Loading...
HomeMy WebLinkAboutFinal Agenda Packet AGENDA City Council Regular Meeting 7:00 PM - Monday, May 14, 2018 Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way 1. CALL TO ORDER AND PLEDGE OF ALLEGIANCE 2. ROLL CALL 3. PROCLAMATION a) Home Fire Sprinkler Day - May 19, 2018 4. ADMINISTRATIVE REPORT 5. AUDIENCE COMMENTS • Speakers must sign-up prior to the Council meeting. • Each speaker is allowed five minutes. • When recognized, please state your name & city of residence for the record. NOTICE to all participants: Pursuant to state law, RCW 42.17A.555, campaigning for any ballot measure or candidate in City Hall and/or during any portion of the council meeting, including the audience comment portion of the meeting, is PROHIBITED. 6. CONSENT AGENDA The following items are distributed to Councilmembers in advance for study and review, and the recommended actions will be accepted in a single motion. Any item may be removed for further discussion if requested by a Councilmember. a) Approval of Coun cil Meeting minutes of May 7, 2018 Council Concur b) AB - 2149 Mayor Law reappoints the following individuals to the City Center Community Plan Advisory Board: Robert Prather with a term expiring 4/30/2019, and George Daniels and Laura Bloch with terms expiring 4/30/2021. Council Concur c) AB - 2150 Mayor Law reappoints the following individuals to the Renton Airport Advisory Committee with terms expiring 5/7/2021: Marleen Mandt (Kennydale Neighborhood, primary position); Kenneth Williams (West Hill Neighborhood, primary position); Steve Beardslee (A irport-at-Large, primary position); Karen Stemwell (Aircraft Owners & Pilots' Associations, alternation position); and Alfred Banholzer (Washington Pilots' Association, primary position). Council Concur d) AB - 2152 City Clerk submits the staff recommendation to amend Renton Municipal Code (RMC) 10-5, Vehicle Impoundment and Redemption, to conform the RMC to State law, clarify when notice is required prior to impoundments, and to confer jurisdiction of impoundment he arings from the City Hearing Examiner to the Renton Municipal Court. Refer to Public Safety Committee e) AB - 2151 Public Works Administration requests authorization to purchase three new replacement vehicles (Elgin Crosswind J Sweeper, Ford Cargo V an; Vactor MC1511), in the total estimated cost of $681,114, using the state bid contract or the Houston -Galveston Area Council bid contract. The funds were approved in the 2017/2018 Biennial Budget. Council Concur f) AB - 2144 Transportation Systems Division recommends approving Supplemental Agreement No. 1 to CAG-17-149, with KPG, Inc., in the amount of $728,636 for the final design of the Williams Ave S and Wells Ave S Conversion project. Refer to Transportation (Aviation) Committee g) AB - 2146 Transportation Systems Division recommends approval of Supplemental Agreement No. 4 to CAG-17-082, with Perteet, Inc., in the amount of $392,389 for the 60% design of the Park Ave N Extension project. Refer to Transportation (Aviation) Committee h) AB - 2153 Transportation Systems Division recommends adoption of a resolution declaring an emergency for the purpose of replacing a damaged signal pole located at the intersection of NE 4th St. and Jefferson Ave NE. Council Concur i) AB - 2147 Utility Systems Division recommends approval of an agreement with Watershed Science and Engineering, Inc., in the amount of $466,098 for surveying, hydraulic analysis, and preliminary design for the Madsen Creek Improvement Project Phase I. Refer to Util ities Committee 7. UNFINISHED BUSINESS Topics listed below were discussed in Council committees during the past week. Those topics marked with an asterisk (*) may include legislation. Committee reports on any topics may be held by the Chair if further review is necessary. a) Finance Committee: Vouchers; Bad Debt Write off; Overfill Water Utility Instrumentations/SCADA Technician Position; Compensate Bradshaw as Construction Inspector at Step E; Senior Center Energy Upgrades - Final Payments b) Planning & Development Committee: City Center Plan Text Amendments* c) Utilities Committee: Kennydale Fire Station and Water Reservoir Fiber Optic System Design 8. LEGISLATION Resolution: a) Resolution No. 4341: Declaring an Emergency to replace/repair a traffic signal pole 9. NEW BUSINESS (Includes Council Committee agenda topics; visit rentonwa.gov/cityclerk for more information.) 10. ADJOURNMENT COMMITTEE OF THE WHOLE MEETING AGENDA (Preceding Council Meeting) 6:00 p.m. - 7th Floor -Conferencing Center Hearing assistance devices for use in the Council Chambers are available upon request to the City C lerk CITY COUNCIL MEETINGS ARE TELEVISED LIVE ON GOVERNMENT ACCESS CHANNEL 21 To view Council Meetings online, please visit rentonwa.gov/councilmeetings —DenisLawMayorProcCamation‘14)fiereas,theeffectsofhomefiresarefar-reachingandlongstanding,andahomefirecanbecomedeadlyinlessthantwominutesduetotoday’sconstructionmaterialsandcommonsyntheticfurnishingsproducingtoxicsmoke;and(4)fiereas,homesshouldbetheplacewhereourresidentsfeelsafe,butinreality,homeiswheretheyhavethegreatestriskofinjuryordeathfromfire;andW’ñereas,homefiresputourfirefightersatriskthroughexposurethatcanleadtohealthissues;andWhereas,combinedwithworkingsmokealarmsandproperfireescapeplanning,firesprinklersinhomescananddomakeadifferenceinourcommunity;andWhereas,bytakingpartinanationaldayofaction,werecognizethatprotectinghomeswithfiresprinklerswillmakethefuturesaferforourresidents,firstresponders,andourcommunityforgenerationstocome;fJ’Iow,therefore,I,DenisLaw,MayoroftheCityofRenton,doherebyproclaimMay19,201$,tobeKome¶FireSprink,terDayintheCityofRentoninrecognitionoftheeffectivenessfiresprinklershaveinstoppingthespreadoffireandsavingliveswithinourcommunity.Iencourageallcitizenstojoinmeinthisspecialobservance.InwitnesswftereqfIhavehereuntosetmyaffixedthis14thdayofMay,201$.DentsLaw,MayorCityofRenton,WashingtonhandandcausedthesealoftheCityofRentontobeRentonCityHall,7thFloor1055SouthGradyWay,Renton,WA98057.rentonwa.govAGENDA ITEM #3. a) May 7, 2018 REGULAR COUNCIL MEETING MINUTES  MINUTES  City Council Regular Meeting  7:00 PM ‐ Monday, May 7, 2018  Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way    CALL TO ORDER AND PLEDGE OF ALLEGIANCE     Mayor Law called the meeting of the Renton City Council to order at 7:00 PM and led the  Pledge of Allegiance.    