.s°:�+i..��.'`F.`_•i;.�:..�vtc9�`v``,r::..+ta " :'"ti.'HSa4)'M�.,. >C.s�f:�.."%,`•"'-.k.r.:.'�`-.,.�;�xc'R:.>+t•..>y...,w ll�ur,+.r« ..., ,..'-•'ti•,x`^""'a`»� ..�..c ud.it,:^"::.s�.317...�.....t.sd2:�1`1+{s2e�zrci..:,:�:s£;att.'.�st.-,..+ Volume(veh/h) 1 162 310 8 4 1 ^«'C,:'^S.^-a.t,,,n.• •„rr "�?"'Tg,;•' 3.. .S{k;'j"" p«.a»,.• .•r.roi,;+a?'Y': q,: v--+,,,,� „7.,iTMN y.!.x,..�T:xvn.^a P h.i4 rn",zr _<t,.n�.m •i?+ .. „.. ; .••2 V" „ ;"r, 7- ":F'M-;;. r;..> x,,-«•.y. y.iy:at�"�".';.{tr.:. ,'' -; .,e.,-:.<7-4.a, Peak,'i�ou�aFaefoz�=:' h"_� �.,0�2� ��92,��092 > U:92 � 0'92, � 0:92.� � , .c g�,° ..� -- '.aa..�,W...� 1::+....'W:. r.,;rA`�sa.,r.,._..xatva•aa- d �` vt75"�*t7x"a",.4.:»•...�:i S::�G '�5r•:��dx.`�i. '33; Hourly flow rate(veh/h) 1 176 337 9 4 1 "`"i w.t ,`sa.F - "t .v.' :Ya:». ,.t;.7:"• -'7 "�^r rt e',w;: .:aa :4. nz:.. .z "?",r..„-'�. '%e:;`e':�,•,et:u'�'t:n +" �irection�ne:.#.- "' .�:�Yq�.�•„EB:1 'W:6..1...� =.SBx ., „. :;�:�'.,�. � �'��.�,-'-'. ., ,.�:;��• Volume Total(vph) 177 346 5 -z;ter, .>--�;'�°"-" R*-t'��xv�"5�--m. � arr_z'r�`,�* x>°� .x�*.:ar ..rzpt,,�. ..�3(h' -^ -t'�• �,-�+tir;�;r�; Volume Ceft yp�i }= ,? tiry�? f i.:; •. ij.+VWSba CO: : >.n, : �_ ...j.x.. • ,..;`��'. :�. ,:: xt..a�.i,13w•m+Ft:st,�.'�rcr,^.�."c>;,' � :wits:,-k_.uc&.,,... ;".�'.G,`......,-y7„3:2,:..tx..V,s,^.ait{3 Volume Right(vph) 0 9 1 . m 'ri""u:ac'..':'.�r'..:�7"t" �..^-^r -=";t;� ..?3: i, e'K ✓'"T` ,r� 'r�`k�." '�""yy'r�""' ;"4 �v�I...a..:z ?`s-ss":u:...,,.>,a..czr.'.u'.+'#e»...e.....xaP�.`3`.�,...�«;w�.�,�w£,,:d.�+s�� x.°i9)i.'1,tr.«.�:l.ar„GS..za ,, ,�� e.�F•c�•G.::"� -�>�'.•'xe.Y�:�t,..�-v��:+c,.�,.a..:�.r..:5,..,s::x:..,. Departure Headway(s) 4.3 4.1 5.0 .","*s,�."r-•-..;'s+�^rc.�,..+sy+�c•,.^n.^.y„ ""_"'y3x: :.f�,>..-., xay.-,�--.,,.y.�{w .':d,:'j'�`;#�;�f`.: \Y^'=+�'L^;e;.-:"'�;4',� _�,�5;.?V�.....,si�'*agY-'�'Y'�;'�'.'.*-u;"y�j'.�.,�xy:.,,-: ;,•r •,•^`p{,r••;?Y begreeXUt�lr�ation;-x�; :��k:��0:21 0�39_ �:-0a;-.01 `, � ��r' �„�:�fhz�.:i=.:.+,_.�='�.`, ,.,,,,� �:•.-,- _= .:.� r (:;'' x, ,�7.s:tea:a�,::.ii�>",S_ .c, .c..?,l:tt".r :�i'+,. :3'�..-m�3�•;�v:'a.«a.> tu; u•• a,.±�,f.:,�`ea:.'=�y..,..xr�`.4e:.�,s...:l Capacity(veh/h) 830 861 652 ry „--7n g7T :,i 7—: r",""Rl°'.3. ,..ar, ,t,.. _ ,§7, 7-M.375'°4"`.e"'�"wrt"...':r^ _..,-s,,,,. YL,,,,.xw•c°-»», +, Gonirol Dena `. . 8,4 9 7 8 :i ... ,n. z.;...,, r • •..:'�,vi?;i�`�7� �!,bay:au#�.._,...».u'�.sSt,3,u:5.:7.-,4t•.vi«;�.'::a:'�CSw;�\.c+,� .Lt's. .c.�-t ,.a2:'w_!!;k'+:Si£.:W..i.�,4;e..vw;.v.«,..�.».n....au,.N-.,,.nr.,""r,..s.,4��a1d Approach.Delay(s) 8.4 9.7 8.1 r.r^r^.w., ,.. ... ..,,??.'r"""`^`"' _,_»,.,w. �.>�.•,r•. - ^p'-;resr°; - ..,"7'r?."tSrP.•.,• »n••;,;;?`ar.-r^ w;�^t<,.P*+-.M.,.h..� w.� 'ti.s:�.�...�..+.,�..,U>.�.,.a.^�.cw..t}..,..,.�..,.,.,...,�',�, ^b�'s::..,.,;.;;,n,a:a.iscirx,.,..,s;��w:-�a4:.£.:T•z.:-:�.:w lntefre.. >....�..a...,._a is A�.&+:Q.• ,>g4 u,-.- - - - :.,4$ Y' 7.,.'. :t: =7;r ' 3, ;: %.:44i'' '�„�: `seetlon,Summary:�a �:_:��r�-��•�� . , , _. . d,'�� >�;�__,,.�_�_;.n� =,-.. �..,b: � • ..,- �r�,,�. u..•_,,..-. �..-...t{.,r-.... _.,.„.^•,.a:u�t�:::�.« 'FWD" �M1,' - i.F_ 4:'F'..,n • �/ s,....2rS .s _..i:z. fit,. ,3•.,w..>: ,.&, 4 - .....].,sa,.......-:.i...... �,n.,..,a•..�+v;+�wncv..;2w2'S.._.it«::,�t s=s ..:.�.sz>... +a,*��;..,;c.�i.:e".xzx..i.�c>".i-z°..._•,,.>'-..'-a-=.:s3,.,�QitL! :rS HCM Level of Service A - ^:->-� ':^.mu..-� fi:; .ut;�',""""` r-x-+�': r -fin-.:;...�•*= Y"M1i's _'r..�3K -a%,e s' - "F'.FS • • nterseotori-Ga'a"ci�'rlltil�zation.v. .n, �-- :=29:9,70., .'�IGU=Level.:of Service;' ,,.->s;'>t•:�:- ��::A-•.�:�-= #=�,_:.;.->'•`::�, �,:..;�:,, I .".«..>......._-.....,., - "G,.,�.»lace,.,....a.,-..,uw„^.,'�'1<,u..,��;.a:�r_-..+,,.b.,.a,...s._I'`.. .......�,,..................a,...,,,.o�,.,..E,._ ...�r£..z,.,.......-.u:..,...�.,.•...zt,.�s..�,,,..,,#.,.�.�.:e»w�_....�n_.�t I Y:\TLienau\Barbee Mill Property\Barbee_2005_Action_PM.sy6 Synchro 5 Report 3/27/2002 BVL Page 8 HDRENGLVL7-FF51 4 s t_LAi OZ- D O Cy) ACROFILMED Technical Information Report Barbee Mill Preliminary Plat King County, Washington Submitted to: Barbee Mill Company 4101 Lake Washington Blvd. N PO Box 359 Renton,WA 98057 Prepared by: Otak, Inc. 620 Kirkland Way Kirkland,WA 98033 Otak Project No. 30209 August 27, 2002 Technical Information Report Barbee Mill Preliminary Plat King County, Washington Submitted to: Barbee Mill Company 4101 Lake Washington Blvd. N PO Box 359 Renton,WA 98057 Prepared by: Otak,Inc. .Ix 620 Kirkland Way NA,TER s Kirkland,WA 98033 to' AA OF WASIY O \$' Otak Project No. 30209 7Ij • A � r,„„, 4Q 3415 A L Z013 August 27, 2002 s 0iv �l LEXPIRES 6/5/0 if J Table of Contents Barbee Mill Preliminary Plat Preliminary Technical Information Report August 27, 2002 Section 1 —Project Overview Section 2 —Preliminary Conditions Summary and Conditions of Approval Section 3 —Offsite Analysis Section 4 —Flow Control and Water Facility Analysis and Design Section 5 —Conveyance System Analysis and Design Section 6 —Special Reports and Studies Section 7 —Other Permits Section 8 —Erosion and Sedimentation Control Analysis and Design Section 9 —Bond Quantity Worksheet, Facility Summaries and Declaration of Covenant Section 10 —Maintenance and Operations Manual Figures: Figure 1—TIR Worksheet Figure 2—Vicinity Map Figure 3—Basins, Subbasins and Site Characteristics Figure 4—Soils Map Appendices: Appendix A— Soils Descriptions Appendix B—May Creek Floodways Appendix C—Water Quality Pond Design Appendix D—On-Site Conveyance Calculations Appendix E—Upstream Basin Bypass Analysis Section 1 — Project Overview This project involves developing a preliminary plat for 22.9 acres on the Barbee Mill waterfront site in Renton,Washington. The site is located between Lake Washington Boulevard N. and the Lake Washington shoreline near the NE 44th Street/I-405 interchange in north Renton. The owner, the Barbee Mill Company,is proposing the development of 115 lots for townhomes on the site. The development of the site will be governed by the Renton Municipal Code and the COR2 zoning which is designated for this property. The project lies within Section 32 in Township 24N, Range 5E, in King County, Washington. See Figure 2—Vicinity Map for the overall project location. Site Drainage Characteristics Refer to Figure 3 —Basins, Subbasins and Site Characteristics for subbasin locations. Drainage water from the developed site will discharge to Lake Washington after treatment in water quality ponds. Conveyance Design Section 5 shows preliminary design calculations for the roadway drainage systems and for a bypass storm drain line from the offsite drainage basin lying between I-405 and the Burlington Northern railroad. This bypass line conveys runoff from North 40th Street to Lake Washington. Soils The site soils in the project area were identified by USDA Soil Conservation Service (SCS) Soil Survey for King County(see Figure 4—Soils Map). The site consists of Norma series soils, identified as a SCS Hydrologic Soil Group D soil. Norma soils are alluvial soils which are underlain by till soils. See Appendix A—Soils Descriptions. The following figures are included in this section: Figure 1—TIR Worksheet Figure 2—Vicinity Map Figure 3 —Basins, Subbasins and Site Characteristics Figure 4—Soils Map Barbee Mill Preliminary Plat 1 otak - H:\project\30200\30209\Tir\pplat071502\text.wpd s > Section 2 — Preliminary Conditions Summary and Conditions of Approval Complete Conditions and Requirements are yet to be established by the City of Renton for the preliminary plat application but some preliminary conditions have been recommended. The development of the site will be governed by the Renton Municipal I Code and the COR2 zoning which is designated for this property. Water Quality Treatment In its preliminary review comments dated April 24, 2002, the City indicated that staff will recommend as a SEPA condition that water quality be provided to this site. However, if other permits are required(HPA, NPDES, etc) and these jurisdictions impose a stricter standard such as 2001 Department of Ecology Stormwater Management Manual for Western Washington [SMMWM], staff recommends that, in the interest of a singular drainage report, the same standard be applied throughout the project. The City recommends that the water quality tracts should be privately owned and maintained. Barbee Mill Preliminary Plat 2 otak H:\project\30200\30209\75r\pplat071502\text.wpd • Section 3 — Offsite Analysis Upstream Analysis A drainage basin located in the neighborhood near North 40th Street between Interstate Highway 405 (I-405) and the Burlington Northern Railroad drains towards the site. Under existing conditions, drainage water is conveyed in a southerly direction along the east side of the railway until the water can flow through a crossing 24-inch diameter concrete pipe to the west side of the railway embankment. It daylights into a surface ditch and then enters a 15-inch diameter drain line which carries the water across the site and discharges to Lake Washington. Under developed conditions, this bypass line is to be redesigned and relocated so that it has capacity to convey runoff from the developed, offsite basin. The line's outfall location remains the same for existing and developed conditions. The City of Renton prepared a drainage report titled Drainage Report for the North 40th Street I Meadow Avenue North Project(SWP-27-2344)revised October 1999. That report estimated the developed 25 year and 100 year flowrates as 15.1 cfs and 18.1 cfs, respectively. See Appendix E for documentation of flowrate computations. Sheet P3_2 shows a proposed bypass drain alignment. A preliminary backwater analysis (see Appendix E)for this alignment shows that a 24-inch diameter drain line will be required to convey the design flows without overtopping the proposed rim elevations. The Lake Washington water surface elevation was assumed to be 19.5 feet. Streets "E" and"F" Streets "E" and"F"connect the residential site to Ripley Lane. Drainage from these streets is collected and conveyed via proposed storm drain lines to the water quality pond WQ1. Downstream Analysis The site outlets into Lake Washington,which has a High Water Mark of approximately 19.1 feet. (Reference: Telecom (206) 296-6640, King County DDES, July 2002). The finished grades of the site have been set accordingly to provide adequate conveyance and prevent flooding. May Creek flows in a southwesterly direction through the site and outlets into Lake Washington. The Flood Insurance Rate Map (FIRM) shows the 100-year flood level ranging from 21 feet (NGVD 1929) at Section A to 23 feet (NGVD 1929) at Section C. See Appendix B and the plan set for delineation of 100-year floodways. May Creek does not appear to be a flooding risk since it is well contained within its banks. There are Barbee Mill Preliminary Plat 3 otak H\proje<t\30200\30209\Tir\pplat071502\text.wpd 1 Section 3 — Offsite Analysis Continued three existing stream crossings that do not obstruct the creek and will be maintained for the future development. The stream buffer, however, will be increased to 50 feet. Barbee Mill Preliminary Plat 4 otak H:\project\30200\30209\Tir\pp)at071502\text wpd Section 4 — Flow Control and Water Quality Facility Analysis and Design Flow Control and Detention Detention ponds are not required for this project because the site qualifies for the Direct Discharge Exemption in the 1998 King County Storm Water Drainage Manual (KCSWDM). The site discharges to Lake Washington, a major receiving water listed on page 1-29, Table 1.2.3.b. Table 4.1 summarizes the Design Basis for this project. Table 4.1 —Basis for Stormwater Design Water Quality Pond Capacity Treatment Design Device Design Criteria Required Provided Standard (cubic feet) (cubic feet) Runoff KCSWDM1 NA Lake 0 0 Control Washington Direct Discharge Exemption Runoff Basic Basic 3 times Runoff Pond No. 1 Pond No. 1 Treatment Wetpond From Mean 48,811 56,902 Annual Storm Pond No. 2 Pond No. 2 9,523 11,026 1 1998 King County Storm Water Drainage Manual 2 Direct Discharge Exemption—Core Requirement No. 3: Flow Control Water Quality KCSWDM Core Requirement No. 8— Water Quality requires that runoff from pollution generating surfaces must be treated. The proposed design includes two water quality ponds to treat runoff before discharging to Lake Washington. The water quality treatment is necessary because more than 5,000 square feet of pollution-generating impervious surface area will be created at the site. The drainage area north of May Creek will drain to water quality pond WQ1. The area includes the residential area consisting of approximately 4.54 impervious acres and 4.92 pervious acres. Areas are summarized in Table 4.2. It also includes Streets "E" and"F" which connect the site to Ripley Lane. These streets have a drainage area of approximately 0.89 impervious acres. Approximately 48,811 cubic feet of wetpond volume is required per the KCSWDM Section 6.4.1. The elevation for the top of sediment storage will be located at 19.0 feet and the design WQ surface elevation will be Barbee Mill Preliminary Plat 5 otak H:\project\30200\30209\Tir\pplat071502\text.wpd • Section 4 — Flow Control and Water Quality Facility Analysis and Design Continued located at 21.0 feet. See Appendix C —Water Quality Pond Design for calculations of water quality volumes. The measured volume for the preliminary WQ1 pond design is approximately 55,900 cubic feet. Table 4.2—Contributing Areas for Water Quality Pond No. 1 Developed Area Land Use Impervious Pervious Total [Acres] [Acres] [Acres] Residential Lots 4.92 4.54 9.47 Water Quality Pond Tracts 0.36 0.99 1.35 Onsite Roadway 2.89 0.00 2.89 Offsite Roadway 0.89 0.00 0.89 Total Area WQ1 9.06 5.53 14.60 The area south of May Creek will drain to a smaller water quality pond WQ2. The area includes residential areas, streets and an access road to Lake Washington Boulevard North for a total drainage area of approximately 2.20 acres, of which 1.87 acres are impervious. Areas are summarized in Table 4.3. The required water quality volume for this drainage area is 9,036 cubic feet as shown in Appendix C. The pond shown on the plan sets has a water quality volume of approximately 11,026 cubic feet when the water quality surface elevation is set at approximately 20.0 feet. Following water quality treatment,water will discharge directly to Lake Washington. Barbee Mill Preliminary Plat 6 otak H:\project\30200\30209\Ti\pplat071502\text.wpd Section 4 — Flow Control and Water Quality Facility Analysis and Design Continued Table 4.3—Contributing Areas for Water Quality Pond No. 2 Developed Area Land Use Impervious Pervious Total [Acres] [Acres] [Acres] Residential Lots 1.07 0.27 1.34 Water Quality Pond Tract 0.03 0.08 0.11 Onsite Roadway 0.75 0.00 0.75 Offsite Roadway 0.12 0.00 0.12 Total Area WQ2 1.97 0.35 2.32 Total Area WQ1 and WQ2 11.03 5.88 16.92 Barbee Mill Preliminary Plat 7 otak H:\project\30200\30209\Tir\pp1at071502\text.wpd Section 5 — Conveyance System Analysis and Design The storm drainage system (Figure 3—Basins, Subbasins and Site Characteristics) is sized to convey the 100-year/24 hour storm with the water quality ponds in their overflow conditions. The following briefly describes the conveyance system for the preliminary plat. Storm Drains to the Water Quality Pond WQ1 Three storm drain lines (Lines 1, 2 and 3) collect flow from the area north of May Creek. The pipes were designed to convey the 100-year flow rate without overtopping