ROLL CALL    Councilmembers Present:  Ed Prince, Council President  Randy Corman  Ryan McIrvin  Ruth Pérez  Armondo Pavone  Don Persson  Carol Ann Witschi  Councilmembers Absent:                           ADMINISTRATIVE STAFF PRESENT    Denis Law, Mayor  Robert Harrison, Chief Administrative Officer  Shane Moloney, City Attorney   Jason Seth, City Clerk  Chip Vincent, Community & Economic Development Administrator  Gregg Zimmerman, Public Works Administrator  Commander Charles Karlewicz, Police Department  Commander Dan Figaro, Police Department      PROCLAMATION    Affordable Housing Week ‐ May 14 ‐ 18, 2018: A proclamation by Mayor Law was read  proclaiming May 14‐18, 2018 to be “Affordable Housing Week” in the City of Renton,  encouraging citizens to join in the special observance. Laura Reynolds, Christopher Ross, and  Evan Mack from Compass Housing Group accepted the proclamation with appreciation.     MOVED BY PRINCE, SECONDED BY CORMAN, COUNCIL CONCUR IN THE  PROCLAMATION. CARRIED.  AGENDA ITEM #6. a) May 7, 2018 REGULAR COUNCIL MEETING MINUTES  ADMINISTRATIVE REPORT    Chief Administrative Officer Robert Harrison reviewed a written administrative report  summarizing the City’s recent progress towards goals and work programs adopted as part of  its business plan for 2018 and beyond. Items noted were:      The Solid Waste Utility is launching the “Bring Your Own Bag (BYOB)” campaign in  efforts to reduce plastic bag use and litter throughout the city. The public is  encouraged to bring reusable bags when shopping and complete an online survey  about plastic bag use. The survey is available at rentonwa.gov/plasticbag through  June 6. Questions may be directed to Solid Waste Senior Program Specialist Jina Kim  at Jkim@rentonwa.gov or by calling 425‐430‐7391.   The Renton History Museum has received an award from the Association of King  County Heritage Organizations (AKCHO), along with a team of four University of  Washington Museology graduate students, for the exhibit ‘A History of Renton in 75  Objects.’ The award honors collaborations between students and museums that  result in projects that benefit the King County Community. ‘A History of Renton in 75  Objects’ was curated and installed by the UW Museology students who used unique  artifacts and photos from the Museum's collection to help the visitor visualize  Renton's history.   Preventative street maintenance will continue to impact traffic and result in  occasional street closures.     AUDIENCE COMMENTS     Dale Hoover, Renton, expressed appreciation for Council's action regarding the new  street racing enforcement plan. He noted that he is optimistic this new plan will  discourage racing in Renton.     Ronald John, Renton, encouraged Council to consider placing flashing speed indicator  signs on Talbot Rd S (SR 515) to discourage racing on that street. He also expressed  appreciation for Council's action regarding the new street racing enforcement efforts.  Mayor Law remarked that the City will consider placing flashing speed indicator signs  on Talbot Rd S.     Sophie Huang, Newcastle, stated she was disappointed to learn the Ellison Hangars at  the Renton Municipal Airport are scheduled to be demolished later this year. She  remarked that she and other hangar lessees were not provided appropriate notice of  the demolition. Ms. Huang requested that the demolition be delayed until the Airport  Master Plan is adopted.     Andrew Bradford, Renton, also expressed frustration that he had not been notified  earlier of the pending demolition of the Ellison Hangars at the Renton Municipal  Airport. He requested that he and other hangar lessees be included in the Airport  Master Plan process. Mayor Law asked Mr. Bradford to provide his contact  information to Public Works Administrator Gregg Zimmerman.     David Hoffman, Renton, stated he was speaking on behalf of Puget Sound Energy  (PSE). He indicated that due to recent tax law changes, PSE will be reducing rates for  its customers. He noted that residential customers should see a reduction of  approximately $7.00 in their monthly energy bill.   AGENDA ITEM #6. a) May 7, 2018 REGULAR COUNCIL MEETING MINUTES    Alan Gurvich, Seattle, expressed frustration with the lack of notice regarding the  demolition of the Ellison Hangars at the Renton Municipal Airport. He noted that  other buildings at the airport will also need to be demolished in a year or two and  requested that the demolition of the Ellison Hangars be delayed until those buildings  are demolished.     CONSENT AGENDA  Items listed on the Consent Agenda were adopted with one motion, following the listing.   a) Approval of Council Meeting minutes of April 23, 2018. Council Concur.   b) AB ‐ 2143 City Clerk reported the bid results from the April 11, 2018 bid opening for CAG‐18‐ 002, N 27th Place Bridge Scour Repair project; and submitted the staff recommendation to  accept the bid and award the contract to SB Structures, LLC, in the amount of $444,783.22.  Council Concur.   c) AB ‐ 2142 Administrative Services Department recommended setting a public hearing date on  May 21, 2018 to solicit public input on the preliminary 2019/2020 Biennial Budget  development. Council Concur; Set Public Hearing on May 21, 2018.   d) AB ‐ 2145 Community & Economic Development Department requested authorization to hire  a Construction Inspector at Step E of salary grade a21. Refer to Finance Committee.   f) AB ‐ 2140 Public Works Department requested authorization to overfill a Water Utility  Instrumentations/SCADA Technician position for two months, June and July 2018, due to the  incumbent's pending retirement. Refer to Finance Committee.   g) AB ‐ 2134 Transportation Systems Division recommended adopting a resolution authorizing  the temporary total closure of NE 31st St., from 150 feet east of the intersection of NE 31st St.  and Jones Ave NE and ending 50 west of the driveway at 2100 NE 31st St., for up to 120  calendar days between June 18 and December 31, 2018, in order to construct the NE 31st St.  Bridge Replacement project. Refer to Transportation (Aviation) Committee.   h) AB ‐ 2135 Transportation Systems Division recommended adopting a resolution authorizing  the temporary total closure of N 27th Pl, between 1140 N 27th Pl. and 1161 N 27th Pl., for 90  calendar days between June 18 and December 31, 2018 to construct the N 27th Place Bridge  Scour Repair project. Refer to Transportation (Aviation) Committee.   