the rims. The 100-year design flowrates at selected catch basins were determined by using the Rational Method. The King County Backwater model (KCBW)was then applied to the storm drain lines extending upstream from water quality Pond WQ1 to catch basins D, G and J, respectively. The backwater elevation during overflow operation in Pond WQ1 was assumed to be 21.5 feet, 0.5 feet above the water quality surface elevation. Appendix D provides preliminary calculations to show that the storm water conveyance system meets the 1998 KCSWDM Section 4 stormwater conveyance standards. Storm Drains to the Water Quality Pond WQ2 One 18-inch trunk line (Line 4) serves the area south of May Creek. Water surface elevations were determined at selected catch basins usingtheKCBW program. p ogram. The tailwater at Pond WQ2 when in the overflow condition was assumed to be 20.5 feet. See Appendix D for preliminary conveyance calculations. Bypass Line for Offsite Drainage Basin An existing bypass storm drain line is to be removed and replaced with another line which will have adequate capacity to serve the developed offsite basin in the North 40th Street neighborhood between I-405 and the Burlington Northern Railroad. See Appendix E for preliminary conveyance calculations. Barbee Mill Preliminary Plat 8 otak H:\project\30200\30209\Tir\pplat071502\text.wpd Section 6 — Special Reports and Studies A geotechnical report was prepared by Golder and Associates,Report to Barbee Mill Company on Geotechnical Feasibility Barbee Mill Site Development dated August 9, 2000 (revised on December 18, 2001). This report was developed for a previous site proposal developed by Triad Associates. That proposal is summarized in the Barbee Mill Property Preliminary Storm Drainage Report dated July 10, 2000. There is a category 3 wetland located adjacent to the site boundary within the railroad right of way. The wetland was determined to have an area of 6,151 sf in a wetland study by David Evans and Associates, Wetland Determination Report on the JAG Development Property dated May 1997. This wetland was field verified by Raedeke Associates in March 2002 and was found to have a slightly larger area of approximately 6,250 sf. s Barbee Mill Preliminary Plat 9 otak H:\project\30200\30209\Tir\pplat071502\text.wpd Section 7 — Other Permits The expected permits for this project are: • Preliminary Plat Approval from the City of Renton • SEPA Threshold Determination from the City of Renton • Shoreline Substantial Development Permit from the City of Renton • Clearing and Grading Permits form the City of Renton • Building Permits from the City of Renton • HPA from the Department of Fish and Wildlife Barbee Mill Preliminary Plat 10 otak H:\project\30200\30209\Tir\pp1at071502\text.wpd Section 8 — Erosion and Sedimentation Control Analysis and Design Best Management Practices Best Management Practices (BMPs)for sediment control shall be implemented according to the standards specifically outlined in 1998 KCSWDM,Appendix D. An expanded description of the following standards will be provided with the final design for this project: • Clearing Limits • Cover Measures • Perimeter Protection • Traffic Area Stabilization • Sediment Retention • Surface Water Control • Dust Control • Wet Season Construction • Construction Within Sensitive Areas and Buffers • Maintenance • Final Stabilization II Barbee Mill Preliminary Plat 11 otak H:\project\30200\30209\Tir\pp1at071502\text.wpd I , Section 9 — Bond Quantity Worksheet, Facility Summaries, and Declaration of Covenant Bond Quantity Worksheets • Bond QuantityWorksheets will beprovided with the final design. � The worksheets will provide an estimate of construction quantities and an estimate of improvement costs for each project. _ Declaration of Covenant A draft Declaration of Covenant will be provided with the final design. Flow Control and Water Quality Facility Summary Sheet and Sketch A Water Quality Facility Summary Sheet will be provided with the final design. It will summarize the design parameters and will show a plan view of the water quality ponds. Barbee Mill Preliminary Plat 12 otak H:\project\30200\30209\Tir\pp1at071502\text.wpd Section 10 — Maintenance and Operations Manual The water quality ponds are to be privately maintained and will require the preparation of an operations and maintenance manual for the final design. • I , Barbee Mill Preliminary Plat 13 otak H:\project\30200\30209\Tir\pp1at071502\text.wpd • King County Department of Development and Environmental Services TECHNICAL INFORMATION REPORT (TIR) WORKSHEET Part PROJECT:OWNER°AND„- Part ` PROJECT.LOCATION 4NQ PROJECT ENGINEER.,' ;DESCRIPTION Project Owner Project Name Barbee Mill Co. Barbee Mill Preliminary Plat Address Location 4101 Lake Washington Blvd. N., PO Box 359 Renton,WA 98057 Township 24 N Phone Range 5 E 425-226-3900 Portions of Sections 32 Project Engineer Government Lot 1 Dan Dawson, PE Company Otak, Inc. Address/Phone 620 Kirkland Way Kirkland,WA 98033/425-822-4446 Part3 TYPE OF PERMIT:; Part.4" OTHER;REVIEWS,AND:PERMITS • Subdivision UPD ■ DFW HPA • Shoreline Management ❑ Short Subdivision 0 COE 404 ■ Rockery ❑ Grading 0 DOE Dam Safety 0 Structural Vaults ❑ Commercial 0 FEMA Floodplain 0 Other- ▪ Other 0 COE Wetlands Part 5 SITE COMMUNITY-AND'DRAINAGE BASIN Community City of Renton Drainage Basin May Creek/Lake Washington Part 6 SITE>CHARACTERISTICS: ❑ River 0 Floodplain ■ Stream May Creek I Wetlands ❑ Critical Stream Reach 0 Seeps/Springs O Depressions/Swales 0 High Groundwater Table ■ Lake Lake Washington 0 Groundwater Recharge O Steep Slopes ❑ Other ' S VILS Part T 4, ;{.'«:m ; Soil Type Slopes Erosion Potential Erosive Velocities Norma Sandy Loam 0 to 2% Slight 1 to 3 fps Part:8 5£ : DEVELOPMENT,LIMITATIONS; ,', REFERENCE LIMITATION/SITE CONSTRAINT • RMC 4-4-130 Stream • 50'buffer from high water • RMC 4-4-130 Lake ■ 25'buffer from high water • RMC 4-4-130 Wetland ■ 25'buffer from wetland ❑ ❑ ❑ ❑ ❑ ❑ ❑ Additional Sheets Attached part 9 ESC REQUIREMENTS MINIMUM ESC REQUIREMENTS MINIMUM ESC REQUIREMENTS DURING CONSTRUCTION AFTER CONSTRUCTION • Sedimentation Facilities ■ Stabilize Exposed Surface Stabilized Construction Entrance ■ Remove and Restore Temporary ESC Facilities • Perimeter Runoff Control Clearing and Grading Restrictions ■ Clean and Remove All Silt and Debris ■ Cover Practices ■ Ensure Operation of Permanent Facilities I Construction Sequence ■ Flag Limits of SAO and Open Space Preservation areas ■ Other:Silt/Water Quality Pond 0 Other Part 10„ 'stAFACEW-A1-0Fi's)(81- M 0 Grass Lined 0 Tank 0 Infiltration Method of Analysis Channel El Pipe System 0 Vault 0 Depression Compensation/Mitigation El Open Channel 0 Energy Dissipater El Flow Dispersal of Eliminated Site Storage O Dry Pond El Wetland 0 Waiver • Wet Pond 0 Stream 0 Regional Detention Brief Description of System Operation Drainage water will be conveyed to a water quality pond. It will discharge to Lake Washington without detention. Facility Related Site Limitations Reference Facility Limitation Part 11 STRUCTURAL ANALYSIS; 'Part 14'„EASEMENTS/TRACTS I=1 Cast in Place Vault 0 Drainage Easement NI Retaining Wall 0 Access Easement Rockery>4'High O Native Growth Protection Easement El Structural on Steep Slope • Tract El Other CI Other Part 1,3's:'SIGNATURE OF PROFESSIONAL ENGINEER I or a civil engineer under my supervision have visited the site. Actual site conditions as observed were incorporated into this worksheet and the attachments. To the best of my knowledge the information provided here is accurate. 4- fo 41 o2 Signed/Date J G-1L]�1LJ - t,' - el KPB *— 5 _ - Newport , t•Shores ..:.::• •I HS.• rc \�� ill 9 �_��• jAgD I AgDrr�� \ `'KP m •,b I IUQIi: .� (1` � 711)y i No\:':-*-. II �., �� /1 - � 'lfite1-11 I ,I" KPD _ . KP j-�� L �>7.1ilikl, AFcE., u o ., --- 2 • �p0 -=t KPB gh • 11 mil► � AgC ��j n /4,4 Agc l ° ,`S✓ AkF • 14:111lPill ��O r : , , , I , iii /w IfD stand 1 <'/ �. f3M'1 ' ;¢,,24 �= Pleasure a � �� .°B f (1�l =aim iI , 16sPoint 21 / `x I ��liy..� , , wit I Is best Pc 7 .:'r 1 ��, T:• 1. le ,„ . � g I Park •- l-3 I' AmC ., , . ., ,ct Id AgC oh II '' �� I] ( AkF wh laiG---- — �4)29- \ illBIV� , �'KPD I •@2'r 'AgC T _ _1m, ` KPB 7 • AgC -1 , - �r \- ;' • 'Pi I'New 11 ii 332 I i n-. _ U �V p0� . Ili EwC i .• . �. jib Hills • kr___ AgC ■ 1 Golf Course 1 . Evi3 y iir r �` KPD#AmBco Q� 67 D j 2. ':lit €B i + \� rii `, AHD BM I�l \ ItJr H. ,-\ / 58 i II �� Bh \ AmC ..• _ �4V O ,�-- AgC 1 .. / • I BMe ` , e, �.i�, KpCb • i -I• 1La irfEwc ch109 •��1� °°Q 356 - -- , -. 1 • t a - 4 1 ri, „p 3• I r• �,, r NI° • AgC KpD I • `1•' u •• ` BMA _ I s• v i� • 1 605 : � - I KPB •� � . . IvAN I.) • �J_` �, Sm \ i i • Point '',��;;;� AgC \s, /1I •—.::: kfen; ,.,•" : k - VIA 11. •�• I,1iii, Ag0•IN:, pgD 1 • Kenny �� •••'•.: : . . . i. .•ED ' • �� `c� dale/�I o : �� •InC AkF I®�.. • .. .CI.. I 1 AkF AkF I�•'_ -::1 , I Age WO Coleman Poi "••::1.• 1.1 P GRA VEL ANAIII.: a I. . .... r \. • B :77: AHD , - pi n ::••... .BM snl 1.:—.: • ��J;: BM 7111 �, :Va.: Lz `T- ' • 1 2 Figure 4—Soils Map — O )),(1. �,_ Barbee Mill Preliminary Plat 04/04/02 f 47 V 1I• I__I 11 \ .\--7:VI Ifs \\ 11 AmC Appendix A — Soils Descriptions • dry; massive; slightly hard, very friable; medium, subangalar blocky structure; hard, nonsticky, nonplastic; few roots; neutral. friable, slightly sticky, slightly plastic; common roots; medium acid; clear, smooth The A horizon ranges from very dark grayish brown boundary. 17 to 21 inches thick. to very dark brown. The C horizon consists of layers C1--29 to 42 inches, dark grayish-brown (10YR 4/2) of silt loam, very fine sandy loam, sandy loam, and grayish-brown (2.5Y 5/2) silt loam and loamy sand, and sand; the thickness of each layer thin lenses of very fine sandy loam, light varies. Mottles occur at a depth below 30 to 40 brownish gray (2.5Y 6/2) dry; massive; slight- inches in some places. ly hard, very friable, nonsticky, nonplastic; Some areas are up to 25 or 30 percent inclusions common roots; slightly acid; clear, smooth of somewhat poorly drained Briscot, Oridia, and Wood- boundary. 10 to 15 inches thick. inville soils; and some are up to 10 percent the C2--42 to 60 inches, grayish-brown (2.SY 5/3) silt poorly drained Puget soils. Total inclusions do not loam, light brownish gray (2.5Y 6/2) dry; exceed 30 percent. massive; hard, friable, sticky, plastic; com- Permeability is moderate. The effective rooting mon roots; medium acid. depth is 60 inches or more. A seasonal water table is at a depth of 3 to 4 feet in places. Available The B and C horizons are mostly silt loam and water capacity is high. Runoff is slow, and the very fine sandy loam and have lenses of silty clay erosion hazard is slight. The hazard of stream over- loam and fine sandy loam. The C horizon is dark flow is slight to severe, depending on the amount of grayish brown, grayish brown, or dark brown. flood protection provided. Some areas are up to 5 percent included poorly This soil is used mostly for row crops. Capabil- drained Puget soils; and some are 10 to 15 percent ity unit IIw-I; woodland group 2o1. the somewhat poorly drained Oridia and Briscot soils. Also included with this soil in mapping are areas of the poorly drained Woodinville silt loam and a Nooksack Series few areas of a Woodinville silty clay loam. Included soils make up no more than 15 percent of the total The Nooksack series is made up of well-drained acreage. soils that formed in alluvium in river valleys, Permeability is moderate. The effective rooting under a cover of grass, conifers, and hardwoods. depth is 60 inches or more. A seasonal water table Slopes are 0 to 2 percent. The annual precipitation is at a depth of 3 to 4 feet in places. Available is 35 to 55 inches, and the mean annual air tempera- water capacity is high. Runoff is slow, and the ture is about 50° F. The frost-free season is about erosion hazard is slight. Stream overflow is a mod- 190 days. Elevation ranges from about sea level to erate to severe hazard. 500 feet. This soil is used for row crops and pasture and In a representative profile, the soil is very for urban development. Capability unit IIw-1; wood- dark grayish-brown, dark grayish-brown, and grayish- land group 2o1. brown silt loam to a depth of 60 inches or more. Nooksack soils are used for row crops and pasture Norma Series and for urban development. The Norma series is made up of poorly drained Nooksack silt loam (Nk).--This nearly level soil soils that formed in alluvium, under sedges, grass, is in long, narrow areas that range from 5 to about conifers, and hardwoods. These soils are in basins 300 acres in size. Slopes are less than 2 percent. on the glaciated uplands and in areas along the Representative profile of cultivated Nooksack stream bottoms. Slopes are 0 to 2 percent. The silt loam, 1,800 feet east and S00 feet south of the annual precipitation is 35 to 60 inches, and the west quarter corner of sec. 4, T. 24 N., R. 7 E.: mean annual air temperature is about 50° F. The frost-free season is 150 to 200 days. Elevation Apl--0 to 2 inches, very dark grayish-brown (10YR ranges from about sea level to 600 feet. 3/2) silt loam, grayish brown (IOYR 5/2) dry; In a representative profile, the surface layer is few, fine, faint, dark yellowish-brown (10YR black sandy loam about 10 inches thick. The subsoil 4/4) mottles; weak, thin, platy structure; is dark grayish-brown and dark-gray sandy loam and slightly hard, very friable, nonsticky, non- extends to a depth of 60 inches or more. plastic; many roots; slightly acid; abrupt, Norma soils are used mainly for pasture. If smooth boundary. 2 to 3 inches thick. drained, they are used for row crops. Ap2--2 to 11 inches, very dark grayish-brown (10YR 3/2) silt loam, grayish brown (10YR 5/2) dry; Norma sandy loam (No).--This soil occurs as strips weak, coarse, prismatic structure; slightly 25 to 300 feet wide. Slopes are less than 2 percent. hard, very friable, nonsticky, nonplastic; Areas are level or concave and range from 1 to about common roots; slightly acid; abrupt, smooth 100 acres in size. boundary. 8 to 10 inches thick. Representative profile of Norma sandy loam, in a B2--11 to 29 inches, dark grayish-brown (2.SY 4/2) pasture, 725 feet east and 50 feet north of the silt loam, light brownish gray (2.5Y 6/2) dry; south quarter corner of sec. 31, T. 20 N., R. weak, medium, prismatic structure and weak, 7 E.: 20 Appendix A ota k Ap--O to 10 inches, black (10YR 2/1) sandy loam, thick. The next layer is yellowish-red sphagnum dark grayish brown (10YR 4/2) dry; moderate, peat that extends to a depth of about 60 inches. fine, granular structure; slightly hard, very Orcas soils are used mostly as wildlife habitat friable, slightly sticky, slightly plastic; many roots; slightly acid; abrupt, smooth Orcas peat (Or).--This level or slightly concat boundary. 10 to 12 inches thick. soil is in irregularly shaped areas that range frc B21g--10 to 30 inches, dark grayish-brown (2.SY 4/2) 2 to about 10 acres in size. Slopes are less that sandy loam, light brownish gray (2.SY 6/2) percent. dry; many, medium, prominent, yellowish-red Representative profile of Orcas peat, under wi] (SYR 4/8) and brown (7.SYR 4/4) mottles, very cranberries, 600 feet north and 650 feet west of I pale brown (10YR 7/4) and reddish yellow east quarter corner of sec. 8, T. 24 N., R. 6 E.: (7.5YR 6/8) dry; thin platy structure; hard, very friable, nonsticky, nonplastic; few roots; 0i1--0 to 6 inches, dark reddish-brown (5YR 3/21 slightly acid; clear, wavy boundary. 