i) AB ‐ 2138 Transportation Systems Division recommended approval of Change Order No. 2 to  CAG‐17‐167, with R.W. Scott Construction Company, in the amount of $301,669.82, in order  to reconcile bid quantity variances for the Sidewalk Rehabilitation and Replacement and  Street Overlay 2017 project. Council Concur.   j) AB ‐ 2139 Transportation Systems Division recommended approval of an agreement with  Otak, Inc., in the amount of $120,300, for preliminary design and permitting work for the May  Creek Trail project; and recommended adoption of a resolution to enter into an interlocal  agreement with the Washington State Department of Transportation regarding  reimbursement of City costs related to this project. Refer to Transportation (Aviation)  Committee.   k) AB ‐ 2132 Utility Systems Division recommended approval of an agreement with Transpo  Group USA, Inc., in the amount of $134,154.74, for the design of the fiber optic system for  Kennydale Fire Station 15 and water reservoir. Refer to Utilities Committee.   AGENDA ITEM #6. a) May 7, 2018 REGULAR COUNCIL MEETING MINUTES   MOVED BY PRINCE, SECONDED BY PERSSON, COUNCIL CONCUR TO APPROVE THE  CONSENT AGENDA, MINUS ITEM 6.E. CARRIED.    SEPARATE CONSIDERATION ‐ ITEM 6.E   e) AB ‐ 2133 Police Department recommended partially closing streets most frequently used by  illegal street racers on Friday and Saturday nights between 10:00 p.m. and 5:00 a.m. This  includes closure of Oakesdale Ave SW between SW 16th St. and SW 41st St., and closure of  SW 27th St. between Oakesdale Ave SW and Lind Ave SW. Refer to Public Safety Committee    MOVED BY PAVONE, SECONDED BY CORMAN, COUNCIL APPROVE CONSENT  AGENDA ITEM 6.E. AS COUNCIL CONCUR. CARRIED.    UNFINISHED BUSINESS   a) Finance Committee Chair Persson presented a report recommending the topic of the Sunset  Multi‐Service & Career Development Center be referred out of the Finance Committee and into  the Committee of the Whole.    MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   b) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to  execute Amendment No. 1 to CAG‐17‐104 with Carollo Engineers, Inc. for $526,510 for the  implementation of Phase 2B for the Kennydale Lakeline Sewer System Evaluation.    MOVED BY WITSCHI, SECONDED BY MCIRVIN, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.    LEGISLATION   Ordinances for second and final reading:   a) Ordinance No. 5880:  An ordinance was read amending the City of Renton fiscal years  2017/2018 biennial budget as adopted by Ordinance No. 5824 and thereafter amended by  Ordinance Nos. 5835, 5850 and 5864, in the amount of $81,141,977.    MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL ADOPT THE ORDINANCE AS  READ. ROLL CALL: ALL AYES. CARRIED.   b) Ordinance No. 5881: An ordinance was read amending Chapter 6‐32 of the Renton Municipal  Code, expanding fair housing regulations prohibiting property owners and property managers  from discriminating against tenants or potential tenants on the basis of participation in any  federal, state or local government, private nonprofit, or other housing assistance programs,  and providing for severability and establishing an effective date.    MOVED BY PRINCE, SECONDED BY PAVONE, COUNCIL ADOPT THE ORDINANCE AS  READ. ROLL CALL: ALL AYES. CARRIED.           AGENDA ITEM #6. a) May 7, 2018 REGULAR COUNCIL MEETING MINUTES  c) Ordinance No. 5882: An ordinance was read adding Section 1‐2‐3 to the Renton Municipal  Code, allowing the City Clerk to make nonsubstantive corrections to ordinances, and  amending subsection 4‐8‐080.G and Section 4‐9‐025 of the Renton Municipal Code, amending  the review process for Title IV amendments to allow purely administrative or procedural  amendments to advance directly to Council, and providing for severability and establishing an  effective date.    MOVED BY MCIRVIN, SECONDED BY PAVONE, COUNCIL ADOPT THE ORDINANCE  AS READ. ROLL CALL: ALL AYES. CARRIED.    NEW BUSINESS   Please see the attached Council Committee Meeting Calendar.    Councilmember Pérez remarked that she had received correspondence from Diane Dobson,  Renton, asking the City to clean up the Liberty Park Grandstand.    MOVED BY PÉREZ, SECONDED BY PRINCE, COUNCIL REFER CORRESPONDENCE  FROM DIANE DOBSON REGARDING CONTAMINATION FROM RATS AT THE  LIBERTY PARK BALL FIELD GRANDSTAND TO THE ADMINISTRATION. CARRIED.    Councilmember Corman expressed his appreciation to the Mayor and City staff for their  timely response to the logging issue on Cougar Mountain. He indicated that because of the  comments provided by the City of Renton and the City of Newcastle, the state's Department  of Natural Resources is bringing in additional environmental experts to review the logging  permit application.    ADJOURNMENT    MOVED BY PRINCE, SECONDED BY WITCHI, COUNCIL ADJOURN. CARRIED. TIME:  7:36 P.M.    Jason A. Seth, CMC, City Clerk  Jason Seth, Recorder  Monday, May 7, 2018  AGENDA ITEM #6. a) Council Committee Meeting Calendar May 7, 2018 May 10, 2018 Thursday 3:30 PM Utilities Committee, Chair Witschi – Council Conference Room 1. Kennydale Fire Station and Water Reservoir Fiber Optic System Design 2. Emerging Issues in Utilities 4:00 PM Planning & Development Committee, Chair McIrvin - Council Conf. Rm. 1. Title IV Development Regulations 2. Multi-family Property Tax Exemptions 3. City Center Plan Text Amendments 4. Emerging Issues in CED May 14, 2018 Monday 4:30 PM Finance Committee, Chair Persson – Council Conference Room 1. Bad Debt Write-off 2. Overfill Water Utility Instrumentations/SCADA Technician Position 3. Compensate Bradshaw as Construction Inspector at Step E 4. Senior Center Energy Upgrades – Final Payments 5. Vouchers 6. Emerging Issues in Revenue Streams CANCELLED Public Safety Committee, Chair Pavone 6:00 PM Committee of the Whole, Chair Prince – Conferencing Center 1. Police Training Space 2. Economic Development/Downtown Revitalization Update AGENDA ITEM #6. a) AB - 2149 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Reappointments to City Center Community Plan Advisory Board RECOMMENDED ACTION: Council Concur DEPARTMENT: Executive STAFF CONTACT: April Alexander, Executive Assistant EXT.: 6520 FISCAL IMPACT SUMMARY: None SUMMARY OF ACTION: Mayor Law reappoints the following to the City Center Community Plan Advisory Board: Mr. George Daniels and Ms. Laura Bloch for a three-year term expiring 4/30/21 Mr. Robert Prather for a one-year term expiring 4/30/19 EXHIBITS: A. Recommendation Memo for George Daniels and Laura Bloch B. Recommendation Memo for Robert Prather STAFF RECOMMENDATION: Confirm Mayor Law's reappointments to the City Center Community Plan Advisory Board: George Dan iels, Laura Bloch and Robert Prather. AGENDA ITEM #6. b) DEPARTMENT OF COMMUNITY ILJI AND ECONOMIC DEVELOPMENT Ji M EM OR A N D U M DATE:April 9,2018 TO:Denis Law,Mayor FROM:C.E.