19 to 24 sphagnum peat, very pale brown (10YR 7/3) di inches thick. soft, spongy; many roots; extremely acid; B22g--30 to 60 inches, dark-gray (5Y 4/1) sandy clear, smooth boundary. 6 to 8 inches thicl loam, light gray (5Y 7/1) dry; common, fine, 0i2--6 to 60 inches, yellowish-red (5YR 5/6, 4/6, prominent, strong-brown (7.5YR 5/6) and 4/8) sphagnum peat, very pale brown (10YR 7i reddish-yellow (7.5YR 6/6) mottles, yellowish dry; soft, spongy; few roots; extremely acic brown (10YR 5/8) and pale brown (2.SY 7/4) dry; massive; slightly hard, very friable, nonsticky, The Oil horizon ranges from dark reddish brown nonplastic; few roots; slightly acid. reddish black. Only slight decomposition has oc- curred. The 0i2 horizon is uniformly sphagnum pet The A horizon ranges from black to very dark that ranges from dark reddish brown through yellov brown and is as much as 15.percent gravel. The B ish red to very pale brown. horizon commonly is sandy loam that in places is Some areas mapped are up to 20 percent include( stratified with silt loam and loamy sand. It is as Seattle and Tukwila mucks, and some are up to 5 pc much as 35 percent gravel in some places. The B cent the wet Bellingham soils. horizon is mottled gray, dark gray, and dark grayish Permeability is very rapid. There is a water brown. table at or close to the surface for several month Some areas are up to 5 percent included Seattle, each year. In areas where the water table is con- Tukwila, and Shalcar soils; and some are up to 5 trolled, the effective rooting depth is 60 inches percent Alderwood and Everett soils, at the slightly or more. In undrained areas, rooting depth is higher elevations. In the area northwest of Auburn, restricted. The available water capacity is high. in the Green River Valley, there are areas of Norma Runoff is ponded, and there is no erosion hazard. soils that have an organic surface layer as thick as This soil is used mostly as wildlife habitat. 12 inches in some places. Also included are small Capability unit VIIIw-1; no woodland classificatic areas of Norma soils that have a silt loam surface layer. Permeability is moderately rapid. The seasonal water table is at or near the surface. In drained Oridia Series areas, the effective rooting depth is 60 inches or more. In undrained areas, rooting depth is restrict- The Oridia series is made up of somewhat poorly ed. The available water capacity is moderately high drained soils that formed in alluvium in river to high. Runoff is slow, and the erosion hazard is valleys. Slopes are 0 to 2 percent. The annual slight. Stream overflow is a severe hazard in precipitation is 35 to 55 inches, and the mean ann places. al air temperature is about 50° F. The frost-free This soil is used mostly for pasture. Drained season is about 200 days. Elevation ranges from areas are used for row crops. Capability unit IIIw-3; about 0 to 85 feet. woodland group 3w2. In a representative profile, the surface layer dark grayish-brown silt loam about 9 inches thick. Orcas Series The subsoil is grayish-brown, dark grayish-brown, and gray silt loam and silty clay loam that extend The Orcas series is made up of very poorly drained to a depth of 60 inches or more. organic soils that formed in sphagnum moss and small Oridia soils are used for row crops and 'pasture amounts of Labrador tea and cranberry plants. These and for urban development. soils are in basins on the undulating, rolling glaciated uplands. Slopes are 0 to 1 percent. Annu- Oridia silt loam (0s).--This gently undulating al precipitation is 35 to 60 inches, and the mean soil is in irregularly shaped areas. Slopes are annual air temperature is about: 50° F. The frost- less than 2 percent. Areas range from 10 to more free season is 160 to 180 days. Elevation ranges than 200 acres in size. from 100 to 500 feet. Representative profile of Oridia silt loam, in In a representative profile, the surface layer is pasture, 850 feet north, 620 feet east of the dark reddish-brown sphagnum peat about 6 inches southwest corner of sec. 12, T. 22 N., R. 4 E.: Appendix A otak Appendix B May Creek Floo.dways 1? STREET To determine if flood insurance is available.contact an insurance agent or call the National Flood Insurance Program at(800)638-6620. APPROXIMATE SCALE IN FEET • ' 500 0 500 ' REET I—: 1---i Y--I I • NATIONAL FLOOD INSURANCE PROGRAM • FIRM . . . . • . . FLOOD INSURANCE RATE MAP o . z KING COUNTY, ' WASHINGTON AND u, INCORPORATED AREAS I Q PANEL 664 OF 1125 • (SEE MAP INDEX FOR PANELS NOT PRINTED) w z g . ' CONTAINS: COMMUNITY NUMBER PANEL SUFFIX CAMAS AVENU DRTHEAST KING COUNTY, UNINCORPORATED AREAS 530071 0664 F , RENTON,CITY OF 530088 0664 F STREET >I I— (/) a w w = Z I- S o CO Z MAP NUMBER 53033C0664 F Ail �N�Y MA�� MAP REVISED: . ,4� p, .'�, MAY 16,1995 47°30'00" ��w� �� `% Iv y 122°II'15" �a :1-', y' O Federal Emergency Management Agency Appendix B otak • • LEGEND ,;-:_:; SPECIAL FLOOD HAZARD AREAS INUNDATED BY 100-YEAR FLOOD ZONE A No base flood elevations determined. ZONE AE Base flood elevations determined. 122°11'15" 47°31'52" ZONE Ali Flood depths of 1 to 3 feet (usually areas of ponding); base flood elevations i H determined. 2 ZONE AO Flood depths of 1 to 3 feet (usually sheet J flow on sloping terrain); average depths LLJ determined.For areas of alluvial fan flooding, I— velocities also determined. CC ZONE A99 To be protected from 100-year flood by 0 Federal flood protection system under 0_ construction; no base elevations determined. SZONE V Coastal flood with velocity hazard (wave action);no base flood elevations determined. X ZONE VE Coastal flood with velocity hazard (wave action); base flood elevations determined. �y == -; FLOODWAY AREAS IN ZONE AE • I OTHER FLOOD AREAS z ZONE X Areas of 500-year flood; areas of 100-year 0 flood with average depths of less than 1 foot or with drainage areas less than Z Z ' 1 square mile; and areas protected by ILlevees from 100-year flood. CC 0 • U_ U 0 OTHER AREAS C9 } Z ZONE X Areas determined to be outside 500-year floodplain. U ZONE D Areas in which flood hazards are undetermined. I k UNDEVELOPED COASTAL BARRIERS I^\ \, , `\\ • , , , \ \ Identified Identified Otherwise 1983 1990 Protected Areas Coastal barrier areas are normally located within or adjacent to Special Flood Hazard Areas. ti Flood Boundary IEET \c Floodway Boundary n�, cP� - - Zone D Boundary TY T. ., -• s•.,c BoundaryDividingSpecial Flood �' �ti �i P ^D�/� � Hazard Zones, and Boundary �D AREAS = T, Dividin Areas of Different lit—, ` .� :n,-.r:. 9 Coastal Base Flood Elevations Within Special Flood Hazard Zones. Base Flood Elevation Line; 513 Elevation in Feet. See Map Index for Elevation Datum. OO Cross Section Line ' (EL 987) Base Flood Elevation in Feet Where Uniform Within Zone. See Map Index for Elevation Datum. • :� .ENTON RM7X Elevation Reference Mark 530088 • M2 River Mile . Horizontal Coordinates Based on North 97°07'30". 32°22'30" American Datum of 1927 (NAD 27) Projection. ZONE X C7 NOTES A This map is for use in administering the National Flood Insurance Program: �q it does not nee,. .)-itv irlpntifv all areas sirhiect to flooding.particularly from in 9 local drainage po Special Flood Appendix B 0 N ti Coastal base f otak 6' N the effects of O' from those • cc) evarnarinn nlannlnn _ • t OA r ZONE X 0 JOINS PANEL 0675 I-[ O w NLIMIT OF "a, p DETAILED STUDY NDV ';'......:a;�. z cL ', 6�_ w ZONE X `°`O , A,,,,,,�a = a / ��~ O E :.r: til z Z May Creek .,04 �� ZONE AE © � � co CI�„ #,xw3 ---/)4 OP rt V /41-Q-71-- � QP� N 40TH STREET RM210 ��; A ZONE X �� ; z° r•' 2 MEADOW . o 0 ��Q F PviE ij O� it'47 O NORTH w r I NORTH 38TH STREET z z w W > z ¢ w D z / NORTH 37TH STREET j o f 52 0 NORTH ( THo © c� STREET ¢ z W J �p is z i w a_NORTH 36TH STREET - � / 0 NORTH 36TH STREET h�t 32 o /1'::'. KIND NORTH 35TH STREET UNINCORI ,/O a < O i O a w 6A NORTH 34TH STREET 6> z mz z May NORTH 33RD PLACE w gi Creek ¢ ZONE X 3 72 ( Y NORTH 33RD STREET Q ZONE X t w z M ili ii.h\\0 tiQ NORTH 32ND STREET i NORTH 32ND STREET » ZONE ; ' W ':: NORTH ¢ 31ST STREET �� "��cv ^d°'" I ZONE AE co• N. CO NORTH 30TH STREET NORTHEAST 30TH ZONE X STREET Ani N NORT Note: Datum = 1929 NGVDN\ \<4..0 �� `may Appendix B Scale: 1" = 500' otak - - I rani at.I n.,r. Ill nrr_ I 1 1 11 Al, Cori I _ .1 1 S114 15 FLOOD1111, ....... 1 �, - INSURANCE- STUDY 1 a- - - :� . ►. . � , .... 1 sir up D y a\, � it T. (-7/ ' 4„,,a2w,4,0- -• ) g7. --- „ -Tr fog.- ri Ar , r• . -:-, S. 41/14'714111111111 A' - t. ,.- • .411. ./. . /). , - I � _ A... �- KING COUNTY, WASHINGTON AND INCORPORATED AREAS VOLUME 1 OF3 COMMUNITY COMMUNITY NAME NUMBER AUBURN,CITY OF 530073 BELLEVUE,CITY OF 530074 BLACK DIAMOND,TOWN OF 530272 BURIEN,CITY OF 530321 CARNATION,TOWN OF 530076 DES MOINES,CITY OF 530077 DUVAL,TOWN OF 530282 ENUMCLAW,CITY OF 530319 FEDERAL WAY,CITY OF 530322 ISSAQUAH,CITY OF 530079 KENT,CITY OF 530080 KING COUNTY, UNINCORPORATED AREAS 530071 KIRKLAND,CITY OF 530081 LAKE FOREST PARK,CITY OF 530082 NORMANDY PARK,CITY OF 530084 NORTH BEND,CITY OF 530085 Ci? PACIFIC,CITY OF 530086 REDMOND,CITY OF 530087 RENTON,CITY OF 530088 SEATLE,CITY OF 530089 SEATAC,CITY OF 530320 11 SKYKOMISH,TOWN OF • 530236 SNOQUALMIE,CITY OF 530090 TUKWILA,CITY OF 530091 WOODINVILLE,CITY OF 530324 6t„ mANq REVISE®:MAY 16,1995 1 1 S. Federal Emergency Management Agency a� r, �'�%o ah 17 Appen o{B ak j • • FLOODING SOURCE FLOODWAY BASE FLOOD WATER SURFACE ELEVATION SECTION MEAN REGULATORY WITHOUT I WITH INCREASE CROSS SECTION DISTANCES WIDTH AREA VELOCITY FLOODWAY FLOODWAY (FEET) (SQUARE (FEET PER FEET) SECOND) (FEET NGVD) May Creek A 0.14 34 158 5.5 21.0 21.0 21.5 0.5 B 0.16 60 239 3.6 21.8 21.8 22.2 0.4 C 0.24 42 99 8.8 23.3 23.3 23.3 0.0 D 0.25 42 110 7.9 25.7 25.7 25.7 0.0 E 0.31 31 121 7.2 29.0 29.0 29.2 0.2 F 0.39 40 150 5.8 32.5 32.5 33.0 0.5 G 0.46 28 87 10.0 35.8 35.8 35.8 0.0 H 0.52 23 123 7.1 40.0 40.0 40.6 0.6 • I 0.57 45 165 5.3 41.8 • 41.8 42.5 0.7 J 0.63 31 89 9.7 45.3 45.3 45.3 0.0 K 0.78 33 133 6.5 55.2 55.2 55.2 0.0 L 0.94 79 143 6.1 64.7 64.7 64.7 0.0 M 1.09 33 113 7.7 76.4 76.4 76.6 0.2 N 1.25 39 128 6.6 85.4 85.4 85.4 0.0 . o 1.36 32 89 9.6 93.1 93.1 93.2 0.1 P. 1.39 40 172 4.9 95.6 95.6 96.0 0.4 Q 1.41 33 90 9.5 95.8 95.8 95.8 0.0 R 1.42 33 111 7.7 96.4 96.4 96.4 0.0 S 1.46 30 95 8.9 99.8 99.8 99.9 0.1 T 1.54 22 91 9.3 106.8 106.8 106.9 0.1 U 1.56 8 68 12.5 112.2 112.2 112.2 0.0 ✓ 1.61 . 43 283 2.9 114.2 114.2 115.1 0.9 44 1.74 27 81 9.9 120.9 120.9 120.9 0.0 X 1.83 38 170 4.8 125.0 125.0 125.7 0.7 Y 1.96 52 101 8.0 135.8 135.8 135.8 0.0 • Z 2.02 42 130 6.3 140.4 140.4 140.5 0.1 b b R . . 0 01 1 7Ced Miles Above Mouth A FEDERAL EMERGENCY MANAGEMENT AGENCY FLOODWAY DATA B KING COUNTY, WA E AND INCORPORATED AREAS MAY CREEK ! , • ELEVATION (FEET NGVD) ...,I -% fs.) (4.) 4c1, CM .0") .4 CO CD 0 • i,...;..... 0 0 0 0 0 0 0 0 0 0 -A --.E.TITL.1 . 1.4.- 1 1 ' .1-1-.;..1 ;HT .]._.1 TiT .4,...4 .1 1 1 i_Li Hi. .1 I .E.4.44. - 1 1 L.4. .1. .4. 1....1.1__ ...4 i..1.4.,...1 44_4.4 .....i 4...{441. : „ ,' , ..,...! 1.1...4 1 . ,.1 ,, ..I.4.1,..4._ 1__!...4:..1.1..1. +. "---4---1, I 1- , 11;' -I--I- I; -1- , .'• i 1 -1,-iNiit IF Ott-Aft:it(' littbr..--id "f3" ETE7).41ULtRIOAD'11---h 1..--i---f-it.-i--1 •-i.-+-11 ',‘. ', 1 h : I : • I 1..I .i .14.1 ; ..1- ' .....1 1. 1... ; ; 1 .4 Li, '. ! .1 i1.(1PR.IVIA117.. .ACjIA.P1) -4-.1.--1.-,.-1.44.. -. , . • ' ' : -1., 4_1-1 1 4.4.4. 4.1. 1__ 4.444 1 1_44_44 4 ...14-4....: 1 -.1 I-4.-1. 1--4.-4-4 , 1. -.-1.-• 1 .I...1 -4.-1 .I.- ; ; I : ' ; . ; ; , ; " ; 11 il ' Iii ; lj i . ; ; ; ; ; ; ; I , J1 ; III j_ 11 ,41 1 ' 11,111 ; 1 ; L11 , 11,_ ---1-,41--1,- 11-'T•1'-i-i •; "'• "1''1 : I I :'. ; . ; ; ; ; , ' '--'` --'' ''- I' •-• • ".r " I •• . ` • '4 • ' I-- . . , I „. , 1 i 1 • ,, , i , I- ! !, -----1 1 ----,- --,--1- , I r_l 1 1- , - 1-_--1---r--,-;, •i.-i--;1; !,-,,--;,---; .;;; -A., H!--i f•••••- ! • , ,; 'I ., ;•i i + -.4.;- • ;.;;;;i--!---,,-;! , ,-f -4- I ;L•t•f-1 .-1; 4-, 1 i• ; •1; ,- ,- 1;;;41 • "; 1--,; I-I 1 L."... ._..1. IA-I. I...I., .1-1...! .L_I..I J i....1...i..1 .J. 1-; J..J..1_I .1 _LI t--.., 4 i --,----1-1..L.--_i__..4....4 ---t---I-I-4----;..-4-4.-1---4_1. _.1.„4_4_4.- 0 • ; ; ; t ; „. , ,..i ; ; • ; , .1, ; ; ; IL ; , , i IHIL ; 1 ; il....' n , ' . ; ' " i__I ; " • ----L---r--,--4-----, , -;-1.-- ti ; --. 11 ;-; . t : 1 -- 7-; - , , , , iii ; ; ; ; 11 ; ; ] I . , ! 1 ,I • ! ! I tr j 1. I- ; ' " • .'1- 47•I' ; : -It 1 ', 1n! t-1. ' -I 'h. rt. ; t f -It t i-t r-r 1,11: "" t I ' . - -1-1-1 1.t I• ' 1. . . 1 ; I, •I-i 1 •';•i i 1-•••-t••••• ••!-4.-I;••1-••• '-I. •-; '; 1, •-•'•". t I• 1•••I I- •-t 1 It J- ti --I'-'; , l'I-L 1 ; t ; ' I !--1-1-`1--I-t-- 'i--r-'-''''-1- J-H---I- I I-I --I- ; - -. 1- ' -1. t• I-I-1 t--I.-; -I; ' j. i : 1 1-1-i 1-i )3 0 8 LI NOTP N iN.0.11i_ii.E4N FlAi.1*-illtd,'Ari. .11...... 1 1. ; ,n, . • . 0 , ; ILL I_ it....i_Li_1....i ;..; : I, -4 .•;--1- I.1 , .1. -; I. : i-.-f--1, •;.--t i .i.--r•-i--,--I 4.-1 i_...i•, 3 i •• ..).,,,,.... _0 J ' .1. 1 , ; 4 .1. , . 1 1 I, I---I -44 4 4; •1-- 4- 1-4 I 1 -1-4 4 1 .1- --; • --'' : ; ; ,1 4 1...1. N_I .1_1 ,-i•---, :--1 1--t- I t•-•--• 1 1 - t-4- ' -I- 1--4--I t ,! I-11 --',- -1--1 -I, .--I-J '11-7 'I-, 4, E-!VitA -1-I-ING, TFON-'BO LEVARO-P,-1- . " . 11 , ! .. ill 1 . 1 • , I -,,-.--, :--i.--1.. ; .1.-1. I-, ! .i t-- ; ; ! .1.----1-4'1 --I"'---1-•1'.I'""; I'd'• •-r ; ; i ;-r--,'-1--• „:•••,.., ,--r.,.--t-i.t- i .1._. ..,._...1\ ! _....,._4...,4-..1 ! ! ., 1,...-L- 1..1 .4. ;--.4-4.] , 1 4. 4 , ,,...L, -4 i .i....1 ; ",...1.1 .1. ii--.4--,- -1 1...--i 1--F i , i• -3, I 1..--4. ..1--1,--1-1 ,..1 ---4--, -4, i -,,.-1.-- , . , 1 ,4 , . .., ....,___,.. ..,....._, L. ,......i..4. ,._,. 1 ,__, . . --,-i ..- . '--r-+ p i___- r.-,. _._. ;_,.. ...L.-:•: -TT.. --1--;--r - "1 -"-- -'1---L1. 1 - 1_,1_1111iLi I ' 1111711 II ; , ' ; I I I • I_..,_r „ .i . , i , I 1 1, 1.... 11 . ! , , t-, II (4 •t 'K fri • : 1 ',"I 4-.. 1--.4.I. .1 A 4.. 1_4 .4-- 4-4 1 .1.\ I I_ !....11 4_ ! 1 I 1_4_4._1 4 I. 4_4_.f.• 4.1 i 4. [ i 1 4_1 .1_____.1-__ .1,._ ..:1,. ,---1 -I- , -4.-!........--1-4--4--i--+ -\I: .i--1 4 i-,4-1--4-: .-4-4-I 1 !.--I 1 ",- 1 1 1--..--I-1 Li 1.--- --!- 1 I. -1-4-J-- I- 44_4 ., I 1 1 t .1_4 ! 1 4.4-I 41-1. 4 4 4 i-4.4 '1 I : I ; I-.LI -1. .1; 1 IN;.\-F-1 .1 .1-1 I I 4 ' 14 1 1.4..1 1 i "!"• "1--1 i _4 ' ; ! , 1 1 4 1-1-1:, 1-7- ..1 I, , . • •• 1.. . r , , • ii 1 ,- N 11 1 • ,-1" 11 , 1 ! i 11 . ! ; ' , 1 ; ' 1 1 _ 1 _, , , 1---, -1; i 4, •-•----ii L 4---!, , ,, 1 i , ,--4,-id 1 1 i-;.4.-T, 1---t 1 I 1-:!-1-_ 1-1.--1.----1--1--;-"--1--1--4--I, -4--1---1----}-.HA-- ; 4--14-4-1-1-i-1•-,- "I -L,-; ri ;! i t t -1--t-I -i. r -! •- 1----l- !, ----- .---;- --i -r --t--r-, 1 . --)---r - ----1-•"-I- -;,-T"4"I- \ ,-.! ,I • 4-,.' 1,•-I 4 I- \ , 4.• -I-1.--;•1 , 1.-4--- -4'I .1- -t. .4 ' 4 1. ' 1 i ' 1 ''''+ ' ; ' '-- 1. ' L- - 't _t-, -I 11" " hi- 1- 1.41--r-r 0 1 .. , .• ; i' , _.,.......444.__, 4 44,411._.1.- 1_......it.‘.1\ r, 1_;._±.....;_I Hi,. i....1.. i i j_;.H 11 ,:__.4,. , I ;., ,, 4_1 ,ti._ti I , il li. 1 1;... ;.....1 1. ,. • lir-F4w 1- 1, ; ;- m. i ., , , . ,_, .__,...„._, . 1 -1--1--f I -I -I '-j 1 I 1; '•-I-1-. -1 t I- it-I-• I •I• •t--4-1•• •i"I i -I• 1.4-1 •-i t•I I, l•-t I t. I• t1-.4•••is 1-• 1,-1 1 1 t•-•1-1--- i 1 it 1 i „ ; , , , 1 4 . I-; ..I- t t -.1.4i.4_4-I.1_. I__1 1 ,_, ...t....1_4_4...4..4.4 ; 1 1 4 ; .11- '• . ---.1-.4 ' -4. f;-4 1--4-1--;I 4 1 '--4 ' ; '-;),-.1 •1 ' ' !•-1-- ;-; ' c- -4 ...1.___!._Li L.1._1...L.L..._4...1._L_i....i I 1... ; .4 .1__N ; 1...I. ! 1 1 1 1_" 4144 1.... . ' _L__!..!,.. i. L i 1.I. i 1 ,„ i !_L 1 ! 1 i L.... i -I; i 1 t 4-1 1._4__t_i_..,_1:711i.-:- ii-1-4_--,...(-J.-tai. ..I. 1 1_1_4 1 1 " t 1..14.4_1 4 1 1 4_ 1 ; .1 I !...4 .1 i.4 1 4.....' 1_44.4.41_4. ! _1. ...; .4 1 .../ ' , 111 , 1-; _i ! . II\ i ! ! " 1 , ! , ! , : 11111 , i14 , ' ', 114 , , , ,, ,! ! LT11_1 ;INTL SiTATE A, 1G1H;VV.-4Y(4d. 1 1 ". . 1 'L.!'.!--1 '. •1•••I -1.- •1. 1,•-•1 ; 1‘. I••1 I---1. •1-:• 1-1 1 1-1 : "1 I. I;_I 11 I I -1-.1 : I 4.1 r; ri ; I 1 II i _.1 1 1_1_.1. .i...:. 1.-1____I.__i.....i. I.__2...;_4_ 1. I.j• .i i........ i..:it]Titt..t."1...L. 11 1 I _LI\• ' " ,!-..i. .'Ll.--I ! I'..;_..; ,-..s,,: A..: 1.1.2,--1-1- .-- .. . ' J... _l i'i..4._-:, v_f_._...._141 IL 1_4_1_4_4 I I 4_ ! 14..!.1 1_4_1. I-I 144 0 i .1, L...4.', 1..4,„ 4 1 L. ..4. ! \ i, ! 1 I ..14 L.4.4. 4.4 1. 4..t. ! .1..; .1.1, 1 ., 4. ; I t..1 .1 .t. 1.• i----1-i i.• .1 .i. 1-1 1••••••1 L.-F-4 -1. t• 1-4-J...I ! 1...t. -1••••1-1. J 1--.1-..1 -1•-•• 4.]... . ...t L.t.L..t..1.....t._ .i._i...t.._.t....1....1..1.._...I__1. t...t....t._.\N 1..1 ILI 1 1 J l...1 1..I. ' _i..j.I..1.....1, 1.L..; 1 .1 L..1_ J..• I 1 1. 1....i. _A. i.4_i 1._44_._;__L_A. f ....i..1 4_ .4_4_4. I.. 1 i F.. _ 1..1 4._ , . 1 \ , , t , , , . . ; , , ; !. ; ! ! • ; ! ! , 1 ; 14. 1111, ! L , 1 ,11 ! 1 ! ' , : 1 ; ; 11, 9 I i_i_i_4_2_2,...1__;__1__-_i__1_4- : •• -4 -;--4 ,---4----- -.-------' I I I.----7---II I I • -I I T-1--I---1- (71 4 - ••', *I- LI--I-4 I-4-4-1'4-4 '-'4""I I I I-I" INN 1 I' !' I I 4-I I•-i 1-1- l'I •-I I Ir j I-I' 1 I-I 11-1-I 1--I-I I I I ±'-j1- 44 . ' 1 I 1 ; . , . i. .i_....,....„...1 .4...1.44. i..4._.L....1_1_ 1..4_4_1 I. ,. •... L. 1: 1....1 .: ...... .;_..i : .1._.i._i_.;: ',. , • H-L t i---I , I ' ' i.-I. 1 --1 L-1- .i. !-2-4-4.1 .i--IT ---i: 1-1---I1---1----1-1--l'- 0 I.i..t ........i ; ,.. i .'..: 1...,.. H.: i..L...... .........i._._...1....t. .; !,- .;\ .i. v ' .1. .1.1 4 ! 1...1. t t 1 1--•! i i .1-1, .1, !--1 1..4-1..t--1 '..f.--t- t- 1.-I -;-1---t -i ,.4-.-1---. 1 4-1_ t.. 1 i_:_i_ ...I...1 L..4........L. , .i...., ,...,.....4 , .....L....1...,..L., . _1_,.:.\..,...,..L...,... ..._.,..L i , , • 4-• 1 : _i,__: . ., , .; ._L. i •1 -, ; , ,, -;.- I •;-1 . •1•' .1•r• ;•-: r ; r.T-,-4•r• t--,- ,--r ! •i. 1---.1..1-.1 1.--1--,---4,-.., -1--;--T- ; ; ; ; ; ; ; ; . 11 , ; ; ; ; ; ; _,.• ,, ,, , , , 1 ,,.. I I r-- .-•; •- .4 .1--;---•;•- ;•••r---; - •1 ;"-,-•-•.--.' •'-1 •'1.";'. ....," T ..I.Lt.' ....-- [, i t. 1..1. 1 .i• [ 1" , i II ..1..i..1...• .4. ..1...1...; 1..;..i •.• ' .1.N .. I. ; ; I , .1 -••.-4 L-- -,- 4--1 4; : i -;--;-; 4 4 1; :- 1 I -1 1 ';'- ; -1 ;"--1-1-r"•-1"", n ! i--•••••-!,---:•-• • • • . . • • , : 1 , • ; , , ; ., , • • I f . i ., •! L,! ,, _,„„ . L. . !, , I 11H ! , : , ,,.. ; 11 , , , • HI 1.-i-:-. ......i.. . _.L...i ,. ; 1--' • , 1 -1-\ , ! ! • 1 ! ' ' : -1..4.• .1 " 1 .4 • 1 4 '4. ' I-4- I-I I-.L.--I 1-1 I I--'1 I 4.• I'4-I-1"! 'Ilr-I-I,- I-11 717'ti-IT-till-1 LI' (/) - If:I:- . 1 :- 1 !...I 1I.-1- I"..-I.. I. LI .I :..;• i '4,-• -1-1--1-"1-I-4-1-1-Is' --1-1•-•••"•4-4,•1-4,-1-1-- ,..t ,,,.. ., .„ ..1 4.. 4...1....4 .1 L..t..,........I .; 'I-\ I 1 1 I ,'•'...r. • " .,•I ;• 1.-•-! • !••1 1.--;••••1 ! 1. f 41. 1..I I -I--•!• •i'. 1.. I I 1-1 ' ' -J. ; : , 11 . ii :--.1 I 1....I ' : I -I. 1 .: ' : , -1,...: I , I- -I -1,-1 I .11-1,--4,'-I• --LI-" -4--1-1'---1-1,--,-- --I 1 -I-• - I-----;--! ---4..-l••;--;-• -•!•-!---1 !•-4-- --, ;; ! •;t- ! -; ;--,- ,, -,--• ,- •--r, , : ! t•1.•.t ," , -!,-4-, ,,- .-4,--!-i ! 1-t---!-,,-i--1 I.--L, !-; •!--,,--4---i---,-1-1---f--1---f-t-f---1-•-- 0 1-.:-- '--; - -I.4•••;•• •'•- 1 1- 1••:*-1.-N' 1--.--1-i-""" "ir.t"! '" "! "' .'"""ir"I i I I I1 1 I 4, 1.."'"""f t" -"1""i .444," ; 1 t -• i "f" 1 li'7 ,....1.....1...J 4. ....1..4 ....L.;.4....i. i...}... .........1 ....,..4...i t 4 ...i_ I, ! . I ..,. ,..r; L. I...., . .„..L 4, , .._.,.4 .1.., 1_4 1. i....t.L...,...,.1....„_,..4„._., -,▪ o _i_ ;. ; • , ._1_: : 1 ; .; , ' I , , 4_ i 1 ' ! , ! ' .1-1 ' ' L-I. NI 44 • .L•-•---' •,--•-•- 1 -;;------4--t---1,--i-4 I I; ' I•--1---i---1-,-t 1 , 1 I 1- ----!--i-1--1--;-4-4--H, -,,> ••••1 - '....4 4_1 4.-- i.1.4.....' ,_..:.4-4.4.....4 4. 1.4.1 .' .1 "...4..1 .1 i .L--' 4 '4.4. 4..k i ' :_...t...; ' : ; ' ' t .t '1..4_ t..; ..1. 4 .1 ..1...., ,,__I_t.1 t 1,..4.1 1...1..i .4_.;_ -L...1 4-4-..;.4 1.....t.i_I 0 I';..;;•';'r; ' •"•I'''''''' ;'' ''''''t•••p'...r. : '1" ''''C''''," "'.; I'l ' ..;"'"; ; ..; 1, Th''.1..1 ''' , '' 7 1 , ' 1 ';' I 1. ' :'I. ' : i ; ' • : ' I • I ; ; ; 1 ; 1 ' ;j 1 1 H 1 I 1 I I I i ; ; M ;;;;;4;;4; 1,;44';i4...i 4.1 t.._.., .t,_-,t ! . 1-4.-Lt i-F . 1.-.4-.t- t..-; , 1 [ r : .,....„,•-1 1 -: I. -; , t t-t 4. . ----1-------t - - -1 1.-;--1"-,. ;-1 r-.. --1- 1 1- 1-r.-1-,--.-1-----;-..-i---,-1--r-,---;"-1--.- : I ' ; ' ; ' ; • i ' 1 • ! • ' 1 ,_.4.._, , .L. ;__•4 -.4 ..; .1-...1- ;., ,./-.I 1....,--1...1.4. f--.- .71-11-1 '.'.ri. JI I 1-7'4 :: i-1-1--1--1 -'t-I-1. 1 •'1-1 -1-'• I ;-1-1. --. kr-F. t.,N, . ,-i- 1 . ,---..-.:- : , ..-, , i , ! 1---r-,••_i_--.. ,•. , i i i . i . i [ i , . , , . . , 2 --1 '- ''-1-' 'i' 't--1---'-----j i j ter--1- --i-1."-r L-1-1--- -i--;;; 1-1 1-i- ; ;FT ; ...;, 1,; , , -1- I .; ; I; ;...i -; ; -1,--;; I i L 1; t; I Ili-1 1 ;-I- '1-1,-"1"-'1-".-1 i 1-I•-1'•1-1 1-1 , -n .t-,--;-.1..1.-----.4.-i--,--1.-, ----t- .--.--.4.-4 "4" 'I 'T-+-1. I 'I-1-r j I. II-: .• I "IIIC I:IN. : I- ' I ,-..., !--' -4 ' M • I " : ' : I : --.I--I . . I--I ; : -,.....,I ,......:. : 7.• ,_,._.! , . , . I I ,I I ,..I...I ..I._..1...i.',..t_. 1_14 I.._i_i_...1 i ..11 1 .4........I H....,._.1_...„.......__I_.--i--4--1-:-.1__;..1.._!.....I__ M _I ; : ' ' I I. ! .I. I .! .1. I I...,.. I .I....I.....1.. I--1 1 .q_; ..1...i_/...L.4. I ,_. .i4 .,. ' J..1\2. •"! • , 4.4 4. . I-4 4. 1 4 ` ! 4-.1-4." 1 444...• J 4. I 1. 1 1 I 1 1 0_4_1.4.4_1....i . • • ........4. 1_.... 4 1 ! I 1 1 4 1 • • [ I 11.1 4 -..; .1.i. 1 "! ..,\ • ,. 1 L ; I .i. 1_ 1.1..1.4____i ; .1. 1...i.i.1 .4_..1 .t. _l_....t..1 ,_tl.. t _It .4-----------------------------.14 , 1 r•-, • ,- , 1•• t•----r -,••: , , . -' • is: . ., • • - • , • . •, ii i i ; i H ; 11 1 1 ,,, i . 1 1 ! II , ! ____,_! ' F- ) - :: :__,_.,__•;-"_--,---. -;--..'-...L.L-4-.,--i--t.---L i • t • . ; --,--,. -L-..;--,-. I • '. ' ---i-- ; • -•,... -2. -- .4,- • , , ; , I , ; , ; 1 1 i • i ; co co _t._i.,...4.._.i...t....t .,1_..:.....t...t._;..t..t.i L__....,4.11.!-1-.i-.1..4 . '-1-1- i 4 :, , '• ; -4 ',-,4 A!, \" I -I' j, , , ' i--1----I.-i. +- "•4- , -1 1 1 1 1 - 4--1-4---I-4 11 i; ; 4 -1- 0 4 1...t...1 1 .1..4.......1... ..;....4...1.-1..1 .1.....1..,1-1 .1 1 ./...1 4 1.4 1..1 1-1 1 : ' 1..; 1 I 4 ;•1 ; I ;;41... ; I ; 1 I ; .1 1 ' ;;I ;4 414 ; 14 i 14.. 44 ; 1 1 t7 I ; 4 4;414;.... L.1--.!--1-..1. 1--,..-L-1-1--1..L.- 1 4.-.1-4-4. ; 1 1 1 i ', 1 i 1 _I_4 : 1.4. .., 4- 1\14 NI,: , ' .-1.4_1_4 , -f . lb -1--'741-1.- 1 --1--4. ..-. % L i--I-.I 4_4_4_4_1 .-__.---1-•.- m - I..4-141-i 1-•1 4... 1.-.:4 I ! 1 ; 4 L ; L_1_4_.1.4._•_ .L._11_1..r..1 • ;.!_L..; 1.4..rI !4,,N '... 4--' I,. I.-! 1 1- 1-t 1.--4 I 1.-1-4---1,- 1I-;! -24 ;1----I I I ! L-1 i it-jf-- E ...1....1....1_,.1 . J. 4 i........1.4 .4 1.-1 .i-- 1 i IL ! i j•;4-i 1-4-- -1; i.-1. : i ', : 4•i;1 1-I-;"-;IA, ' . 1 I-, ..i. i; -i--i--i I It 1-;;;i; 1 ;i.1;4 -I- 1,; N-• 1-1; -i; ,--I;L,- i Li--1-i ;•4; t -1;;;; 0 _1_4_4_1.1..,..i 1,.1 .1.: ;.4...1.-...:. 1 1-4--t---f-I I , • L.; 4-1-' ---4 I: --4 ±-4•-•I' I' ; I '1\f" , I.-1 1-'' T-1I••I I ` I ; . 1 411-I-I i .±-; -:- j--I -1--1- -1••••1 -I" ""11 1 i• f- r" 4...4 4.-1 4 1 ! 44. 1.4_.4...1, ; ..., .1 4._, '.4_4 4_4_4 1 1 i" *i i, -I 1". '-1 'H-4 1 3 :--1-"Ht-- 1 f--L-f 1 •H 11-i-T1-' -1-1-'1--jr- -1- -41-1 -1 ....1...1..t....1...t..,.;..1...t. 1 I it. 1 ..4_ ..1 ; f 1. 1 ...4 f--t. 4, .1.i . ! i .1 4 I- I j , 1 1-- I ..-4 -, -+--!.....,........ -1-' -1' " '1-1' ' 'I"' I 't I--.....-r 1„' i ! ; .',...; it 11' _i_ 11411, 1 ; 11 il ; i , ' ; . ',--; 1 - ' ;; " , 1 ' ' -4WILT -Ii -H . 1- , , . . „ , , 1 ll, ' ;, 1, l ', .; 1 ; 14_ ;, ;. ;__1_, 4,--' ! 1 ' ; • "rfll ' i ' 1_ 11H111 WHL , 111 ! ii : 1111T- w ....i_j_.1...{....4_.[......4..4., ..4.3...; t _i__•1 .1•I..: 1. v .t. 1 ;i.i .1--.1 IF .,..-' 4 I;•H. .1 1-I• I ; 4-4--; 1 1 1 ; -.1-- , I ', 11--1---+ , t--; 1 i 1- 1 -..-i-t--; --I.-t 1- -4,---; I i-.1 rt•-•-1- t t I 4.......t...4 i_'v.:. t st. t i. t.....t t 1 .1 I I- '-4,- I;;;;t•1 +.-I.• •;;I. .4-4-1 Li. I .k. I i• t . , ' H•-1 ! -,,s 1. F-f- 1 -1 .1...L...;kit 1 f:._,._ __41 ii ;Lit: it 1.....1_1_,1 1 1 .1._, 1 .1, 4._ ,. • t .1._1._,..., ; 1_14_ 1 , i , .1 ; 1. 1 4.1 .1._' -4- '.• I ' 1...t-.t.4 1. ! -1.--4- ' '- , -.1--1 1.I • ; ; 1 , ; , , : it : ! , , ii ! 1 . 11 , ' 14 ' 1 ; ; 111111411N ; , I 1 4.....1_• 4 1 1. 4_4 ' 1.-__L' 1. 1 1; T-1 1 4-4-4-4- • ' .1. • ; .; -.1:1 1 [...1.T.L..1 ..I. .1. ..4.11....; .,,, I ! [ ,,.. ;,1 ,L..1 1 I ..j...., .I_..1 .1 [! .I..ifi ! I I ! „.;_.'; I.,.. ' •I I....I _4_1 I ..I..I. I,.._I 1...I 1 4 i I .1 ' I ! ;_4_ ;_;;I: ; ; ; ;i;;;;;;;;; 4, 4,•;; i ,4„.„1_1.1 1 ,;_l__;;;_;„ 1 _1, 1 1,4_1_, 1,_,_; I_; 4 ; i_„„4 I ,,;_1_4_1_1,,,,,,1_1,,_I____,1_„.1,_i_ 1,_.,,Lis, ,_4____t_t_____,I,..;,_;_ i...I...___;_t_.4_4_1:_i__;__:._1...__I_..14.1_i__,.1._._.1.__1._ t. ' i i t• 1. '4„_•;...J t : 1..i .1 i 1 _1 _1 1 I._i. L.1...; .i .4 1 1 LT, 1..1 1 .J. 1 I 4 1 ! ' i...1 • 4 1._[ ! 1 '1,\" ' i....1._1-1. 1 ..4.1. j. _I_ I I ' ..!..4...! .1....,_ 4...k_1....1 .1..4 .1 I I 1 L...4._i 1. '...i...! .1...1 .., 1_1_ 1, .i. 1 1 4. i 1. Li __L I '_1 1_1_: ' i--- -4-4--1-; 1---[•-;--!--1,------1---,,- 1--1,--I-j,--i--1- - -1---.--i••!••7 i-1--••, '. •••-•••- -- ,-;" ; •"- - -I ; i1 ; : iii 111 ; : : i. 4_4 ; 1 . ! ; iiiilL; 1 ; HijIIII ,• _____, , ' -_-_,_--4 ' ; ; ' ;--;---4 . , 1---,-- : • , ; , ---- ---1--4- -1-, . ---, . . , , , , III ' III -44 : : 1 0 Ii I I, 1 ; ',. I_ .., .4,.. 1 I I I ! I. 4.1 I ! -.1 I I. I ...--; I ..; I.-4-.1....1_.I....1 ' .1....1.., _4 I I , ; I i, 4,,.., I d., _L.1 .4 d, , ..,.\\ ,, .._d_._d__I ..1 1., I ..1._I Li I1._.1 . I_L___ 1 I, ._, ...I...;.J......L....1. :.1._ 1. 1_1.i. ..1..1....1 .i. 1.....1..1_4.........1.1..1._.1.. 1 4... 11 L 1 4...i 4 44 ' I I .1.4 ; r 1.i . 1 _i_ i t i i .,_il J. I T.Hi 1 L.7_1 4. 1 I ..L.1_' 1..."...1....1-1., • Z -1 I , ',. 1.it IF i_ 1 1\ 1 I._L., 1.4 , _i_i_i_4_1_1 1, ;..1_,_!; ..., i_: [I if_!,, _i ,.'i : :-.: :. 1 ' "-;,;I ' ;---4--I-.!' 1 1 !---i-.1.i 1,---!!- i : 1,- ';'-'; ; .1--. -i- 1 I ..! ! ;;-; ; t i--' •-f- i ; '----; -t--; ' , L-I;1 , ; ;`; t 4.- .1; ;-I-i ;11 '; ;; 4; i ' 0 .i.-:- " ' L-i- --; I- ' _I_I 1 ,_4__i _l_.....:_i_1._..1.......L...1 ,....L....4.__Li..4_1_.:L...14...1,.. t 1--1,-i 1 Til- I •-1 -I-1 '••1- i t-I--I-- •-•••I, 'I-,-1,-I-.i•t••••1; I • -+ :- j t- I I-•-•4 „1 [. ,- ,- t-1 I-- 11 1 . r f I 1--1 .CD. ., I f.1 ! 1.4....111_4_1. t*C ' 1 1 r_i I i. " -I--. L-1-4--, .t. I -1- 11 . s ;--1- ! i FA: r ! -r---1-•I 1 ---1-•±---1 1-_,1 : ±-4---i- r 1,---4 4 , ; ; 1-1, I 4 4_ 4, I..4._-_.1 1 1._ 1\ 44_4 _t_LI 1 1_4_, -L,-I 1 1.-4-1-1 .4-.4.-4.4.--1 4 I- I-4--4-4- 1 _l_ 4 4 ., 4_ 1..., 1 .1 .1-4-.1 t 4.1..1 ; ; , I:Tsi .VI.2r.1.::. ._.L4J : ..1 '.; : 1 1_1.1_. ..F.1_41_4.4....1....L.4.-1........1 I 4_J.....4...1. 1 .1.4.I... Anik t _.1 .1.; .4_! [....1 11 il , , I ., ,,11 I-i ,L.- ,k - 1-1- !' L-11 F 1 t"Lrj "1 .-Hi 1.....1 1r1-1 ' ' ' I I-1--I H .1.I.-. i "I"I Fill i 1 I 1 I i 1_i1 i1. 1 CID i '1- i I ; ;""1 1 ; -.. 4 __...._.4...H____.__,...... It f\i 'kl- 1 11 ,-11 ; 11 Iij- 11• 11, ..I• 1 --1.- 1 ! ! * I 1 7 1 4 4. 1.. 1 , I .1 1 I__,___1. 1...1..1 ,1 k' .ti_IT , 1.. ,J J__, j. I I. .1__ - ••. ., , 1 , , : , ___ 1 i_4_,_;.i_.: _,__,.. i : . ,. .1 IE 1 1 LI ' ' -;- --I --4--1- I I -1-- I I -I\-4 t, 1, I I ! I --I J. II. I_.+_ k..1.___ 11 ' 111 ; ' , .i H. ......1 1 -4.-4--; I . i--4.---1--1-; 1 T-'1, 1 I 1 „ l_...__4_.1._.1_1.4.1.._1_4_4_44._ I_L __Li.J_N 1....1______i_j[i_i_4____1..._1_1......14.H._.1.....,_H_ 1.4_, 4 1 1_44_44.' 1; ' ..I___ ; II II ! , 1 i i I I' I li• I ; 4 1- 1` d :. ; ,,,,..1 [ 1 .1 t 1 • ,--1. ; 4 1-1 I 1.- , ,-,-.1-1 , '' , _...1....1_r,J 1 ' .I. 1 I 1 ; ! I-. ..--,• !--1--}-. ; , ; r I -I- 1--4-1-- - •-I.-----1-4-1-.4-1------1---;----1--r-i--r--4.---4- ; 1 I 14..47 . 4_4_ 1 i 4_4. 1 ; . .--;--4- . 4 • --,- 1-, 1 L\D ;_1..4. 1_4.r. 4 i___1,_1_4_4. it .. \ ; 1 ; 1_4_ ...4 I ; ; 1_4_4 1 .1 4_4... L ; .4 1,.. .;...1._.1....i. 1 L.1_1 .4 ; , ! ; ; , 1 , .,_, • , ! C.0 1 1 "',""1-'!'1 t-1 1 . ' 1-111 1 il- 1id• ' i 1 ! 1 ! : ! ! •1_,LIII I ; 4..-4 . ! , ! 1 I I '1 I [ I I'Q , 1_, ! 1 , , , , , i , c ; 11 ! : , ! , ' • , ; 1 • 'r-1 ; t- r-4:1 ' • ; 1 i i I , i Z I ' ' ' : 1-.1- 1-1-I. tr 1 '•- 1 • 1 -IIT 1 1 i ,---i-•f .1---1 •'I-1 ;--1 I 1.--. •;; , I I--! 1•1•; 1- -F-, ; 1 --L--1 .1 l•-•.1-1--r--t-'N J ' c) 1._ 1 ; I.L.1_11 I .1._t_d 4_ I I +-HI-- 1•-+ --i•!,--1 : II-I 1-.1---,--4-', I 1 1--, 1 1 ; • rn ' • . , , ! ! ! ! I ! ! 1 • ;..1. 4 ' . 1 4-1 ' 1-1 rG-T)1 -L.L. - " ""-"-- -'111- 1 !-- .-'... - ,---- .--I-i- H, i f\- ' I , i 1 , ' 71 1--; ,- ' •- -,--.L 4 ; 4._ ; ...... 1 ; .4 ,;__ ; I ! I I i . I -I. •1: 'I 1 1 T 1„ 1 i-1:-I !" 4 Z ' -I !L-, ",;I; • i i :-I -1-4-1 1 .'..--i 1-..i. 0 Ct, " al '"I C-71 .1_.„... _ : .. .. . .1 1_. • .' ' I.!, I 1 .i_ ' ,. .1 •.!.. LI.1_4_1. ! .1..J._ I ' [ L I ! 1 1 1.--L t• t---- -1-1-1 Q"."" -.-1-1- "--r-1.--c 1--r-IT-1-1-- --, , , , . i ., ' 1--' 0 0 -1'1-'1-1-1--",--+-1 ""- "4'-';"1"''' " , 1" I .1 ' • : 44.i ' .4.1_4_4_1 1__1_4_4._.4. f-i--1-.1- I -1--".\-\' 1-1,-.....si - ir'• -•"1- -. 1 -"-I I , 4-4 11 • I 't• 1 •""I11 "I ; 4 ; H -I 4-1 - •-- 1 I H-F-4-1 HI ' 1 -I , -L,\ i 1 1.Li 0 cn > m rn -< -< 7-- 1 ' j i 1 ; i ' 1-1---1-4-r-4- ; ,--i--4--i- ..-----1-1---i---LI + III ii m m --i--'-'-[---H---f- 1---1---- 1-1 i F- L-1 ',- ' -'. I --------1- i--1, 1 i---1-!--!---i ; i 1 -.--.-.1- i 1---; 4-•-f 'N-\ 1 1 I L1--4-_4 4... 1-4..1-I; -I-- ...1.•1...,1-.. i I.,. , -.4-4 i....1 4. ;14 1..-1-11H1.•11 I.J1.__I 1. H II 0 C° XI '0 ---I--1-1-1...4-1.1--.4_ ..4...4.._.4.4._ _1_4_4_,._.1 LI 4 1 1_l__I 1 1 1 4...1 4._.1. I__.1._..4 _.4.__I-L! 1 FILL_ ..,_ , „S„\' _,J. IL 1 1 ,...- _l___i_4_4__1_4_t ,..i. L.1 1 L41 '.. I I ....4. 'L...i 1 H.1....:_i_i 1,_ i---} 4_14 4 ! 1 1_4_1 4 1. 4 !.4,1 1 1._ 4. ,ct • 1 ..,_..1 1 4.4 4 1/4.d ° Orr ...-1- • , ,-- '',.... ..1...L..I. ,I, ;... I , ! 1.-- +-I 1 -I.1 4 I, .1 44-[. 1--t --'F--1 i j--1 IL I 1 ' 1---1--'14-1-1---L- z 0000 1 ' '. I ' 1 ii 4.....1.....i ,..1._ ..I. 1....11 Li i; 4 i ..,..1 .4_1. 1_,.. i I ..]. 1..1;_l_1..i ...21.X I._, ..;....11r.... .-i.0 , , ,_1..... 1 .! '••` 4- I I ..--. I--I,--1 I.-I.-I- ..-'1-4-- --I.-1--i---1-4,- I I-4 ! LI- , [ , 4-I , I I--II II- I I -I--4 , I- /-- I.,1 • I--I-I- -- v CJ 0 CD • ', --i-H-1-''-1,-'''''H-1. : I !--ji•'• : ; 1 -H ! I" '-4•", I J-1-j.--1 1 -1--1--f--1' ill I i i-- -1-ir I 1 4-1 L ! ! t li '•••! 1 ' I' 1- 1Di ... • 1 i .1 .1...; .4..4. I...;.I. I,.1 4. ,. 1 ' ; 4 ; .4.4 , 4_1..I 1 ' .1..1 1. 1 4 1_4..4. ..4_.4 1. i.. __,_.1.....1. I_i_, ,, i. 1\. 1-1. .,1 a X A m•CO ..k o FEDERAL EMERGENCY MANAGEMENT AGENCY _...„ FLOOD PROFILES cp KING -COUNTYr WA ._......_ co . 17 - AND INCORPORATED AREAS MAY CREEK .... ,:„:„....„..„...7 .._.............._____..:. ... Appendix C Water Quality Pond Design Barbee Mill Preliminary Plat Wetpool Volume WQ1 Step 1 - Wetpond volume factor,f: , Based on the Nationwide Urban Runoff Program (NURP). Step 2- Rainfall for the mean annual storm, R: Residential area: Impervious area=8.02 ac, pervious =4.89 ac R,, >047 , 1998 KCSWDM Fig 6.4.1A(p. 6-69) :�:.,.. Streets E and F: Impervious area=0.89 ac, pervious Step 3 - Runoff volume of the mean annual storm,Vr: =0.0 ac. Vr=(0.9A;+0.25At9+0.10Atf+0.01Ao)x(R/12) where: Al=area of impervious surface including and sf "t :�LOX Acre At9=area of till soil covered with grass,sf Ax{ 34�4489; Acre Atf=area of till soil covered with forest,sf fA `'=f0l 0 Acre tf; Ao=area of outwash soil covered with grass or forest,sf kAfoi,` ... 