“Chip”Vincent,CED Administrator SUBJECT:Reappointment to the City Center Community Plan Advisory Board:George Daniels and Laura Bloch George Daniels and Laura Bloch have consistently demonstrated a commitment to their positions on the City Center Community Plan Advisory Board and to the fulfillment of the City Center Plan.They both have the ability to participate fairly and equitably while representing the community at large. I recommend that they each be reappointed to a new three year term,expiring on April 30,2021. h:\ced\planning\community planning\city center\advisory board\appointments &reappointments\bloch and daniels reappointment -3 year.doc AGENDA ITEM #6. b) DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT MEMORANDUM DATE:April 9,2018 TO:Denis Law,Mayor I 7 FROM:C.E.“Chip”Vincent,CED Administrator(/ SUBJECT:Reappointment to the City Center Community Plan Advisory Board:Robert Prather Robert Prather has consistently demonstrated a commitment to his position on the City Center Community Plan Advisory Board and to the fulfillment of the City Center Plan.He also has the ability to participate fairly and equitably while representing the community at large. I recommend that he be reappointed to a new one-year term,expiring on April 30, 2019. h:\ced\pla nning\community planning\city center\advisory board\appointments &reappointments\prather reappointment -1 year 2nd time.doc AGENDA ITEM #6. b) AB - 2150 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Reappointments for Renton Airport Advisory Committee RECOMMENDED ACTION: Council Concur DEPARTMENT: Executive STAFF CONTACT: April Alexander, Executive Assistant EXT.: 6520 FISCAL IMPACT SUMMARY: None SUMMARY OF ACTION: Mayor Law reappoints the following to the Renton Airport Advisory Committee for terms expiring 5/7/21: Marleen Mandt (Kennydale Neighborhood, primary position) Kenneth Williams (West Hill Neighborhood, primary position) Steve Beardslee (Airport-At-Large, primary position) Karen Stemwell (Aircraft Owners & Pilots Associations, alternate position) Alfred Banholzer (Washington Pilots Association, primary position) EXHIBITS: A. Recommendation Memo STAFF RECOMMENDATION: Confirm Mayor Law's reappointments of Marleen Mandt, Kenneth Williams, Steve Beardslee, Karen Stemwell and Alfred Banholzer to their respective positions on the Renton Airport Advisory Committee. AGENDA ITEM #6. c) PUBLIC WORKS DEPARTMENT MEMORANDUM DATE:April 25,2018 TO:Denis Law,Mayor1 FROM:Gregg Zimmermj’Fklic Works Administrator STAFF CONTACT:Harry Barrett,Jr.,Airport Manager,ext.7477 SUBJECT:Renton Airport Advisory Committee Membership Reappointments The Renton Airport Advisory Committee (RAAC)has several terms expiring May 7,2018.Those positions are as follows: 4A1ViE PÔSJt1ON Marleen Mandt Kennydale Primary May 5,2001 Kenneth Williams West Hill Primary November 19,2012 Steve Beardslee Airport-at-Large Primary March 11,2013 Aircraft Owners and Pilots Karen Stemwell Association Alternate May 7,2001 Washington Pilots Association Alfred Banholzer Primary May 7,2007 The above-listed incumbents are considered to be members of good standing.Based on individual conversations with these members,Airport management has determined each of them has a desire to continue to serve on the Committee.These members understand and are committed to the City’s Airport Master Plan,mission statement and Business Plan.In addition they have demonstrated the ability to analyze detailed information to balance competing objectives presented to the Committee. The Airport management team recommends these members be reappointed to their respective positions on the Renton Airport Advisory Committee with terms set to expire May 7,2021. In addition two RAAC members also with terms expiring May 7,2018 have declined reappointment. Those members are Robert Dempster,representing the Aircraft Owners and Pilots Association as its primary member and David Basco,the primary representative from the Renton Hill/Monterey Terrace neighborhoods.The Airport management team will continue to accept applications to fill these vacancies,as well as five other alternate position vacancies,two of which represent the Airport-at-Large,while the other three represent the Talbot Hill,South Renton,West Hill neighborhoods. cc:Bob Harrison,Chief Administrative Officer Jim Seitz,Transportation systems Director April Alexander,Executive secretary Susan Campbell-Hehr,Administrative Secretary I H:\File Sys\AIR -Airport,Transportation Services Division\O1 Administration\02 Committees\Airport Advisory\RAAC -Membership\2 - Reappointments\2018 Reappointments\revRAAC Reappointment memo 2018.docx AGENDA ITEM #6. c) AB - 2152 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Amending Renton Municipal Code 10-5, Vehicle Impoundment and Redemption RECOMMENDED ACTION: Refer to Public Safety Committee DEPARTMENT: City Clerk STAFF CONTACT: Jason Seth, City Clerk EXT.: 6502 FISCAL IMPACT SUMMARY: N/A SUMMARY OF ACTION: On November 6, 2017, the administration referred an ordinance amending Renton Municipal Code (RMC) 10- 5, Vehicle Impoundment and Redemption, to the Public Safety Committee for review. However, prior to adoption of the ordinance, it was pulled from consideration and has since undergone several revisions. In order to fully apprise Council of the new revisions, the administration is requesting this item be re -referred to the Public Safety Committee. This ordinance conforms the Renton Municipal Code to State law, clarifies when notice is required prior to impoundments, and confers jurisdiction of impoundment hearings from the City Hearing Examiner to the Renton Municipal Court. EXHIBITS: A. Draft Ordinance STAFF RECOMMENDATION: Approve the recommended amendment to Renton Municipal Code 10 -5. AGENDA ITEM #6. d)   1  CITY OF RENTON, WASHINGTON    ORDINANCE NO. ________    AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING CHAPTER  10‐5 OF THE RENTON MUNICIPAL CODE, CLARIFYING IMPOUNDMENT AND  REDEMPTION OF VEHICLE REGULATIONS, DESIGNATING THE RENTON  MUNICIPAL COURT AS THE POST IMPOUNDMENT HEARING VENUE, AND  PROVIDING FOR SEVERABILITY AND ESTABLISHING AN EFFECTIVE DATE.    THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS:  SECTION I. Chapter 10‐5 of the Renton Municipal Code, is amended as follows:  CHAPTER 5  IMPOUNDMENT AND REDEMPTION OF VEHICLES  SECTION:  10‐5‐1:    Definitions  10‐5‐2:    Impoundment Of Vehicles, Notice  10‐5‐3:    How Impoundment Is To Be Effected Purpose and Intent  10‐5‐4:    Owner Of Impounded Vehicle To Be Notified  10‐5‐5:    Redemption Of Impounded Vehicles  10‐5‐6: Cancellation Of Hearing Challenging the Impoundment –  Requirements  10‐5‐7:    Post Impoundment Hearing Procedure  10‐5‐8:    Abandoned Vehicles  10‐5‐9:    Renton Police Department Record Of Impounded Vehicles  10‐5‐10:    Approved Tow Company Duties And Records  10‐5‐11:    Severability  10‐5‐12:    Approved Tow Rates Required  10‐5‐13:    Penalties For Violations By Approved Tow Agency    10‐5‐1 DEFINITIONS:  A. APPROVED TOW COMPANY: Any person, firm, partnership, tow operator,  association or corporation approved by the Renton Police Department that  engages in the impounding, transporting, or storage of vehicles, or the disposal of  abandoned vehicles. Approved tow companies must comply with all State laws,  County ordinances, and any Federal law including antitrust laws.  AGENDA ITEM #6. d) ORDINANCE NO. ________  2  B. HIGHWAY:  The entire width between the boundary lines of every way  publicly maintained when any part thereof is open to the use of the public for  purposes of vehicular travel.  C. IMPOUNDMENT: As used in this Chapter, impoundment shall have the  definition set forth in RCW 46.55 for “impound” and, in addition, shall include the  removal of a vehicle to a storage facility either by an officer or authorized agent  of the Renton Police Department or by an approved towing company for towing  and storage in response to a request from an officer or authorized agent of the  Renton Police Department.  D. VEHICLES: As used in this Chapter, vehicle shall have the definition set  forth in RCW 46.04 and, in addition, shall include any vehicle hulk as the same is  defined in Renton Municipal Code Section RMC 6‐1‐1.   10‐5‐2 IMPOUNDMENT OF VEHICLES, NOTICE:  A.    When A Vehicle May Be Impounded Without Prior Notice: A vehicle may  be impounded with or without citation and without prior notice to its owner for  any of the following reasons:  1.    The vehicle is impeding or is likely to impede the normal flow of  vehicular or pedestrian traffic; or  2.    The vehicle is illegally parked in a conspicuously posted restricted zone  where parking is limited to designated classes of vehicles or is prohibited during  certain hours, on designated days or at any time and where the vehicle is  interfering or likely to interfere with the intended use of such a zone; or  AGENDA ITEM #6. d) ORDINANCE NO. ________  3  3.    When a vehicle without a special license plate, card, or decal  indicating that the vehicle is being used to transport a disabled person as defined  under Chapter 46.16 RCW is parked in a stall or space clearly and conspicuously  marked as provided in RMC Chapter 10‐10, whether the space is provided on  private property without charge or on public property; or  4. The vehicle poses an immediate danger to public safety; or  45.    A police officer has information sufficient to form a reasonable belief  that the vehicle is stolen; or  56.    A police officer has information sufficient to form a reasonable belief  that the vehicle constitutes evidence of a crime or contains evidence of a crime, if  impoundment is reasonably necessary to obtain or preserve such evidence; or.   6.    The vehicle is parked without authorization on residential property.  7.    The vehicle is parked on private, nonresidential City property or right  of way, properly posted under to the extent required by RCW 46.55.070; or.   8. The vehicle is parked on a Highway and its vehicle registration is  expired by more than forty‐five (45) days; or    9. The vehicle is a junk vehicle or vehicle hulk, as that term is defined by  RMC 6‐1, and is parked on a Highway, street, alley, or road open to the public or  on municipal or other public property; or  8.10.    Impound without notice is otherwise authorized required by law.   Nothing in such this Section shall be construed to authorize seizure of a  vehicle without a warrant where a warrant would otherwise be required.  AGENDA ITEM #6. d) ORDINANCE NO. ________  4  B.    When A Vehicle May Be Impounded After Notice: A vehicle not subject  to impoundment under Section RMC 10‐5‐2.A may be impounded after notice of  such proposed impoundment has been attached to and conspicuously displayed  on the vehicle for a period of twenty‐four (24) hours prior to such impoundment,  for the following reasons:   1.    Such vehicle is left unattended on a public highway. When such  vehicle is parked and/or used in violation of any law, ordinance or regulation; or  2.    Such vehicle is a junk or abandoned vehicle, as defined in Renton  Municipal Code Section RMC 6‐1‐1.; or  3.    Such vehicle is left unattended without authorization on private City  owned non‐highway property not posted in accordance with RCW 46.55.070; or  4.   When such vehicle is so mechanically defective as to be unsafe for  operation; provided, however, that this section shall not be construed to prevent  the operation of any such defective vehicle to a place for correction of  equipment defect in the manner directed by any police officer.    10‐5‐3 HOW IMPOUNDMENT IS TO BE EFFECTED: PURPOSE AND INTENT:  All impoundments authorized by the City shall be conducted in accordance with  state law, as prescribed by Chapter 46.55 RCW, which is hereby adopted by  reference and incorporated into this chapter. This Chapter is not intended to  replace or subvert the state law governing impoundments or apply to privately  AGENDA ITEM #6. d) ORDINANCE NO. ________  5  authorized impoundments. This ordinance is intended to supplement and  complement existing state law.   