0 0 Acre Atot Ai +Atg+Atf+Ao Atot= 601128 sf V r = 15767 (cu.ft.) I Step 4- Wetpond volume,Vb: Vb := f•Vr V b = 47301 (cu.ft.) Check actual volume, V := pond 56902 using 3 foot WQ depth • Project: Barbee Mill Plat 8/26/02 H:\project\30200\30209\waterres\WQvolume98.mcd Barbee Mill Plat Wetpool Volume WQ2 Step 1 - Wetpond volume factor,f: , Based on the Nationwide Urban Runoff Program (NURP). Step 2 - Rainfall for the mean annual storm, R: AR':= 0:4Z , 1998 KCSWDM Fig 6.4.1A(p. 6-69) Step 3 - Runoff volume of the mean annual storm,Vr: Vr=(0.9AI+ 0.25At9+0.10Atf+0.01 Ao)x(R/12) where: A;=area of impervious surface including pond,sf A Fg="T i Acre Atg=area of till soil covered with grass,sf >A-' .r 33 Acre A =area of till soil covered with forest,sf �Y x t = i10' Acre Ao=area of outwash soil covered with grass or forest,sf r 02„; Acre A tot := A i +A tg +A ff+A o Atot= 95832 sf V r = 3012 (cu.ft.) Step 4- Wetpond volume,Vb: Vb := f•Vr V b = 9036 (cu.ft.) • Check actual pond volume, V := 11026 using 2 foot WQ depth - Project: Barbee Mill Plat 8/26/02 H:\project\30200\30209\waterres\W Q2volume98.mcd Water Quality Pond 1 CELL 1 ELEV AREA VOLUME VOLUME CHANGE SUBTOTAL FT SQ FT CU FT CU FT Bottom 17.00 ,15;,1!32,.-: 0 0 Top of Sediment 18.00 ';F-15,132 0 0 19.00 ',":17,666 16,382 16,382 20.00 ,'20,259 18,948 35,330 21.00 (.-22,913 21,572 56,902 Water Quality Pond 2 CELL 1 ELEV AREA VOLUME VOLUME CHANGE SUBTOTAL FT SQ FT CU FT CU FT Bottom 17.00 -883 0 0 Top of Sediment 18.00 883 . 883 883 19.00 : 1411 1,137 2,020 20.00 '-20;259; 9,005 11,025 Appendix C 30209\WaterRes\WQPondvol.xls otak 6.4.1 WETPONDS—BASIC AND LARGE—METHODS OF ANALYSIS • FIGURE 6.4.1.A PRECIPITATION FOR MEAN ANNUAL STORM IN INCHES(FEET) ST 1.1 ._„_,. r n LA 0.8 . 0. 1.0 p 2 ST 1.0/ LA 1 ST 1.0 9 'LA iT= / a !, �•/>. .r� ,s '.' '., ter` ./•/'`�,,Y1/A \ . r "G.v H..,.Rr -',„. Y " .--. - •` '--.+ /.._ ': f'I.1 ?3 ` ice•.: _ ---�. 0 • ram_•_-_/' _ ,? :1•i' }:-_ram_ � - o ^ : I;. _i ,.s v Ti _ _'X I�t,:!;;.s.: 'N., _ Y 1111 • �; ; `'; / _ 0.54' a l (0.045' ) O0 Q/ �., ' I 4 • i•v.,‘,..,.„,„;KC r.c.,7:,:5. ----s i .--lb, • 0.47" ` (0.039') , \ I • _7.ri Incorporated Area ._ River/Lake 0.4 7" \\ Major Road (0.03 9' ) 0.52" -----.-\\�' (0.043' 0.65" NOTE:Areas east of the eastemmost isopluvial should use 0.65 to.5 6" (0.0 5 4' ) inches unless rainfall data is available for the location of interest (0.047' ) 24 The mean annual storm is a conceptual storm found by dividing the annual precipitation by the total number of storm events per year result,generates large amounts of runoff. For this application,till soil types include Buckley and bedrock soils,and alluvial and outwash soils that have a seasonally high water table or are underlain at a shallow depth (less than 5 feet)by glacial till. U.S. Soil Conservation Service(SCS)hydrologic soil groups that are classified as till soils include a few B,most C, and all D soils. See Chapter 3 for classification of specific SCS soil types. Appendix C 1998 Surface Water Design Manual otak 6-69 Appendix D — Conveyance Calculations Areas Preliminary Calculation of Areas Draining to Conveyance System Total Road Parcel Road Area Road % Impervious Pervious CB No. and Parcel Area Area [AC] [AC] (AC) Impervious Area (AC) Area (AC) WQ1 1.35 0 0.27 0.36 0.99 1 1.92 20,949 0.481 1.44 0.65 1.42 0.50 2 2.73 27,343, 0.628 2.10 0.65 1.99 0.74 3 1.46 15,127 0.347 1.11 0.65 1.07 0.39 4 1.41 19,281 0.443 0.97 0.65 1.07 0.34 5 0.67 14,474 0.332 0.34 0.65 0.55 0.12 6 0.43 2,347 0.054 0.38 0.65 0.30 0.13 7 1.39 11,075 0.254 1.14 0.65 0.99 0.40 8 1.34 10,994 0.252 1.09 0.65 0.96 0.38 9 0.91 4,438 0.102 0.81 0.65 0.63 0.28 10 0.56 10,423 0.239 0.32 0.85 0.51 0.05 11 0.41 6,267 0.144 0.27 0.85 0.37 0.04 12 1.08 16,190 0.372 0.71 0.85 0.97 0.11 13 0.33 5,373 0.123 0.00 0.85 0.12 0.21 14 0.56 0.56 0.00 0.85 0.56 0.00 15 0.56 0.56 0.00 0.85 0.56 0.00 WQ2 0.11 1,306 0.030 0.00 0.03 0.08 TOTAL 17.22 165,587 4.92 10.66 12.48 4.74 Note: Percent impervious areas= Building and driveway footprint/lot area*100 Duplex: 65% impervious area was assumed for duplex(not including roadway) Town Home: 85% impervious area was assumed for town homes(not including roadway) 30209\WaterRes\Rational-SHN_07_25_02.xls Barbee Mill Line 1-3 Runoff Computations Using Rational Method (Preliminary) Barbee Mill Plat • Reference: 1998 KCSWDM Equations(Section 4.3.3) Definitions R=return period(years) l 100 PR=Total precipitation for R-year, 24-hour storm(inches) •':3:85 25 yr 100 yr QR=CIRA A=subbasin area(acres) From isopluvial maps(Figures 3.5.1C to F3.5.1H) aR 2.66 2.61 IR=aRTc-0R aR,bR=coefficient(Table 4.3.3.6) ,,;..2.61 QR=Flow for individual basin(cfs) bR 0.65 0.63 IR=PRIR C=runoff coefficient(Table 4.3.3.A) O.t 3 QT=Total flow for sequential basins(cfs) PR 3.35 3.85 To=Max of Tpipe+Tc prey,6.3,or Tt so=slope of flow path(ft/ft) Tt=L/60V IR=unit peak rainfall intensity factor To=time of concentration for sequential basins(minutes) V=kR(s,)o.s IR=peak rainfall intensity(inches/hour) Tt=time of concentration for individual basin(minutes) ' kR=values for Tt(Table 4.3.3C) V=average velocity across land cover(feet/second) L=flow length(feet) w . ctt.> ..< w ... , .. _-,..\., c_W .>e,.,..1\.w :r,-«+>..:=:: �..'g`'�`''avT. ,.?. ''}i: ,X.,-�r. Lt e. . . Basin a � "..,n _>. ,:.: �,- :,'�.',.�....>_,. , >'� .F�., <t'. tcutatio ..... . ..,. .., w<. ro,� >5::,•�y< �: 13 nS :7. - ___ t ..,. , t . .-�> _ _.. _.., -. _ _ .. . _ _>�,;'• _ CatC oil x°>�.. i,�' .T:, s.. 3 .... " a`_>.'a'� `..a < - \. , - ,:..>�..>,x xs`:.a.;b::=,.�-t•a.. .t t, h.. .z.ua ,R:,., -. , .rv,e ,,. ., _..v xm>. "-, S, <-a ..- _ - .. , .. a. ..,-. 'Y` �� _ w�;u. a,Y}•.:n.,.a<.«.a,. .x-. .. .. _ `x."v . .. .< .�,,. . .,..>.<.. ,<a<,�.,.. vw-,+t,.>,.,.,>:+..--..r,<....o ,a ,S,' �'.a= .«G2i :=:per . Basin C1 . _ t w .. .v. ...�...R. .% ., s :-"x':,a=`:its.-,. _.,. >a`:C� '.. �:o?' �. 3`aa :a `. ;xr'�,':�t�` �Z<'a.,� ?.. , xa ..._>��.. .. ery <"....�_e a,�.F,Perv�ous. .. . , „ . ^ _. ....,<-.� �,. .",r �,u «� �.a .��.. <�-<„. P ".. _« ._.__..,.-� - _ .. ...,... <a. -..., <.aa <. �s<...>a`x�. _a.�,>..-^... � .n_..-<.. �. a_,. �t:c. ., < < .. �>.�sx ... A ...<.,A2a,x: C. ac.-'-:k V :..-:L: ,>:. Tt To iR IR A QR QT Y;`.Lpipe iS::czn ::c>c:=':=F:i�sczrsz�€Spipe . -Vfull Qf >Qt_Qf �Vpipe ' '•Tpipe `�ToCB 14 0.90 0.560 0.25 0.000 0.90 20.00 0.0030 1.10 301 4.58 6.30 0.82 3.15 _ 0.56 1-.588 1.588 150 0.012 18 0.0030 3.53 6.23 '0.25 2.52 0.99 13 13 0.90 0.123 0.25 0.207 0.49 20.00 0.0030 1.10 460 7.00 7.29 0.75 2.87 0.33 0.468 2.056 460 0.012 18 0.0030 3.53 6.23 0.33 _ 2.70 2.84 3 3 0.90 1.071 0.25 0.389 0.73 20.00 0.0030 1.10 317 4.82 10.13 0.61 2.34 1.46 2.478 4.534 405 0.012 18 0.0030 3.53 6.23 '0.73 3.34 2.02 2 2 0.90 1.994 0.25 0.736 0.72 20.00 0.0030 1.10 601 9.14 12.15 0.54 2.08 2.73 4.123 8.657 436.5 0.012 24 0.0030 4.27 13.42 0.64 3.92 1.86 1 1 0.90 1.416 0.25 0.504 0.73 20.00 0.0030 1.10 422 6.42 14.01 0.49 1.91 1.92 2.668 11.326 375.8 0.012 24 0.0030 4.27 13.42 0.84 4.22 1.49 WQ Pond WQ1 0.90 _ 0.365 0.25 0.986 0.43 , 7.00 0.0170 0.91 179 3.27 15.49 0.46 , 1.79 1.35 1.027 12.353 117 0.012 24 0.01 7.80 24.51 0.50 6.70 0.29 Lake WA .. .,. ... < ...._.. _ :.�. ... .. x, ... > .. ,Late .. : ,....� v,a*. >w„ . .x „, . 3 <_.. BasnC alclations <_ . , . s,- x t « . ,-.=. a-ss � � -�^ � r� ,ad'� . � < _ a - " ,�x .; a �<�t �cre �� . 'G u >r < . \6 _i . . � v <. <.. .. te. ,r. x` F s 1 _ x z, .`. .� y.. ,. ...^> . i `_.-x.> . .. .1 ,, tt„ : w i . , I _C.� '. ,\" < � � <I` , g�{� . i. i ,� '� � i W a1 1 I I 1 1 I I I 1- I I I I l I I I I I I I a Sum Area 5.529 2.821 8.350 Total 8.350 Qt= 12.353 cfs Litlte.2 ... ...... ,<,,'.,. .. .....,.. >,_..,> >_ S � <t.._�,.... , i`;haYa �:«�:o" a , .�• _... s alculatwtt§. , t � . .< ,, ". .. �< .. .. <... `-� ,>•,_ >_.._ < t.a� a _, , x, ._. �ya��. . a<.x_ , >h. � ... � _ _.. _ .. � ,, ;Pi` Caletilatioit�.t . .. s w .,..,> ..:x .,.. .<... >> .. ,. :,...<. .....>.ra.".t. ^>."xx.`a>,..a_ . - ''>Z-<Q.., ,.z; =.>rY�,:'•s. t ,,e, <�svnt.. < _ envious .,.. t�.> _, .,_ .�. ~- .., „ ^. .. ....->_a_„` ,<a,..:,.a >n-:..` °.'-,<` •..o;u�. .....�'t<.... ,.... .??"L``. ,....zG. _ .........._,a,r,- .,-.<><.,. _- .`,�'-�" .,t .:.'.',na">'.: .,,". .;�a:,�. „� �'�=`�''� Basin Cl :•;A1-r C2 ;...:» «xA2 C k `:_•. .>.:>5 ' _ri: V L.,:..,a, T T I ::....,.,_:. s,::a` t c R R A QR Qr e`Lpipe_ r:c;nrrd=,c;.::,; .U -_`=;::Sptpee,'s Vfull Qf Qt Qf Vpipe Tpipe To CB 6 0.90 0.298 0.25 0.132 0.70 20.00 0.0020 0.89 178 _ 3.32 6.30 0.82 3.15 0.43 0.950 0.950 230 0.012 18 0.0020 2.88 5.09 0.19 1.89 2.03 5 5 0.90 0.552 0.25 0.118 0.79 20.00 0.0020 0.89 310 5.78 8.33 0.69 2.64 0.67 1.391 2.341 269.2 0.012 18 0.0020 2.88 5.09 0.46 2.41 1.86 4 4 0.90 1.071 0.25 0.339 0.74 20.00 0.0020 0.89 315 5.87 10.19 0.60 2.33 1.41 2.442 4.783 256 0.012 18 0.0020 2.88 5.09 0.94 2.93 1.46 1 < a w t '•ter_ ..;Caa-xu lat rat ., .. .....a <4` R--. ..c-, �'l...£. _aS......`vc .Sa, ...,-, ..,c .-, e > x } }, �t t _%,ia -:t°`.i;N�: :, . � ,n. ,.h.,.Bas f: < in_ attulations . . < .., , �. . ,. ....- - n-."".., - _. ... ...,. .... . . ,re <.,x_< ,a-a >-<a.'� <x>a a, a, t ,.1,. _v.... 6 .x<.._, r�:, °:3`.�<.,,,,i,pc,`,:>_ _<>, s .�. .,sue . .. _ .<.x.:.a;t,•x:„«..e> ..>.s». .. ..t <.t.' - .a,&<>. _. .. - .,> :Y:...,-"=..a>,x t=_: ,sue::" _-;�.�:a,�:�' Pi.. .< e a «, z .,,v... . x ._.> > ._ .x .t.z"<._x..�'<-<.c>,.a>a >,, ,-e-... t:..`i.`<x'.,rb' �_�. ' ?t - 'i£^:n . . ,. « s r .L, ,x � <..ao.>.t.. ..,...<<... <�..r..,. ;.<>.. ,.. m "«�.S a'. » ,'t. " , > 'i'3 . .. .. _ .." .},>. ...>,t ., ,max � <,..._.. .x:.`...,r_ �.> ., x ,_ ,�a,< :<r3 - ,ea-<>-^. a., a .,n . r..-ta v"",>x..-,_>.. ...,. ex_..a>._.. .. .. ,.. > s,> t- ?� �, <a\ ..... > •v, fie. v��o-.v.ta.` .a. » ,_. ,., .`.-_ w._. ... ._ .. R .," .. "xs. '.„}' -Y'"c..-,ev,v ..> >, ` \. .. -, 5 a ..., t x. ,z .^,a.' ' -e.. <.. <. .,. .Sna =_o _ _ _ ,W..?.., t • s , a` a . _,.... .,>av,t-< -_�,.... `.,t-n`<:?'>.,,_.�,<,s>�,\'`v- as<.-nM .G, t.. , ,> <, - a.f-r-.a,•<,.:,,as .-, -, ,,. • .<,, , Fw`s_v dn''^<:+, 3sro ,ax"`>;f4- f:',<`:..:}�..;__�.<��V,.',° �x,�<,.'- -a..wi^.'n:<',,«'>...,,x..m: YaF:=."s^,.a•FE�' ,«t.:"S4,_.'.,,°,�.->.=c'•n.-,..,:.'=�\:.:..'Y,:Y.2\,`..<�,�,^1 I I 1 I I I I I I I I 1 I I I < I I I I I I I I I I I Sum Area 1.922 0.588 2.510 Total 2.510 Qt= 4.783 cfs - . , .u. ...1`.;.... + h kt a� aert'd «x a _- rC. `\.o..`e n.r.eSs� . ` .�i , ....::>Yx%_�-»•a.x a _,,e . ...t.>.,..._, � . .\....<„,i,..ov . . ._ - i ...- - :a-. . „. � ;v.Fx>:.".,..`�.. �: K ��6iv.. �": `jyPi C.�<-, a c la ta ' _.._. - %< ...°.+^.=><,r �,, . �-' , <� � . hP z.-. T a > � c_ P O U ` .,_. x ,._. . , 2 a._. i „u- . a< � ...>>� ,. ...,t.,C_�.>"?.x� � _i... a:. - .ti,q » __•z» . .<. •�E ',�m _ ,,,1 =�-: - _ ��:-wxa ',.i:s 4-, . tT :- � > �' { ::>.`F � i>: �t3e°im..<;';"i,-�>.k..~.t Basin Cl ».A1.... C2 A2. Cc rkR: so.,; V :.'L<: - Tt To iR IR A QR QT .'.`Lpipe";: i cna"; ::'1::;D:= :Spipe:: Vfull Qf Qt_Qf Vpipe Tpipe To CB 9 0.90 ' 0.627 0.25 0.283 0.70 20.00 0.0050 1.41 200 2.36 6.30 0.82 3.15 0.91 2.002 2.002 48 0.012 18 0.0050 4.55 8.05 0.25 3.23 0.25 8 _ 8 0.90 0.959 0.25 0.381 0.72 20.00 0.0050 1.41 332 3.91 6.55 0.80 3.08 1.34 2.948 4.950 304.2 0.012 18 0.0050 4.55 8.05 '0.62 4.13 1.23 7 7 0.90 0.992 0.25 0.398 0.71 20.00 0.0050 1.41 311 3.67 7.78 0.72 2.76 1.39 2.740 7.690 210.9 0.012 18 0.0050 4.55 8.05 0.96 4.65 0.76 4 =1.d'tend - '.�-.. c--' ..:,_ -, ',;;_ :�-,..�::. '.>; � - Sits'Catculatio•" - _ _ . x..ate, �t, -,,,- » ............. �=.„` .er:� <>.:>.<. <..t.>n._`.-..., ... ., ttS �'��: %:: i'--s:.;Lr:. �.:r`` ;.r, .a�gr." \<:a- _ _ pe, _ .._., <. . .>... _. _ . "<�..x ..._. z?�.`.w..>, .` .. ,_., ..• <<.: }.<,�:-;ra:'. ��' - ram. `.�„�� `t« `q'tza > t .. ,n l _ r t ..-r* r c_,r,,r^a. ><e ,r_ <«, <>. .. _., -..,,._.x ., - :to <`.•' >.T'i. a., x_ .t.<>-x `.. .-a., `..- ., a_..v. -r _. .. w < - ., t e. ._ ry .,,;: t..x ._fir, v-<„,; I I I I I I I -.. ,x : :..�. . ..,. �,�p :�_ .:>�:� I _ ._ I .. I I 1 ..". ,. I .``_ I I >.�., ., I• �.. ..,.�,.- I I I I I I I I I l Sum Area 2.579 1.061 3.640 Total 3.640 Qt= 7.690 cfs 302091WaterRes\Rational-SHN 07 25 02.xls Barbee Mill Line 4 Runoff Computations Using Rational Method (Preliminary) Barbee Mill Plat Reference: 1998 KCSWDM Equations(Section 4.3.3) Definitions - R=return period(years) ,100 PR=Total precipitation for R-year, 24-hour storm(inches) 3.85 25 yr 100 yr QR=CIRA A=subbasin area(acres) From isopluvial maps(Figures 3.5.1C to F3.5.1H) aR 2.66 2.61 IR=aRTc-bR aR,bR=coefficient(Table 4.3>3.B) '2:61 QR=Flow for individual basin(cfs) bR 0.65 0.63 IR=PRIR C=runoff coefficient(Table 4.3.3.A) .: 0;63 QT=Total flow for sequential basins(cfs) PR 3.35 3.85 To=Max of Tpipe+Tc prey,6.3,or Tt so=slope of flow path(ft/ft) Tt=U6OV iR=unit peak rainfall intensity factor To=time of concentration for sequential basins(minutes) V=kR(so)°.5 IR=peak rainfall intensity(inches/hour) Tt=time of concentration for individual basin(minutes) kR=values for Tt(Table 4.3.3C) V=average velocity across land cover(feet/second) L=flow length(feet) r . > r � a r .. _ ._ ., ..<- ..a. . wart \a:•,-. ..� `-�>" r`>a• �. _ < f h e ....<.. >=.a. h <,>r:„<......,-<,...0 _a>aa ->.. �>,, a>-.. ;x>q.. ;e,,, aaC•. - y,aa. t , @ `-`k "�_..- .."...._, ,. e� .,. ..>....5•.c,.. 3.ro . s4ft _n.. >Y<.. .,m _a _ a .a..w SUa, .�`�. .Ra'._ �i ••.Y .:. _ +-.. ., t. - .... '� ... }t. r x .. S`�R > a » va-a>u_.> ....a .._ ,�v e `G.> V':i" a3:`. �:':�,:�> S- , >r F. »y.. . .�,- ,... ...,. , ,o,.a- _. Di7JI)�CICt{iUI 4< , $,.-a. .._c .a.a ,.aa> an. ., ..a 3�� xrD> X'. xF �t•:.e ,.. <, at) p �� s, x ><<e - 8tlo<,�. G- C �• <a,- ., a...ter•. ..,-.,:.« a x. ,xa b n-. ..1..�_. ',v,` w,.� �: $a" .� ..G..+z• _ �, .:.T>�Sxx ti•: _>.-.. ,�. _Jr.> »:' , ,\\„4_< <�. S'elErn.>.,.._ _ Ya&;aqa< _ "<�-: e_ .. _... .. _.>.....s s.«>x,_>..'��...<:'?a �<>. ,.,..a ,. � .. r: ..��. .a,,<�.. z.. ....,:_s�..<.<- ,...C�x�, z-.. .«,� >$,>,..,.5. :'�:a x?� .�.... -.tea. w. .a,. - .... x ,, s ... aa>., y..>,-„y,.�3 .«., n>_ x_, a .. ...> r:<., ,...-�.^>_.<>... ...<:i'.'�<..�x.x i raY':' _a e a # � .y � :<•«e.-x<>'�.<.s;=& >�- es=u.>>�:,x -Y�3s<..r-�..,.�..`. 3., �,>...>. � p�q fi. .< i - .,t.a d.. > _. .v .. .. ^ .. .. _ .. _t ._ ... •. .tea 2::= ,`:>'i.. �,� 8 .. < <n ., v 4. .:�•.X'v. - _ �_ '--_eRxi= -=`Lr-. -aLii��._:i� • `-'a:w < _.5 .... `tea- +. .,_:..a,.c..taao,<: '@c. =,.�:«'c°3.<< ;., a .,1 '>i"... '•��.r' < x _.I .a, a-,. _ `F._>a. .._.>»..a........-..��c>,...<._ :>F.�a�_.«...�.....-«.�.> .<„<„ Iro .,...»,,...�..',x�. ...:n.< -<^ ..>:3". ... 7 ry2- .._ ta.`s�:'��z�`��^'"� �'< /�+M ^.av..,,,.. a, 'T<�4` zz^.._ Y^,.<3�-::>,'a.=�-..:.^...k.,\.. -- ... <. '?i:.=d:•i$r�>.ig: .. i^:- s saM•�.,<•>'t' .x.w "' `R�" Basin Cl >;:;:A1:.>c,: C2 „x,,..A2::;:;;: C pipe V c o R R QR QT .Lpipe F.` _'_n�;::;.a.� :D - ::.;S•pipe;'-:: Vfull Qf Qt Qf'. .Vpipe .Tpipe>• To CB ...... .. ....>.... ... a <^ 12 0.90 0.974 0.25 0.106 0.84 20.00 0.0050 1.41 383 4.51 6.30 0.82 3.15 1.08 2.846 2.846 546.7 0.012 18 0.0050 4.55 8.05 0.35 3.55 2.56 11 < 11 0.90 0.370 0.25 0.040 0.84 20.00 0.0050 1.41 217 2.56 8.86 0.66 2.54 0.41 0.872 3.717 158.9 0.012 18 0.0050 4.55 8.05 _ 0.46 3.82 0.69 10 10 0.90 0.512 0.25 _ 0.048 0.84 20.00 0.0050 1.41 192 2.26 9.56 0.63 2.42 0.56 1.146 4.863 133.2 0.012 18 0.0050 4.55 8.05 0.60 4.11 0.54 WQ2 _, .... .Sac v \'?a,_.