When impoundment is authorized by this Chapter, a vehicle may be impounded  by an approved towing company at the request of an officer or authorized agent  of the Renton Police Department.   10‐5‐4 OWNER OF IMPOUNDED VEHICLE TO BE NOTIFIED:  A.    Not more than forty‐eight (48) twenty‐four (24) hours after impoundment  of any vehicle, the Renton Police Department shall mail a notice of impound,  hereinafter referred to as the impound report, and notice of redemption and  opportunity for a hearing shall be mailed to the registered owner and legal owner  of an impounded vehicle, as may be disclosed by the vehicle license number, or  vehicle identification number (VIN), if such be obtainable, unless the impound  report shall be mailed to the registered owner at the address provided by the  Washington State Department of Motor Vehicles Licensing, or the corresponding  government agency of any other state or province. If the officer person requesting  the impound has reason to believe that the registered owner is residing or is in  custody at some different address known to the officer requestor, a copy of the  impound report and notice of the right of redemption and opportunity for a  hearing shall be sent to that address. The impound report shall contain the  particulars of the impoundment, the name, phone number and address of the tow  company involved, and location of storage of the vehicle if not that company’s  address.  AGENDA ITEM #6. d) ORDINANCE NO. ________  6  B.    Written notice of redemption and opportunity for a hearing as set forth  on a form provided by the Renton Police Department with information required  by Chapter 46.55 RCW and a copy of the tow and storage receipt shall be given by  the tow company to each person who seeks to redeem an impounded vehicle. The  tow company shall maintain a record evidenced by the redeeming person’s  signature that such notification was provided.  C.    Similar written notice and record of notification for redemption and  opportunity for a hearing as set forth on a form provided by the Renton Police  Department shall likewise be given by the tow company at the time of releasing a  vehicle impounded for investigatory purposes pursuant to Section 10‐5‐2A.  Renton Police Department shall notify the tow company of the authorization to  release such vehicle.   10‐5‐5 REDEMPTION OF IMPOUNDED VEHICLES:  Vehicles impounded by the City shall be redeemed only under the following  circumstances:  A.    Only the registered owner, a person authorized by the registered owner,  or one who has purchased a vehicle from the registered owner, who produces  proof of ownership or authorization and signs a receipt therefor, may redeem an  impounded vehicle.   B.    Any person so redeeming a vehicle impounded by the City shall pay to the  towing company the costs of impoundment (towing and storage) prior to  redeeming such vehicle.  AGENDA ITEM #6. d) ORDINANCE NO. ________  7  C.    Any person seeking to redeem an impounded vehicle has a right to a  hearing, conducted in accordance with this Chapter, to contest the validity of the  impoundment or the amount of towing and storage charges, except no appeal  shall be had permitted when:  1.    The appeal is to the tow company rates and the rates do not exceed  those approved by the City.  2.    The vehicle was impounded because it was stolen or used in the  commission of a felony.   10‐5‐6  CANCELLATION OF HEARING: CHALLENGING THE IMPOUNDMENT –  REQUIREMENTS:  A. Statute Of Limitations: Pursuant to RCW 46.55.120, any person seeking to  challenge the validity of an impoundment authorized by the City of Renton  pursuant to this chapter or the amount of towing and storage charges therefore  shall request a hearing by paying a filing fee and filing a request for hearing with  the Renton Municipal Court no later than ten (10) days after receiving written  notice of the right of redemption and opportunity for hearing and no less than six  (6) days prior to the date the vehicle is schedule to be sold at auction.    B.  Waiver Of Hearing: If the hearing request or the applicable filing fee is not  received by the Renton Municipal Court within the prescribed time, the right to a  AGENDA ITEM #6. d) ORDINANCE NO. ________  8  hearing is waived, and the registered owner (or entity) shall be liable for the  charged towing, storage, or other impoundment fees.  Any person redeeming an impounded vehicle in accordance with Section 10‐ 5‐5C shall have until ten (10) days after the date of the request to cancel the  hearing. If a hearing is cancelled more than ten (10) days after its request, then a  ten dollar ($10.00) cancellation fee must be paid to the City.   10‐5‐7 POST IMPOUNDMENT HEARING PROCEDURE:  A.    The Renton Municipal Court is vested with jurisdiction over any hHearings  requested pursuant to Section 10‐5‐4 this chapter or applicable state law  governing impoundments authorized by the City of Renton or its authorized  agents hereof shall be held by the City Hearing Examiner.   B.    The Hearing Examiner Renton Municipal Court shall, within ten five (510)  days after the request for a hearing, notify the registered tow truck operator, the  person requesting the hearing if not the owner, the registered and legal owners  of the vehicle or other item of personal property registered or titled with the  department, and the person or agency authorizing the impound shall notify the  motor vehicle owner in writing of:  1.    The hearing date and time; and  2.    If the owner of the motor vehicle desires to have the police officer  responsible for the impoundment or a representative of the towing company  present at the hearing, a written request on a document provided by the Hearing  AGENDA ITEM #6. d) ORDINANCE NO. ________  9  Examiner must be returned to the Hearing Examiner Renton Municipal Court no  later than ten (10) days prior to the hearing date;  3.    In absence of such a request, the officer’s impound report and/or tow  company’s tow and storage receipt shall be received in evidence.   C.    