+ `•>. S. ..... .. _ .\. : `>: ! ,..R :• » r .}. _ .... .>. e a Z..,a>eew a_..� . ...s. -....• ..\` .RZ.t .a R�...ar<'•� Z¢^\� .. _ `�.. ?, .,.... "� , , . 1, , .. "S z ,x._a.¢<-->,-•.�:-`. �cw„�1,- .<"'�."..,.v Late .. . . . ,. -, ,..,, _ a a M ._.. ,x. . ,a. .... .. ». . s . x. >a _ � ,.. � � icutatio `;ix,- ,_,..F-< rc.a>,_ .., ,vim. .m a x ,> e aexa .. .> _ .. � x l .e _,aa .._.., r.>j.. .,e.� _ .�::L'$A vm,<. _=<m¢.•^::r,.-., .. < ,,., .. �z. .�.. .. ..., r_ _.. .. i �. -.<_, ..... ..3-n ,,.`tea:. ....-aa..,._ _. .. .x> <..�. ..\. .:< .a. ,., .a aa ,_ a4... x..._,. <.-e .^n.^x<��. z^ .er �'^ > Ala<. ... ... > ."l_-. <3i 1. �. ., r �>+. .,,, _ \ c.. . ,_. .. <.. , -n.. \ ;;LL <x\ ,., 3 •X-.., ,. a e ..-. -... < ... r. m,e._ .__v.«.. a ry .A::� :.4:, - < _..x _,sN, :c, c<x2 m< 'C, x� a a. ?,-;< K ->. .- >� .✓,. "a _, .> w. .T \a. F. ,^ .,t\ a I I I I I I I L I I I I_ I I I ._ .. . I ,.a I. l . . ..,., � _� ..� ::Iu< ,I: ,�.. I I:� Sum Area 1.856 0.194 2.050 Total 2.050 • Qt= 4.863 cfs 30209\W aterRes\Rational-SH N_07_25_02.xls • Barbee Mill Backwater BACKWATER CALCULATIONS (Preliminary) Barbee Mill Plat Submerged Critical Velocity Specific Head- Head- Total Inlet Outlet Pipe Full Full Depth Barrel Tail- Friction Entrance inlet depth at Head @ Entrance Exit Water Water Approach Bend Junction Head- Inlet Pipe Pipe Pipe Pipe Pipe Manning Barrel Pipe Pipe Design of flow Barrel Velocity Water Head Hydraulic Threshold of flow Critical Critical Head Head Outlet Inlet Velocity Head Head Water Rim Rim PIPE SEGMENT Elev. Elev. Length Slope Diam. Coeff. Area Capacity Velocity Flow in pipe Velocity Head Elev. Loss Grade line Equation in pipe depth depth Loss Loss Control Control Head Loss Loss Elev. Elev. minus From To L S D n A QF VF Qd dd Vd Hv TW HL HGLE 1Qd/AD05 2d. Vc HC 3HE Hx HWo 4HWI 5HA 6HB 7H.i HW (Rim) HW Elev. CB CB (FT) (FT) (FT) (%) (FT) (SF) (CFS) (FPS) (CFS) (FT) (FPS) (Fr) (Fr) (FT) (Fr) , (FT) (CFS) (FT) (FT) (FT) (FT). (FT) (FT) (FT) (FT) (FT) (FT) (FT) Line 1 . 1 WQ1 20.10 20.00 50 0.20 2.0 0.012 3.14 11 3.50 11.33 2.00 3.61 0.19 21.50 _ 0.10 21.60 2.55 1.19 6.19 1.78 0.10 0.19 21.88 22.01 0.17 0.01 0.03 21.88 23.00 1.12 2 1 21.00 20.10 345 0.26 1.5 0.012 1.77 6 3.30 8.66 1.50 4.90 0.17 21.88 0.90 22.77 4.00 1.12 6.00 1.68 0.08 0.17 23.03 22.96 0.19 0.26 0.06 23.16 24.00 0.84 3 2 24.00 21.00 584 0.51 1.0 0.012 0.79 3 3.53 4.53 1.00 5.77 0.19 23.16 2.99 26.14 5.77 0.89 5.37 1.34 0.10 0.19 26.43 25.99 0.33 0.02 0.12 26.24 26.50 0.26 13 3 27.00 24.00 342 0.88 1.0 0.012 0.79 4 4.62 2.06 0:60 4.09 0.26 26.24 2.35 28.58 2.62 0.60 • 4.40 0.90 0.13 0.26 28.97 27.97 0.15 0.05 0.08 - 28.96 29.50 0.54 14 13 28.50 27.00 301 0.50 1.0 0.012 0.79 3 3.48 1.59 0.61 3.11 0.15 28.96 1.19 30.15 2.03 0.53 4.13 0.79 0.07 0.15 30.37 29.33 0.20 0.01 0.11 30.29 31.00 0.71 WQ1 LW 29.10 1.0 4.00 Line 2 4 1 20.54 20.10 221 0.20 1.0 0.012 0.79 2 2.20 4.78 1.00 6.09 0.08 21.88 0.44 22.32 6.09 0.92 5.44 1.38 0.04 0.08 22.43 22.69 0.23 0.31 0.08 22.84 23.50 0.66 5 4 22.00 20.54 241 0.60 1.0 0.012 0.79 3 3.83 2.34 0.74 3.70 _ 0.21 22.84 1.35 24.19 2.98 0.64 4.55 0.96 0.11 0.21 _24.51 23.05 0.08 0.00 0.03 24.47 24.50 0.03 6 5 22.50 22.00 227 0.22 1.0 0.012.. 0.79 2 2.31 0.95 1.00 1.21 0.02 24.47 0.14 24.60 1.21 _ 0.41 3.63 0.61 - 0.01 0.02 24.64 23.13 0.05 0.00 0.03 24.62 25.00 0.38 1 23.00 1.0 3.50 _ Line 3 7 4 21.00 20.54 87 0.53 1.5 0.012 1.77 8 4.68 7.69 1.50 4.35 0.29 22.84 0.39 23.23 3.55 1.05 5.82 1.58 0.15 0.29 23.68 22.76 0.29 0.01 0.07 23.47 24.00 0.53 8 7 22.00 21.00 190 0.53 1.5 0.012 - 1.77 8 4.68 4.95 0.93 4.21 0.28 23.47 0.81 24.28 2.29 0.84 5.21 1.27 0.14 0.28 24.69 23.34 0.15 0.01 0.06 24.61 25.00 0.39 9 8 23.50 22.00 309 0.49 1.0 _ 0.012 0.79 , 3 3.43 2.00 1.00 2.55 0.10 24.61 0.82 25.43 2.55 0.59 4.37 0.89 0.05 0.10 25.58 24.45 0.00 0.00 0.00 25.58 26.00 0.42 23.00 1.0 4.00 Line 4 10 WQ2 19.67 19.00 133 0.50 1.5 0.012 1.77 8 4.57 4.86 0.94 4.11 0.26 20.50 0.54 21.04 2.25 0.84 5.19 1.25 0.13 0.26 21.43 20.99 0.15 0.01 0.03 21.31 23.00 1.69 11 10 20.46 19.67 159 0.50 1.0 0.012 0.79 3 3.48 3.72 1.00 4.74 0.19 21.31 0.79 22.11 4.74 0.81 5.11 1.22 0.09 0.19 22.39 22.02 0.19 0.25 0.03 22.49 28.00 5.51 12 11 23.20 20.46 547 0.50 1.0 0.012 0.79 3 3.48 2.85 1.00 3.63 0.19 22.49 2.72 25.21 3.63 0.71 4.78 1.06 0.09 0.19 25.49 24.39 0.31 0.42 0.17 25.77 28.00 2.23 24 1 4.50 - Note: 1) QF/AD°.5<3.5 =>unsubmerged inlet contol condition. 2) Determined from trial and error method of solution to Q2b=gA3,or from DOE drainage manual(Pg.III-2-39,Figure III-2-19), An approximate solution is calculated for circular pipes by Dc=0.420(Qd)°.5/Do25) 3) Entrance loss coefficient is from DOE drainage manual(Table III-2.3,pg III-2-21), Ke= 0.5 • 4) Constants for inlet control eqns from FHWA charts. See DOE drainage manual(Table III-2.6,pg.III-2-31). Using FHWA Chart 1,Monograph Scale 1: K M c Y 0.0098 2.0 0.0398 0.67 5) Set the upstream approach velocity head to zero,if the upstream pipe is significantly higher or lower,than the entrance to this pipe 6) Bend Head loss coefficient is from DOE manual(Figure III-2-5,pg.III-2-12). This coeff is structure specific,vary Kb at each structure. If you assume pipes are not installed exactly linear in alignment,upto 10 degrees of deflection Kb= 0.05 7) Junction headloss coefficient is from DOE manual,Kj=(Q3/Q1)/(1.18+0.63(Q3/Q1)) Project: Barbee Mill Plat Otak No.: 30209 Page: 1 - Date: 826/02 By: SHN Filename: Backwater-07 26 02.xls Appendix E — Upstream Basin Bypass Analysis • It A we- BACKWATER COMPUTER PROGRAM FOR PIPES Pipe data from file:offsite.bwp Surcharge condition at intermediate junctions Tailwater Elevation:19.5 feet Discharge Range:15.1 to 18.1 Step of 1. [cfs] Overflow Elevation:29. feet Weir:NONE Upstream Velocity:3. feet/sec CB10 TO OUTLET TO LAKE WASHINGTON PIPE NO. 1: 28 LF - 24"CP @ 1.46% OUTLET: 18.24 INLET: 18.65 INTYP: 5 JUNC NO. 1: OVERFLOW-EL: 22.15 BEND: 80 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* Z 5 r-=0,15.10 2.28 20.93 * 0.012 1.41 1.02 1.26 1.26 1.41 ***** 2.28 16.10 2.40 21.05 * 0.012 1.45 1.06 1.26 1.26 1.45 ***** 2.40 17.10 2.53 21.18 * 0.012 1.50 1.09 1.26 1.26 1.50 ***** 2.53 too 2.68 21.33 * 0.012 1.54 1.13 1.26 1.26 1.54 ***** 2.68 CB20 TO CB10 PIPE NO. 2: 100 LF - 24"CP @ 0.85% OUTLET: 18.65 INLET: 19.50 INTYP: 5 JUNC NO. 2: OVERFLOW-EL: 23.50 BEND: 90 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* 15.10 2.48 21.98 * 0.012 1.41 1.20 2.28 2.28 1.73 2.48 2.38 16.10 2.71 22.21 * 0.012 1.45 1.25 2.40 2.40 1.96 2.71 2.51 17.10 3 .01 22.51 * 0.012 1.50 1.31 2.53 2.53 2.17 3.01 2.65 18.10 3.32 22.82 * 0.012 1.54 1.36 2.68 2 .68 2.38 3.32 2.82 CB30 TO CB20 PIPE NO. 3 : 120 LF - 24"CP @ 1.72% OUTLET: 19.50 INLET: 21.57 INTYP: 5 JUNC NO. 3: OVERFLOW-EL: 25.57 BEND: 60 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* 15.10 2.12 23.69 * 0.012 1.41 0.97 2.48 2.48 1.41 ***** 2.12 16.10 2.22 23.79 * 0.012 1.45 1.01 2.71 2 .71 1.45 ***** 2.22 17.10 2.32 23.89 * 0.012 1.50 1.04 3.01 3.01 1.50 ***** 2.32 18.10 2.47 24.04 * 0.012 1.54 1.08 3.32 3 .32 1.81 2.47 2.45 INLET TO CB30 PIPE NO. 4: 10 LF - 24"CP @ 27.90% OUTLET: 21.57 INLET: 24.36 INTYP: 5 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* 15.10 1.85 26.21 * 0.012 1.41 0.47 2.12 2.12 1.41 ***** 1.85 16.10 1.97 26.33 * 0.012 1.45 0.48 2.22 2.22 1.45 ***** 1.97 17.10 2.09 26.45 * 0.012 1.50 0.50 2.32 2.32 1.50 ***** 2.09 18.10 2.24 26.60 * 0.012 1.54 0.51 2.47 2 .47 1.54 ***** 2.24 BACKWATER COMPUTER PROGRAM FOR PIPES Rebsv.k '5 TO`r Pipe data from file:offsite.bwp 1 Surcharge condition at intermediate junctions Tailwater Elevation:19.5 feet Discharge Range:15.1 to 18.1 Step of 1. [cfs] Overflow Elevation:29. feet Weir:NONE Upstream Velocity:3. feet/sec PIPE NO. 1: 28 LF - 18"CP @ 1.46% OUTLET: 18.24 INLET: 18.65 INTYP: 5 JUNC NO. 1: OVERFLOW-EL: 22.15 BEND: 80 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* **************** OVERFLOW ENCOUNTERED AT 15.10 CFS DISCHARGE ***************** ************** ACTUAL OVERFLOW MAY OCCUR AT LESS THAN 15.10 CFS ************** ******** ********* OVERFLOW CONDITIONS CALCULATED ASSUMING SURCHARGE CONDITIONS 2 S ��a�115.10 3.98 22.63 * 0.012 1.41 1.50 1.26 1.41 1.52 3.30 3.98 16.10 4.39 23.04 * 0.012 1.43 1.50 1.26 1.43 1.59 3.62 4.39 17.10 4.82 23.47 * 0.012 1.45 1.50 1.26 1.45 1.67 3.96 4.82 .418.10 5.28 23.93 * 0.012 1.46 1.50 1.26 1.46 1.75 4.31 5.28 IOU PIPE NO. 2 : 100 LF - 18"CP @ 0.85% OUTLET: 18.65 INLET: 19.50 INTYP: 5 JUNC NO. 2: OVERFLOW-EL: 23.50 BEND: 90 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* **************** OVERFLOW ENCOUNTERED AT 15.10 CFS DISCHARGE ***************** ************** ACTUAL OVERFLOW MAY OCCUR AT LESS THAN 15.10 CFS ************** ******** OVERFLOW CONDITIONS CALCULATED ASSUMING SURCHARGE CONDITIONS ********* 15.10 6.96 26.46 * 0.012 1.41 1.50 3 .98 3.98 4.89 6.96 4.27 16.10 7.89 27.39 * 0.012 1.43 1.50 4.39 4.39 5.54 7.89 4.72 17.10 8.88 28.38 * 0.012 1.45 1.50 4.82 4.82 6.23 8.88 5.19 18.10 9.93 29.43 * 0.012 1.46 1.50 5.28 5.28 6.96 9.93 5.70 PIPE NO. 3: 120 LF - 18"CP @ 1.72% OUTLET: 19.50 INLET: 21.57 INTYP: 5 JUNC NO. 3 : OVERFLOW-EL: 25.57 BEND: 60 DEG DIA/WIDTH: 4.0 Q-RATIO: 0.00 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI ******************************************************************************* **************** OVERFLOW ENCOUNTERED AT 15.10 CFS DISCHARGE ***************** ************** ACTUAL OVERFLOW MAY OCCUR AT LESS THAN 15.10 CFS ************** ******** OVERFLOW CONDITIONS CALCULATED ASSUMING SURCHARGE CONDITIONS ********* 15.10 8.28 29.85 * 0.012 1.41 1.25 6.96 6.96 7.00 8.28 3.48 16.10 9.68 31.25 * 0.012 1.43 1.50 7.89 7.89 8.22 9.68 3.82 17.10 11.17 32.74 * 0.012 1.45 1.50 8.88 8.88 9.52 11.17 4.18 18.10 12.74 34.31 * 0.012 1.46 1.50 9.93 9.93 10.90 12.74 4.56 PIPE NO. 4: 10 LF - 18"CP @ 27.90% OUTLET: 21.57 INLET: 24.36 INTYP: 5 Q(CFS) HW(FT) HW ELEV. * N-FAC DC DN TW DO DE HWO HWI Co 1-114.tti.-e 0� _ ******************************************************************************* **************** OVERFLOW ENCOUNTERED AT 15.10 CFS DISCHARGE ***************** ************** ACTUAL OVERFLOW MAY OCCUR AT LESS THAN 15.10 CFS ************** 15.10 7.23 31.59 * 0.012 1.41 0.52 8.28 8.28 5.67 7.23 3.56 16.10 8.89 33.25 * 0.012 1.43 0.54 9.68 9.68 7.09 8.89 3.96 17.10 10.64 35.00 * 0.012 1.45 0.55 11.17 11.17 8.60 10.64 4.38 18.10 12.51 36.87 * 0.012 1.46 0.57 12.74 12.74 10.20 12.51 4.83 i \) ' r _ __ . ___, , ,- . . ,. .. • • _ . , .-.- '.---, / - ,,,, F% : `,4i ly. M. ... OO is ' `-t' 4 •• , <•Y • f may► "r y"ZY ,, i ( f IIJJ ! If • .:.r. q a' /rl / 1 ��y1 \ X/ ,��; 102 � • 16, •!lin.i.., . ----- „...._-------- .----.::::::------f"' . ' 1. / \ Nil/ :..,.......\./.„ - l'~ , • 9A ,11 y`�0:: •Q►00 , l7C i 4G / `, ��_ 't 1k,\ /� \ �'IP.GI0. • • �a� �1 1 r,,,. s /„/ u• :l/ / WA eiev 5. l ' 1,40��/ Q // // / .` V. ! i � ' Tp- X. /, / f s ' . x 7.':;z1._ / ' '' * 0.A41"-44 4tior:.,!":1'''' 9 5 • C. ......., . 13 A...,i: /.,41."000itap000pi, /}1111r; Nr.,,,-1„,--, .., _---- .i. e' ./ / /*/ • \\\ ' /,''''''*' „ / I ./ / , .., i ,..., t` T--- s Rap_ Ili f ,'' / a.r fotr�ee/ Mill . ,,,., ' /'/ • . .tA .j� f •1 7tlu4 } l /c ^ /Y /OZ N. 40TH STREET / MEADOW AVE. N. STORMWATER SYSTEM IMPROVEMENTS DRAINAGE REPORT Prepared by: City of Renton Planning/ Building/ Public Works Department Surface Water Utility May 1998 (Revised October 1999) // __ ///,.//,/ cl_ _ 01Y ii/ i. ....._ : _ i r SE loth j df 2 ^ 7'12V. - •' I ft MIR li _ _ 4' 4 -- / , • -,,,,i Millpii_ 1 - Project Location / % � ai >1 - /, EtuSt { ¢ NE 40th S11 -1 - 4q JIi4r i \\ E 36th ,J__- -1-- - . /3 B��awaiiiii iaraf� MINN , ' ' > ,L,; 4 EA a iiiilniIiiIc�Ft- .ilEh ut;ur c, l f - tg.";7711111:1 ; I 0:i tt 4i71— grammillip o \ � NE31stSt i I 0-1-74411 Mt Wis-Ag+.I , 1 I� 1iCM, l� '1'P�i� Ht I Nl3Ut1k ► ILT 1 - kork'�\ , 1 I► 41, SDI Ii 4 \\Ab, 1 _ - - A, \. rn r*i I: II ��f # :th St . \ \ ,/ 11 blailli ..11.11101111/11111. illauliqTt \ Ella" VA AT �� t i `- :_ uivapos: Ir. \ ', \ fl ■ a ° ilm6■: rwr°� ■� i Ica 1 l i tilririMriiilaffill - a ri,i ill ...r. ,.. _ - \ \,,t- .. ,. . lob . -, - .. .. - L_____, I-\\; { I-o :, _ ,. ,,, \ ,_ ,11,,>,- , . ,its 11............. ....1Hro' \\\ , M... MIRA --"--[ Project Vicinity N 40th St./ Meadow Ave. N 0 1000 North Storm System Project s t Scale: 1 Inch = 1000 Feet City of Renton Surface Water Utility D.Carey 1/99 ,_--_-/ c_z . ./ ...I to"//' - L„�.__ 7. - •—.,__K.,/ I' 4/410111M‘: - y .r• Ir � 611411411,0• ` ..,A, / zyi/ wimo, 0 CI me r'' ti\I /--). Z' AIPIAli *If 11114:Ma ' 11 41111#21. 11: 1 ' is. 7 •: alliallfaarair441 ° , f7,N. NI I moil ii till ll'ili . 1! , 7_0.. �'cl. / iiri, ,•A :le, . ...1.. . 0� tr.I tI 1.18 a, I 1. `� 1 I I x j/ ov A. 1 y X rz L -.r 4 / -/ k i _____ . . i2.5 . 0 rx 1--cc 1 If ' #ii ///1104,—),..___ .. Ill& .. L— ----_-?4, 11 : / ////// i• .6. 0~1a111.11PAy ? 1 ---- • . • ' ' / icillft # 11 I IS WAIIII I 4 . II I . --/X' i 4 i \I:lap � I 5 : 11 ri./ 0 IL , , • . w-ff Al iii 7.814, )7%. -VA4 . .16 • o(,.. . , `er irpear7. ( - I ' . .1 ;11 'Ii$ 1,11 K� E 8T TH ST. . ii ii.,_ EH-. '''.2, sci %oil 1 '1_' = I: : ' fr7 — — - 1 % — 31 ■ rx 1 , 1 . D AI I i II I 1 /_ 1 R■ XP • ___11 ) I • S E. 8'Tit 1. 