At the hearing, the Police Department may produce any relevant evidence  to show that the impound was proper. In absence of a request by the vehicle  owner pursuant to Section RMC 10‐5‐7.B and Section RMC 10‐5‐7.D of this  Section, the officer’s impound report and/or tow company’s tow and storage  receipt shall be received in evidence. In determining whether the fees charged  were proper, the Hearing Examiner Judge may take notice of the tow company’s  rates which shall be filed with the Hearing Examiner Renton Municipal Court and  available for public inspection.   D.    At the hearing, the owner of the motor vehicle impounded may produce  any relevant evidence to show that the impound and/or towing and/or storage  fees charged were not proper.  E.    In lieu of a personal appearance, the owner of the motor vehicle  impounded may provide the Hearing Examiner with a written statement of  position which the Hearing Examiner may consider in the same manner as the  officer’s impound report and the tow company’s tow and storage receipt.  F.E.   At the conclusion of the hearing, and within no later than thirty (30) days  following the hearing, the Hearing Examiner Judge shall determine whether the  impoundment, and/or towing, and/or storage any fees charged for towing and/or  AGENDA ITEM #6. d) ORDINANCE NO. ________  10  storage were proper and who is responsible for payment of the fees. The court  may not adjust fees or charges that are in compliance with the posted or  contracted rates and provide both parties with a copy of his decision setting forth  in writing the reasons for the determination reached. Should the Hearing  Examiner Judge determine that the towing and/or storage fees charged were not  proper, then the Hearing Examiner Judge shall determine the proper amount.   After each hearing, the court shall provide both parties with a copy of the court’s  decision setting forth in writing the reasons for the determination reached, and  provide a copy of his the decision to the tow company and the Renton Police  Department.   G.F.    If the impoundment is found proper, any unpaid impoundment, towing,  and storage fees as permitted under this chapter together with any applicable  court costs shall be assessed against the person(s) or entity requesting the  hearing, and no refund shall be granted. the expense of the hearing shall be  assessed as a civil penalty against the owner of the vehicle impounded. The  appearance cost of an approved tow company’s representative if requested shall  be a cost assessed, Section 10‐5‐7J of this Section notwithstanding.  H.G.    If the City’s authorization to impound is not found determined to be  proper in violation of this Chapter, the owner of the vehicle shall bear no costs,  and the City shall refund to the owner any expenses incurred for the cost of towing  and storage.   AGENDA ITEM #6. d) ORDINANCE NO. ________  11  H. If the impoundment is determined to be in violation of this Chapter due to  an error or omission of the tow company, or if the tow company is found to have  charged excessive fees, the owner of the vehicle shall bear no costs, and the tow  company shall refund any expenses incurred for the cost of towing and storage.  I.    Compensation for the hearing appearance of a representative of an  approved tow company shall be paid by the City at the rate of fifteen dollars  ($15.00) for such person’s appearance. Decisions issued by the Renton Municipal  Court in accordance with this Chapter may be appealed by filing a petition in King  County Superior Court no later than thirty (30) days following the Renton  Municipal Court’s entry of the decision.  J.   Nothing in this Chapter shall be construed to prevent the Hearing Examiner  Judge exercising discretion in assessing penalties, costs or arranging time  payments if justice so requires.   K. No attorneys’ fees shall be awarded to any party, except where required  by state or federal law.  10‐5‐8 ABANDONED VEHICLES:  Any impounded vehicle not redeemed within fifteen (15) days of mailing of the  notice required by Section 10‐5‐4 of this Chapter shall be deemed abandoned;  provided that, if the Police Department has reason to believe that the owner of  such impounded vehicle is in custody of the Police Department jail incarcerated,  it shall be presumed that the vehicle is not abandoned until after the prisoner has  had an opportunity to be heard regarding the propriety of the impoundment and  AGENDA ITEM #6. d) ORDINANCE NO. ________  12  circumstances giving rise to such impoundment; provided further that, in the case  of a vehicle impounded by order of a police officer and held pursuant to police  order, the fifteen (15) days shall not begin until forty‐eight (48) hours after the  Police Department shall have notified both the owner and the towing company in  accordance with Section RMC 10‐5‐4.C that it has authorized the release of the  vehicle. Any vehicle so determined to have been abandoned shall be deemed to  be in custody of the Chief of Police.   No tow truck operator shall sell or otherwise dispose of an abandoned vehicle  regardless of its age unless he has first complied with the provisions of  RCW 46.52.120 and 46.55.130 Chapter 46.55 RCW.  In the case of failure to redeem an abandoned vehicle under RCW 46.55.120 an  officer shall send a notice of infraction by certified mail to the last known address  of the registered owner of the vehicle.   10‐5‐9 RENTON POLICE DEPARTMENT RECORD OF IMPOUNDED VEHICLES:  The Police Department shall keep, and make available for inspection, a record of  all vehicles impounded under the provisions of this Chapter. The record shall  include at least the following information:  A.    Vehicle make, year and model;  B.    Vehicle license number and state of registration;  C.    Vehicle identification number, if ascertainable;  D.    Such other descriptive information as the Chief of Police deems useful for  purposes of vehicle identification;  AGENDA ITEM #6. d) ORDINANCE NO. ________  13  E.    Name of impounding officer and serial number;  F.    Reason for impoundment, and the time, date and location the approved  towing company took custody.; and   G.    The written tow authorization form, if applicable.  10‐5‐10 APPROVED TOW COMPANY DUTIES AND RECORDS:  Each approved tow company as conditions of approval in addition to fully  complying with the standards set by the Police Department must:  A.    File its towing and storage rates with the Police Department.  B.    