7 4t � ' � I I- 1 i I i I! • E. d. ST — : 1f — ❑ • I I— a I1 1 11 il II No 0 ien k I o �, . II riii ■ Il _ , J S. E. _ TM S �— — ---- ----_ x 2O7x x r • _11 I I Li III ,-- - n . °air 10. , o r'11-1) 1 i_ Drainaje Su b6asins r , SECTION 3 i' FUTURE CONDITIONS DRAINAGE ANALYSIS A. Future Condition s a density of 8 , The CityComprehensive Land Use Plan identifies the fa as uture residential con with the basin was Using8 DU/acre for potential i � dwelling units per acre(DU/acre). analyzed as follows Impervious Area (acres) Pervious Area (acres) Total Area (acres) 18.62 12.42 31.04 potentialount for any stormwater detention systems that may be The analysis developments in the drainage basin. required forP 1 I Pro osed Drainage System I The proposed drainage system schematic drawing is shown at the end of this section. The ed system would start at node 2, in Lake Washington Blvd. The new outh side of system 40th Street p stall y the s installed from Lake Washington Blvd. to the east, along new (replacing the existing 12-inch system), to Meadow Ave. Meadow toe., the Street.system would be located on the east side of the street and wouldunto the to extend to N. 36th Street to allow for future system was designedlocatee e osed drainage _ Manholes would b The proposed drainage system. P residential construction and expansion of the y approximately every 300 feet and catch basins would be connected to the manholes. Future e develo pments ments in the drainage basin would be able to connect their -sit drainageer systems to the proposed manholes, or construct new manholes on the system to conAt this time it does not appear necessary to construct a new system all the way up Meadow Ave. to N. 36th Street. Due to the road's slope, the south end of Meadow Ave. does not have a ,_ problem with ponded water, and flooding has not been slightly pa en s N. 38th S the ders treet to connect to _ storm events. Actual project construction may only extend an existing pipe/culvert on the west side of the Meadow Avenue. C. Drainage Analysis Method ns The drainage'basins used for the future conditions analysis analyzede the same as the us using the maximum of used for existing conditions. The basins were impervious area that would be allowed, as described in Section A above. \\CENTRAL\SYS2\DEPTSWBPW\DIVISION.S\UTILITIES\DOGS\1999\CURRENT\99-684.DOC Page 5 The time of concentration for the developed basin and new drainage system was estimated at 16 minutes using the travel time equations in Chapter 3 of the KCM. The travel times were based on sheet flow over grassed areas, shallow concentrated flow, and pipe flow in the proposed new pipe system. The basin characteristics and time of concentration calculations are included in Appendix B. To simplify the design process the longest time of concentration (16 minutes) was used to determine the peak flow for each individual basin. The peak flows from each basin were added together where they would be combined in a proposed drainage system. D. Analysis Results The peak flows for each drainage basin estimated by the SBUH method are given in the following table, and the actual printouts are included in Appendix B. Future Conditions Subbasin Peak Flow Peak Flow 25-Year, 24-Hour(cfs) 100-Year, 24-Hour(cfs) 1 2.82 • 3.37 2 1.88 2.25 3 2.57 3.07 4 0.87 1.04 5 0.63 0.76 6 1.46 1.75 7 1.36 1.64 8 2.25 2.69 9 1.27 1.51 Total 15.11 18.08 1\CENTRAL\SYS2\DEPTS\PBPW\DIVISION.S\UTILITIE.S\DOCS\1999\CURRENT\99-684.DOC Page 6 t-WA 0 G 9 0 0) MCROFtLMEcI Barbee Mill Preliminary Plat Sewer System Analysis Technical Memorandum 11 , Submitted to: Barbee Mill Corporation Prepared by: Otak, Inc. 620 Kirkland Way, Suite 100 Kirkland,WA 98033 Otak Project Number 30209 August 27, 2002 Table of Contents Barbee Mill Preliminary Plat Technical Memorandum August 27, 2002 Technical Memorandum Section 1 —Project Overview Section 2 —Existing Sanitary Sewer System Section 3 —Proposed Sanitary Sewer System Section 4 —Flow Projections Section 5 —Oversizing of Lift Station Section 6 —Lift Station Elements Figures Figure 1 —Vicinity Map Figure 2 —Existing Sanitary Sewer System Figure 3 —Proposed Sanitary Sewer System Figure 4 —Potential Service Area Appendices Appendix A —City of Renton Sewer Facilities Maps Appendix B —City of Renton Zoning Maps Appendix C —City of Renton Wastewater Flow Criteria Section 1 — Project Overview This project involves developing a preliminary plat for 22.9 acres on the Barbee Mill waterfront site in Renton, Washington. The site is located between Lake Washington Boulevard North and the.Lake Washington shoreline near the NE 44th Street/I-405 interchange in north Renton (Section 32, Township 24N, Range 5E). The owner, the Barbee Mill Company, is proposing the development of 115 lots for town homes on the site. This Technical Memorandum "Sewer System Analysis"will identify sanitary sewer requirements for the proposed plat including future sewer needs for the undeveloped property to the north. Currently, both the City of Renton and King County Metro have sewer facilities in the vicinity of the plat. However, because of site constraints such as topography, the proximity to May Creek and the Burlington Northern Railroad right-of-way, this site is not a likely candidate to be served entirely by a gravity sewer system. An analysis to determine sanitary sewer flow projections for the Barbee Mill Plat and the north property, preliminary alignment, and lift station elements are included in this memorandum. See Figure 1 — Vicinity Map for the overall project location. 'Barbee Mill Preliminary Plat 1 otak H:\project\30200\30209\Reports\Sewer-Tech-Memo\Text.wpd Section 2 — Existing Sanitary Sewer System The City of Renton and King County Metro both have sanitary sewer facilities in the vicinity of the proposed Barbee Mill plat. The proposed sewer system to serve the plat will be owned, operated and maintained by the City of Renton City of Renton Facilities The City of Renton owns and maintains 8" and 12" sewer mains along the westerly margin of Lake Washington Boulevard North, Hazelwood Lane and Ripley Lane from May Creek to approximately 3,500 feet north of the creek (Appendix A). An existing dead-end manhole (MH-8) and 12" diameter sewer main are located within an easement along the easterly property line of the proposed Barbee Mill Plat near the northeast property corner. The manhole is located approximately 200 feet southerly of the northeast property corner. The 12" gravity main flows northerly approximately 1,100 feet to the Baxter Lift Station. The City has indicated that this line from the Barbee Mill property to the Baxter Lift Station has minimal flows, if any. As-built records show that this line and the lift station were constructed in 1973. The existing main appears to be deep enough to provide gravity flow for lots located near the main, but lots located near the shoreline are lower in elevation and would be difficult to serve by gravity. See Section 3 —Proposed Sanitary Sewer System. The majority of flows enter the Baxter Lift Station from properties located to the north of the station. Approximately 1,500 feet north of the Baxter station is the Misty Cove Lift Station. A flow of approximately 75 gpm (one pump) from the Misty Cove station has been estimated by the City. The City also indicated that the capacity of the existing Baxter station is at 400 gpm. An 8" force main installed within a 20" steel casing cross under the Burlington Northern Railroad tracks adjacent to the station. The force main empties into a stilling well which then connects to Metro's Eastside Interceptor line at manhole R02-25. An 8" gravity sewer main and 6" force main are proposed for a small three home development located south of the Barbee Mill property. The proposed 8" main will connect to the existing Lake Washington#2 Lift Station and then be pumped through a 6" force main connecting to Metro's 96" Eastside Interceptor line. The proposed sewer improvements will be owned and maintained by the City of Renton. It is assumed that installation of the 8" gravity main and 6" force main will be completed in the near future and therefore included as part of Renton's existing sanitary sewer facilities. Barbee Mill Preliminary Plat 2 otak H:\project\30200\30209\Reports\Sewer-Tech-Memo\Text.wpd Section 2 — Existing Sanitary Sewer System Continued King County Metro King County Metro's Eastside Interceptor line is located on the east side of the Burlington Northern Railroad right-of-way and runs parallel to Lake Washington Boulevard North. The interceptor line is 84" diameter north of May Creek and increases to 96" south of the creek. Several Metro manholes are located adjacent to the proposed plat and any new connection to the system would require connecting to a manhole. The South Mercer Force Main, a 14" diameter pipe, runs from Mercer Island under Lake Washington and connects to Metro manhole R02-25. See Figure 2—Existing Sanitary Sewer System for City of Renton and King County Metro facilities. Barbee Mill Preliminary Plat 3 otak ' H:\project\30200\30209\Reports\Sewer-Tech•Memo\Text.wpd Section 3 — Proposed Sanitary Sewer System As-built records obtained from both the City of Renton and King County Metro indicate that Renton's existing system and Metro's existing Eastside Interceptor line are too shallow to provide gravity flow for the entire proposed Barbee Mill Plat. There are a number of lots however, which potentially could be served by gravity flow into either system. Lots located at the northeasterly corner of the plat, lots 1-8 and 58-70, have the potential to be served by gravity into Renton's existing system between manhole 8 and manhole 28 depending on existing sewer invert elevations and finish floor elevations. This line is located within an easement on the Barbee Mill property and would not require approval or permitting from Burlington Northern Railroad. Lots located at the southeasterly corner of the plat, lots 93-115, have the potential to be served by gravity into the new sewer system proposed for the three home development. The City of Renton has indicated that they would like to either eliminate the Baxter Lift Station if the proposed Barbee Mill plat requires a new station, or modify the Baxter station if the plat can be served by gravity. Gravity flows from the proposed plat to the Baxter station are possible but would require excavations exceeding 30 feet for a substantial distance in order to provide gravity flows. Due to site conditions and the difficulty of the existing sewer facilities to provide gravity flows from the site, except as described previously, a new lift station will likely be required. The preliminary location for the lift station is between lots 28 and 29 near the west side of the property. By constructing a new lift station for the Barbee Mill plat, the existing Baxter station can be eliminated and the existing flows from the gravity main north of the station extended south to the plat (approximately 1,000 feet). Once the line enters the plat, it would be incorporated into the onsite system and gravity flow to the proposed station. A force main from the new station connecting to Metro's system will be installed and could possibly be installed parallel to the gravity line in the same trench. The existing 8" force main and 20" steel casing from the old Baxter station to the Eastside Interceptor line may possibly be used which would eliminate the need to obtain approval from the railroad. Preliminary calculations indicate that an 8" diameter force main will have the capacity to handle total developed flows. The existing force main is approximately 30 years old and the condition is unknown. The 20" steel casing is 62 feet long and is centered approximately perpendicular to the track within the 100-foot railroad right-of-way. If the existing force main were to be replaced, construction within the railroad right-of-way and approval would be required. If a new crossing is required, a location closer to the Barbee Mill Preliminary Plat 4 otak H:\project\30200\30209\Reports\Sewer•Tech-Memo\Text.wpd Section 3 — Proposed Sanitary Sewer System Continued northeast corner of the proposed plat would eliminate a substantial length of force main and could be connected to Metro manhole R02-24. Another option may be to run the force main along proposed "Street D" and connect to Metro manhole R02-22. In order to serve the property to the north via gravity lines to the proposed lift station, the bottom of the wet well will be at an elevation of approximately 6.0 feet which is considerably lower than the 19.5-foot ordinary high water mark of the lake. Additional depth will likely be required for proper pump cycling and control. In addition, a minimum of one hour of emergency overflow storage may be required for peak flow conditions if a permanent backup power source is not provided. Once the new system is operational, the existing 12" line between manhole 8 and the Baxter Lift Station could potentially be abandoned. Alternative Concept According to the City, the capacity of the existing Baxter Lift Station is 400 gpm with current flows of approximately 75 gpm entering the station from the north. Flows generated by the proposed Barbee Mill Plat will add an additional 35 gpm. The station appears to have sufficient capacity to accommodate future development from the property north of the Barbee Mill Plat (107 gpm). Flows from the Barbee Mill Plat could be pumped into existing Manhole 8 and then gravity flow into the Baxter station. This would require a new onsite lift station as well as possible upgrades to the existing Baxter station due to age. See Figure 3—Proposed Sanitary Sewer System for preliminary alignment. Barbee Mill Preliminary Plat 5 otak 11:\project\30200\30209\Reports\Sewer-Tech-Memo\Text.wpd Section 4 — Flow Projections Sewer flow projections are divided into two areas, the proposed Barbee Mill Plat and the undeveloped property located to the north including flows from the Misty Cove Lift Station. The City of Renton has indicated that potential flows generated from the north property will need to be determined and the new lift station sized to accommodate the flows of both the Barbee Mill Plat along with the potential flow from the north property. The City will participate in the costs associated with the oversizing of the lift station to handle future flows. See Section 5 — Oversizing of Lift Station. Barbee Mill Plat The Barbee Mill Plat is a proposal to subdivide 22.9 acres into 115 residential lots ranging in size from approximately 1,800 square feet to 6,000 square feet. The zoning is designated COR-2 (Center Office Residential) which is a mix of office and residential (Appendix B). The proposal is for residential lots only, therefore 6.57 dwelling units per acre will be used as the basis for flow calculations. The City of Renton's Comprehensive Sewer Plan 'Wastewater Flow Criteria"defines flow rates, density and peaking factors (Appendix C). The following table is used to calculate preliminary flows generated by the Barbee Mill Plat. For the purpose of this analysis, it is anticipated that flows generated from Lots 93-115 (approximately 3.5 acres) of the proposed plat will gravity flow to the south into the proposed system. The flow is estimated to be approximately 12,417 gallons per day (peak flow). This flow would be pumped through the Lake Washington#2 Lift Station and not the proposed station. Population Average Peak Net Density Density Flow Peaking Flow Property Acres du/acre per/du gpcpd Factor gal/day Barbee Mill 14.0* 6.57 2.7 100 2.0 49,670 * Lots 93-115 are not included as part of the total capacity. North Properties The property to the north of the proposed Barbee Mill Plat consists of two large parcels identified as Lots 1 and 2, two small lots identified as Lots 12 and 15, and existing flows to the Misty Cove Lift Station. The properties generally slope from east to west. Some of the property located adjacent to the City's existing sewer main may be served directly into this line if deep enough. Preliminary indications Barbee Mill Preliminary Plat 6 otak - H:\project\30200\30209\Reports\Sewer•Tech-Memo\Text.wpd L Section 4 — Flow Projections Continued • would show that gravity lines could serve the four properties and therefore their net areas are included in the flow calculations. The zoning is designated COR-2, mixed- use development. Without the ratio of residential to office development, it is difficult to determine projected flows. For the purpose of this analysis, and as a bases for determining peak flows, a density of 6.57 dwelling units per acre were used which is consistent with the density proposed by the Barbee Mill Plat. The following table is used to calculate preliminary flows generated by the properties to the north. Population Average Peak Net Density Density Flow Peaking Flow Property Acres du/acre per/du gpcpd Factor gal/day Misty --- --- --- --- --- 108,000* Cove Lift Station Lot 1 19.6 6.57 2.7 100 2.0 69,537 Lot 2 22.8 6.57 2.7 100 2.0 80,890 Lot 12 0.2 6.57 2.7 100 2.0 710 Lot 15 0.4 6.57 2.7 100 2.0 1,420 260,557 * Flow information provided by the City of Renton. A peaking factor of 2.0 was used for flows into the lift station which is consistent with the City of Renton's Comprehensive Sewer Plan "Wastewater Flow Criteria". Summary of Flows Proposed Barbee Mill Plat 35 gpm Undeveloped North Property 107 gpm Misty Cove Lift Station (existing) 75 gom 217 gpm See Figure 4—Service Area for potential properties served. Barbee Mill Preliminary Plat 7 otak - - H:\project\30200\30209\Reports\Sewer•Tech-Memo\Text.wpd Section 5 — Oversizing of Lift Station The City of Renton has indicated that they would like to eliminate one of the northerly lift stations, either the Misty Cove Lift Station or the Baxter Lift Station. Because of the site conditions and elevations of the proposed Barbee Mill site, a gravity line does not appear to be a feasible alternative. The new lift station located onsite would eliminate the aging Baxter Lift Station and would have the potential to serve the north property. This means that the City would not have to maintain an additional station and will generallybe a cost saving measure over time. The City would participate in the costs for upsizing the station to include the north property. The additional capacity and associated costs beyond what is needed for the Barbee Mill Plat would be determined. A pump station sized for the sole purpose of pumping the proposed Barbee Mill Plat would require a capacity of approximately 35 gpm (assuming flows from Lots 93-115 can gravity flow to the south). Future flows from the north property would account for an additional 107 gpm which is approximately 75% of the total capacity required for the pump station. This does not include existing flows coming from the Misty Cove Lift Station. Barbee Mill Preliminary Plat 8 otak H:\project\30200\30209\Reports\Sewer-Tech.Memo\Text.wpd Section 6 — Lift Station Elements Design of the proposed lift station will be in accordance with the City of Renton and the Washington State Department of Ecology "Criteria for Sewage Works Design". The lift station will have to operate under the full range of projected system hydraulic conditions. This means that the station will have to accommodate fairly low flows from the proposed plat and Misty Cove Lift Station as well as projected flows generated by development of the property to the north. The City will maintain and operate the station and will likely require at a minimum, the following items: 1. Two pump system (duplex). 2. Separate dry well and wet well. 3. Flyte submersible pumps in separate dry well. 4. Stainless steel guide rails. 5. Emergency overflow storage (if portable emergency power used). 6. On-site emergency power. 7. Special City-furnished telemetry panel and alarms. 8. Bypass capability. 9. Provide appropriate security measures against vandalism. The lift station should be designed to provide enough reliability that accidental spills of wastewater or backups do not occur. A standby emergency power source, portable or onsite, will be required. Equipment redundancy to ensure performance and provide capacity for peak flows will be incorporated into the station during the design phase. Barbee Mill Preliminary Plat 9 ota k H:\project\30200\30209\Reports\Sewer-Tech-Memo\Text.wpd Figures 1 --, . 1 • , 1_ • • ,• , ' 0 sendaIt Terminals : , i,, / 11 ; , ;;;::-----------------------_.2. 1„,` / , LAKE 0 0---•‘---- ,../ si i . 0 y ;,,i',..* $.0 WASHINGTON. i.// f.46 I 'iZS It•, / , O' \ \ •'•I \ • ,.. . • ""%, *9 '.9 A' ',,,,,„ -------------- „ 1 1 p . • ' -•• •N.44TH ST.;, - .'- t—•—• . - / f - y3 ... , .,. ,, ., : 0 t el • ' -' I 14Y 02.90 AC ild 7111 Ft r ,1 0 ..., /14... , . 7it i‘,...\ a .4, ::it' t.. •'''1 X "----110 44y"..zif , co , "/ I ,..4 all •• d•d . #,- •00,11 .7 •,.‘ - < 1 . - i 1 0 1 ......N..V 1 •'.: V g.. I: at O'S,* 11 c,,,,4„or w ,•::,. , / .010 . • 0 i . , Z lj / At,• •sTp04, . g . ...i — 4 '"/..,;(4' - .,.0 , . ,,., z in i- @ -N. 1, 1 ,\ g*-• •11.'',,. ] AO - ,- :41144.%/)''ti 't) Vi:' i6k - -i--,144\ .1 ,,', , .: - "to,. 6". 1--. , . . <E.' 4' Fg t Ili it no MI Iiii 4- b !...,z bit,...... , . ...- 1 • 7 . - 40TH Tr. •••••..7"....— i ,..— „..HL II 1 .< 37.00 ACrA:71 7 scC4vmmin% ,, ...1:31(2,:.0::.LP-7'1101.4-H•,..' $ i . •A I) 6e. , ' r '...': .."..,- ...:. ./ 64" ' i 437/ V1E°'AN 1035 I.giffiril III ,r4 1 ._ ....., ,,,,,, .. irs.,....•. ar, 104 41111 7 LI ill 1 :a•tri/ ,/-i2 ' ,5. • • Ill i .. _ ,, i / • 62 r ..„ . io. . , „ No l E Ntireill-• Irp I - -ill: ye-v••• • .----- ,: • • _ ••,: , 7 ,.. WAKE WAS-„i.ITITO.iN 1 , • ---*=4,/ '111CR MIA alirlitillitr. 6 600.AVE. ••- • • If i L-11-wil N. - 38TH _,-,,, .. , i ',x• • , \ l• I 1 ----ir-`41 Tz• • 'it r: ii 4 vi •& _ . , ._••__ • 1 • --El .rE-1: .01 1 . 41,101..1 1... 1 ' ((ill 1 :,---:-:,-7'''T/ i -1"f• 9 r 't•liEi % '. iii tr--100 .-1-• - . - - c, •i : 41 1 i YI 500' 0' 500' 1000' •, eim mi i' SCALE IN FEET VICINITY MAP . , Figure 1 MlCONDsn 4o01E I • ST%REF LI sale: 1 solved C209H2O0 • , 0971}0 ra I 097350 09U660 APPROXIMATE t SHORELINE15 ji /5'r . MISTY COVE LIFT STATION CITY OF •.. RENTON SEWER ,5 • r" R02-27 : ,c5�6 ,r 4. .: SOUTH MERCER �'-�',' 14' FORCE MAIN ;` �Q /7 SE 76TH ST. S.•..• , ,: RO-26 ,`O 44 �P BAXTER ,s LIFT r'r / A.(/ STATION . r> - \F 'r• I ss ••• ' 8' FORCE MAIN •••'` O44, 1 STILLING WELL 45;•` R02-25 10 S. �2 `ti st" 27 /4e N I METRO 84" EASTSIDE _ . INTERCEPTOR ..,, .---------'---'.\\\ 28 R02-24 4 - it �r , NE 43�D PL. II JLJ,LJ" JLJLAV! ' . •• �•,-i I II y 4: L wo , c 0 APPROXIMATE C C� �J �� • — SHOREUNE� \- ^�� c� • — o \ �%��- ).. R02 23 p V ®� ��/" METRO 98 EASTSIDE �I INTERCEPTOR — m PROPOSED BARGEE MILL +� Pi x PRELIMINARY PLAT 1 11//1 I•%* ; pa o : �� 601 PROPOSED AI OTHERS , �� . %�1 12 n 8" SEWER SYSTEM AND u 6" FORCE MAIN FOR b 9 PRNATE DEVELOPMENT , ' II 10 (3 HOMES) "Sr' 4) a \ 4 200' 0' 200' 400' ^ EXISTING Ae �� ai' 7 _ E 6' FORCE MAIN SCALE IN FEET 7 > I4 41/ LAKE WASHIGTION #2 �% FI Ure 2 LIFT STATIONIlil EXISTING SANITARY SEWER SYSTEM „ ` I I I I I I 1 1 %REF _I57 V _ Ascole: 1 ^"M. '' `''j� 4 I — 4 0 5 C2097130 � C EXISTING 8' FORCE MAIN czo97350 - ,',r\,,�D� a° - IN 20" STEEL CASING , �209U615 *, N 1:209U880 �, v �>y $ ,,„''-' • �'w�� av '';°•my CONNECT PROPOSED FORCE ° MAIN TO EXISTING 8' FORCE MAIN e'' cJy ``1.-, - i• q `�V EXISTING GRAVITY ` ',., ."' SEWER MAIN FROM •�: ` MISTY COVE Ufl 't STATION °'z- MEADOW AVE. N • \ ." air - BAXTER �.\.-=., , ,,. LIFT STATION ' ., -,.„ (DECOMMISSION) , .., • ` , Lfl. EXISTING GRAVITY \ .., • ^,' i SEWER MAIN TO :r,, BAXTER LIFT STATION ��\ `�.., "' .1/ `:krs,„,,,,Z,-.,,,,,,,, •.:;,,, '' .\•,........N q' L &aG ABANDON EXISTING SEWER , , ,>, �- MAIN SOUTH OF BAXTER `Z}�:. 4114* UFT STATION , (+ a� U SOUTH MERCER PROPOSED GRAVITY \\ ♦4, 3 14 FORCE MAIN SEWER MAIN TO ^' Ys'' NOON .4 PROPOSED LIFT �� `tom., >�.T STATION r\ '�- ? �j/' I _5,! r;' PROPOSED FORCE k MAIN L__J a =y `"'' BURUNGTON N I ^-1 I 1 NORTHERN RR F = `� \ L___J I I 1 o PARK AVE. N 1 I (- -1 1 k` Z T.: L---J I I e \�/ , I——--J ( eI I i,, ^ a L___J , % - r �'/ 1 I II ' L—-J ? I " - 1 \ ''z, „ CONNECTION 'DINT FOR (- _ 'I�,i r l _J L_ )n \ 6 LOTS 94 THR J 1 15 Iv m I----i 1 \\ < ) 111001 . .:, # -. . 7>iie ' N.., .-------",,,...„.__._, I I ^\ \v i \ - /i� �� '': \ PROPOSED BY OTHERS 8- SEWER SYSTEM AND APPROXIMATE I——-J I • \� ` i� O �' \ "°e 6" FARCE MAIN FC`R `` PRIVATE DEVELOPM_Nr SHORELINE - r——1 l ) �� s //\ U /� , (3 H)MES) \ // \ -/ /N 42" / .-8 NN •S> s\N.,:-, , N. #2* ,,,'? >,„ \'s '' ".".4., / .7 Ili "a, e. ,,, L_—J Ir r �r 1 / r �.L.i; 1 11 II a I I 1 , -\ �j 1 '�`'�/„/ I " -InIi 11I- 111 I I I 11 J7 ,,,,, i 1 NirI � ``,a�C ^ I .I Ia ^ 1I IIx 1 L_ ' _J L_'—J 1_—'— \ - ) r -:a `� l.`J\ 1 I ^I I a I 1 I PROPOSED I \ �i Ai �V r �t I j r L_—J L J�. J LIFT STATION 1 �,,,Vj ^ I •t,@ ,, /^+ ,�� . BY OTHERS4 _ a' VT 1 �/ /OI EXISTING 6" 100' 0' 100' 200' qqq FORCE MAIN /I /v J PROPOSDBARBELAIN FEET I WASHINGTION {2 LIFT STATIOtI Figure 3 PROPOSED SANITARY SEWER SYSTEM F. %REl_UST_•_ • a MISTY COVE I sc°e. CONDOS °'Vee4 . CCD4 PROPERTY 70NING POTENTIAL NET ARFA SERVED-• ., .. C20996,0 ,i_ , czo9�zoo yy I BARBEE MILL PRELIMINARY PLAT COR 22.9 ACRES C20971 JC ti —• } 2091350 APPROXIMATE 209U660 APPSHOROXIMATE IMATE MISTY COVE COR 1.3 ACRES • ' .. / ; LOT I COR 19.6 ACRES 4 • MISTY COVE LOT CDCOR 22.8 ACRES '' LIFT STATION / •••••• CI of / / LOT 12 , COR 0.2 ACRES ♦ . RENTON SEWER :♦ '/ R02-27 O 6 LOT CD- COR 0.4 ACRES I ..... .>'-.`/SOUTHMERCER FORCE _ / ♦ 6A; / ( ( SE 76TH ST. 8�r S. ".r' 3 R02-26 �� •' �\ 'I BAXTER LIFT STATION / P gi APPROXIMATE POTENTIAL l�'.7, •• y0 NET AREA y . -,� f R02-25 10 r k . t N. 44TH Si 27 1 / • 1 ' — 2B`' R02-24 r-- 711-1F.,—Ir—IF<T1 war "/ NE 43RD PL. �K —i L. J _AL:ill JLJL ' �L_rt_ Il u v -J I. II I�' Q w. _,4,,,,,:, . • <. 4*. e ir 0 ��j �j Z aim C ✓ i - a u �� in J RO 23 p w Li! V ® J� 4--� _ Z -)11 �Ci PROPOSED BARBEE L.,:, �� '(E mMILL PRELIMINARY PLAT Q/�� cn 801 14\Vyi / 2o 7 ,4'.. 0 i 7 4 200' 0' 200' 400' 4 911 I I 10 //1 ' 4"3 1M-1111.1- 1 E .- / N. :.rTH SCALE IN FEET ,o � Z LAKE WASHINGTON #2 ,y 14 ♦ Z - { ' / LIFT STATION '`. Figure 4 W POTENTIAL SERVICE AREA Appendices AppendixA City of Renton Sewer Facilities Maps -1111--111117-11k 4 . 291'i'24ty R5E W 1/2 • .. L38 41 I / ' mac? (I '�R02-24 NE'..4'3r S „....... . �_ ,' Y ,l,. zi.:.• 1 . • i3O s\i . / F' I - .� '( I ,. �`Jr �Q2-22` ' M-5 �,- ? • �' 2' //;.. i, M-6 ''.. i i 1E3' l (7 5 i ''., % i • • 9 1200 - R02-21 i;r' _ I 3 ,: LAKE SH. !�. ' �o 'i • 1 LIFT .i1 __ O/ 12 N'' Oth; � 1 , TRq - 1 ., 19 S ii Zoe -, ,,. 'RUC 20�� , .. . a i i ! ; 'I __ 7 " Sit 8' 800zl �'/ i j •210 i ( r • .. ,32 35 36 37 a 117 i �. i ! ; i I • 1 { • . 4 is g° 38. 8' •� a, 38t 33' 34 t...®, 817 .._. t 8 - g' 39 ..-... :4 , : , , • , (/.11, „ : 8' 23 8 i i 4 45 : t ;.., v. 6 41 42 ®43� z 't Q? ® ® 25;.. C4 1 \�. t ,802 8' 8' 1 a Z 1 1) 48 N 37th St. 54 • • • a 26 i Private R d 51- ✓, • ; 8' ' ,.8. 50 8• • . 53 8'•., -� t`' ' • RI�2-18 ',140 52 u;: 8. 'I •1 •1 ? i E-+ .. .. 1 806: ! 41cui. 803 '28 ---t &) . , . q , .1 9142 ' �5.. N�3 56.. h M 58.. ...:.-. .I I 8 , j.. St. ._30 ..;._'c9 P7... .• ,, 8' 8 8' 8' 04 ' , , : 8 145 72 05 : 8 ' S : 07081 6 Z • 1 i z 8, 60: ¢ S z 2 71 (..,`\ o 63!. ¢ 34thSt a- N - . . 66.. 34th 9t , 8' 65 . 8' ;,, ....2,09 ai . 8' i 8>' 8�,. ..73..9, 70 ..' [' i i% Q ; r. (a, ; - i . �' ` ,' 78 N•33. j i rd Pt 1 r i ; 8 810 r. '8' g .' . 41 ' •?? •'. i.:'' • ..; 8' i 62 I a N 33rd •St 433.__..-. ' 84 . N 33rd; I<426 j 7.. • r • 8 811 di, ,� � , • • ® .d',5 .. 4 �* • '8' 8' ' 8' 1 N 32nd 2n `•i • ) -1" ,. ''. . 5: <.95'._.. 94 :N 32rid i St , 88 0,-. 9 �12 i 8, 8, 91 m \\ •93 co_ 8' : 8' 125• i • � St „' 1 6• N ...31st 9Z, :... • ..:...:. 98 •N 31st 'St• hes.. • Igo_ • ........... 9 • ;: • 99 8 8' :8" ' 110 i i; • �\ i • 812 r :_._.: N ..30th... St.:3 `.103...:...... N.3.Ost,St..,. Cam® . . .. 10'4 ® •.. .....,106i... . ' 107....... N..,.30,th,..St.... ' 1 I • 7 201 l09,....:..: NE. 30t t • • g' g• 105• 8' 8 108 8, 8 . _....._ • e' • i '. 813 205. ` 02 ��. 20L..6 20 . : N 29th' St. ;111 112 • N:i'9th St ' z `•203 �'� �. .. ® •®. .. . _.. . .. • 04�-. • ,. 8' 113' i .. 8, ip 8• ` • 1 'L 135 ' • . �� 814 •116 . :6• ; '.;,... a 132 m i': 117•... . ...... : 118 N'28th. Pl:. .• .• 119.:. . ... 120... .I !121 36 , �� ' 815� :®1 �1E 29h g m - 2,,, N 8' 8'' 8. r •. > N 28th St • , Emergency Access .Ohl .i N 2 134 133 y S :':Sa.:_; ::.:'.: •NE..28th St Dirt Rd) ,.. .... ... Overgrown ; • • • Ja , Q NF P7th f't D4 - 5 T23N R5E W 1/2 ti�y O Cif 4 200 4p0 a► SANITARY SEWERS 1:4800 + P/B/; P/H/PW TECHNICAL SERVICES �� /05/01 32 T24N R5E W 1/2 5432 L ---, - - - - -- ____IIIF___7- - -- 1- J --- --- -- ^---- -� 1 •I \i . i . • • 1. �,. d CI) • J o;:• (7 • - ,..._..._ ........- --.._._... _...--' ----- ---...... ._.__..._ ._...._ _..__._ to _ _.._.._. __.._.. 4,4 . (r L.. c{) t ( . if I T 1 001 , o T - • i ...... _._.. _...._... • ... 3 f8 ) 4 • I ' /MISTY COVE • • LIFT IO __..._. _._. — L 08 I'- ,,'''''''''' / � _ `� , : . I i 7CNE. 8 ) �• ''t tr i''R02- t , .... _ (' 61 a i I �� > .. r,' a% I- DENNEY'S BAXTER LIFT STATNION tie i LIFT STATION - 9 L-07 L 0 ._. ..... .- _ i •••••„ �i ' - ,�' %:R02-25 _.....__ __ 11 25 10 iv ' 12 I ...__... :-.7" 27 13 2 ' a�r •.'z, i NE 43r~d-St I , C4 - 32 T24N R5E W 1/2 ti'tY O � ��o ,t SANITARY SEVERS 1:4800B 4 P/8/PW TECHNICAL SERVICES ��NIa 09/05/01 29 T24N R5E W 1/2 5429 I al I Appendix B — City of Renton Zoning Maps i • .. ___ \ ; _____ __. \ . I \ \ ' _Hill • LAKE WASHINGTON - -. ..I-- --) ____ _____ /_....... . ........-.. .7 / __/_ -- r ---- --- -- - ----- /-.- / . -- -- -- . _- -- --- - ,.0 Q R , - -0 . ... . . ,,,/ - -- �� . 1 .... I . __ _/ . . -- -- - . -- .,,., . „ . ,.... . __„_...._....... _ ___ - -., .... . • . . ..., ,... .-- . . _ A . _._ .. . . __ ____ _ _ ....:- _._ _ . __ - 1 C . . . . . . . , 1 _ __ _ _ _/ _ _ _ . _____ ..._ _ _ _ 4/4) / . . . . . _._ ___ . . . . . . . , ______ _ _ _ _ 1_ • / .- , . . _ - -- _ - I/ . . . . • — —_— — • — �/ NE3rc 8 • C4 • 32 T24N R5E W 1/2 • • d► ZONING ---- Renton dity Limits i:4800 III, " a>,.. • + P/B/PW TECHNICAL SERVICES • "*P� �� ®��0z 29 T24N R5E W. 1/2 • 5429 .1--imi-- -- B - 29 T24N I„- 1/ 1— • CA _....._.... . .. , ....._....._ ........_ . . .... ,, ......_. . .. ..... _. .. : ........ __•_:: :•:: - .. NE43i . . ••••••_-- C 0 R 7C D R c A ....... .. ... . .. gee ` . ............. . . .. .... �! may...... .. . ...._.... . _......_ c# , ....._ C • �,..... . _ ... < .. . . . ......... c.3 .......... .T. .- •• - : .. .... .. '. - . .. ... .. . . . . . b, z ... .. . .... . • •. .....--- - -- R - ,....... . - . , _....... _.._._._. _e . . . . . . , . ........_.... . ,,.: .. , • ................. / lir ,,R7-'1.0 ,, . CA 40th St i // " • / R8 . . 8 � 38t : St ._-.. _..-._• ,. -._ —_ , .1 1 R: ; LI .._ ,•.• . '' (z).\;,. ..1I -,,r. .: o. 3 .. ,! ..,; •_, .. ., •,,. 7; R, _ 8 o0 z - - - 8 kii. N E 36t , • . , •I i ._zi,, ; , . ; . �� p� \ R - i c� /eR8N(..) -:•::-/ ... •1rt I : ,�t , I , R i 8i , ,, ._. , ._ i • 8R - 8N 34thSt R - 8 4N3� th St - . . \ ' • `D RC � ' •8• , . • Nv ,. : . aR- di• . : •3r , (.... .. ... • R :8 I R-j8 R, , , .: o cI IR-8 j1- R-8• ;331",c !t • i ir iii . :R. :8 jR_8 - . N 3ncl fit. / ) 1 R: , 32nd + St , . , . • 1 R-8 . I , R . . x 1 : : . '81 8 . .� R-8 I . R_8 N, s;t ;s , [cc R_8 J .. . ; May Cr�� i H R ;8 i ee R-8 . 1 I R-8. ...3Qth .St' ; ' CC : I RI-110 I ! 'C C aio R-8 I 8!r1 • fq-iio 1 IC . • ,,.::•-• xi i R-8 I - N S R CCI , I 8 R " 8 R-8 -I R-8 ' • i i ; I • Y � ' R-8 R`8 ; • — 8' . • R . , , , , , RT8 N Sth' R - 8 ,' . \ ..._0 . . , i 1 . ! ! ! 2 st o „ : , : , „ .• i , , : . , \ I • V i i I . .-:....:.,.....• • D4 - 5T23NR5EW1/2 G Y � -- �- 200 400 i, , , , , .... . . . . . .. . :,,,. ,, ZONING -— Renton dity Limits 1:4600 ` ` PB/PW TECHNICAL SERVICES C 4 Cmoo, 03/15/02 32 T24N R5E W 1/2 5432 . Appendix C. — City of Renton Wastewater Flow Criteria CHAPTER FOUR TABLE IV-3: WASTEWATER FLOW CRITERIA Average Domestic Sewage Flow: 100 gals/day/person Average Population Density 2.7 person/dwelling unit single-family (U.S Census Bureau, 1980): 1.9 person/dwelling unit multi-family Residential Density: Residential Rural 5 dwelling units/acre Residential Single-Family 10 dwelling units/acre Residential Options 13 dwelling units/acre Residential Planned Neighborhood 18 dwelling units/acre Residential Multi-Family lnfill 20 dwelling units/acre Mixed Use Density: Neighborhood Center Site specific Suburban Center Site specific Center Downtown Site specific Center Office/ Residential Site specific Commercial and Industrial Sewage Flows`: Convenience Commercial 2800 gals/acre/day(gpad) Center Institution 2800 gpad Employment Area- Commercial 2800 gpad Employment Area- Office 2800 gpad Employment Area- Industrial site specific Employment Area- Valley site specific Recreation 300 gpad Green Belt 0 gpad Inflow and Infiltration ( I & I): Peal; Inflow and Infiltration 1 100 gpad Peaking Factors System Average 2.0 x Depth/diameter ratio 0.80 Design flow criteria vary considerably, depending upon land use.