Mail within twenty‐four (24) hours of receipt thereof a fully completed  and signed copy of any requests for hearing and promissory note and copy of the  tow and storage receipt to the Hearing Examiner Renton Municipal Court.  C.    Keep, and make available for Police Department inspection, a record of all  vehicles which it impounds under the provisions of this Chapter. The record shall  include:  1.    A copy of each tow and storage receipt which shall contain at least the  following information:  a.    Information on the person securing the release of a towed vehicle,  including the person’s name, relationship to owner (if not the owner), driver’s  license number, signature and address;  b.    Vehicle make, year, license and identification numbers;  c.    Any unusual circumstance of the tow;  d.    Time, date, location of tow and distance towed;  AGENDA ITEM #6. d) ORDINANCE NO. ________  14  e.    Name of tow truck driver and his signature.   2.    A copy of each request for a hearing for all vehicles redeemed, signed  by the redeeming person.   3.    A copy of each monthly notarized claim for reimbursement for towing,  storage and mailing costs.  4.    Copies of any notices and/or forms the Approved Tow Company was  required to provide to the vehicle owner(s), pursuant to Chapter 46.55 RCW.  10‐5‐11 SEVERABILITY:  Should any section, subsection, paragraph, sentence, clause or phrase of this  Chapter be declared unconstitutional or invalid for any reason, such decision shall  not affect the validity of the remaining portions of this Chapter.   10‐5‐12 APPROVED TOW RATES REQUIRED:  Each approved tow company shall have its tow rates approved by the Police  Department, and an approved tow company shall not charge greater than its  approved tow rates. To the greatest extent possible, the approved tow rates shall  be equivalent to those approved by the State patrol for tows it initiates.   10‐5‐13 PENALTIES FOR VIOLATIONS BY APPROVED TOW AGENCY:  Should any approved tow agency violate any section of this Chapter, including  charging fees in excess of the approved tow rates, then it shall be subject to  progressive penalties. For the first violation of the Code this Chapter, the  offending tow agency shall be charged a civil penalty of not more than one two  hundred fifty dollars ($100250.00). For the second such violation within any  AGENDA ITEM #6. d) ORDINANCE NO. ________  15  calendar year, the tow agency shall be penalized up to five hundred dollars  ($500.00). For the third and subsequent violations, the tow agency may be placed  on probation, temporarily removed from the list of tow agencies, or removed from  the list of approved tow agencies and not permitted to reapply for inclusion within  that list for a period of one (1) year. Each penalty shall be determined by the Police  Chief or his designee after reviewing the available information. Should the tow  agency be aggrieved by the decision of the Police Chief or his designee, then the  tow agency may appeal, within twenty (20) days of receipt of notification of any  penalty, to the Hearing Examiner. Such appeal shall be in writing and shall state  all reasons why the aggrieved agency is appealing. The Hearing Examiner’s  decision shall be rendered not more than thirty (30) days after an appeal hearing  to be established by the Hearing Examiner. Any appeal from the Hearing  Examiner’s appeal decision shall be to filed with the King County Superior Court  by Writ of Review brought within twenty (20) days of the Hearing Examiner’s  written decision.   SECTION II. If any section, subsection, sentence, clause, phrase or work of this  ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction,  such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other  section, subsection, sentence, clause, phrase or word of this ordinance.  SECTION III. This ordinance shall be in full force and effect thirty (30) days after  publication of a summary of this ordinance in the City’s official newspaper.  The summary shall  consist of this ordinance’s title.      AGENDA ITEM #6. d) ORDINANCE NO. ________  16  PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2018.                         Jason A. Seth, City Clerk    APPROVED BY THE MAYOR this _______ day of _____________________, 2018.                         Denis Law, Mayor    Approved as to form:             Shane Moloney, City Attorney  Date of Publication:      ORD:1968:5/1/18:scr    AGENDA ITEM #6. d) AB - 2151 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Authorization to Purchase Fleet Vehicles Approved in the 2018 Budget and Carry Forward Ordinance RECOMMENDED ACTION: Council Concur DEPARTMENT: Public Works Administration STAFF CONTACT: Ron Kahler, Fleet Maintenance Manager EXT.: 2660 FISCAL IMPACT SUMMARY: The Fleet Maintenance Section obtained quotes to purchase three replacement vehicles. One vehicle is for the Community Services Department’s Facilities Division, estimate d at $41,000, which is $1,000 less than the budgeted amount. This vehicle was added as a replacement purchase as part of the 2018 carry forward and first quarter budget adjustment ordinance approved April 23, 2018. The other two vehicles are for the Publ ic Works Maintenance Division and consist of a street sweeper, replacing the one damaged by fire in 2017, and a vactor truck. The sweeper estimate is $231,495, which is $48,505 less than the budgeted amount approved in the carry forward ordinance. The estimate for the vactor truck is $408,619, which is $11,381 less than the approved budgeted amount. The total estimated cost of the three vehicles is $681,114. The vehicles will be purchased from various vendors using state bid contract numbers or the Hous ton-Galveston Area Council (HGAC) bid contract. SUMMARY OF ACTION: This is a request for authorization to purchase three replacement vehicles. Two of the vehicles (the sweeper and van) were approved by Council as part of the 2018 carry forward and first quarter budget adjustment ordinance on April 23, 2018. The replacement vactor truck is included in the Equipment Rental Fund 501 Vehicle Replacement and Acquisition Schedule as part of the 2017 -2018 biennium budget. The vehicles will be purchased from various vendors using state bid contract numbers or the Houston -Galveston Area Council (HGAC) bid contract. Department/ Existing Vehicle Year Purchased Replacement Make & Model Replacement Cost Vendor & State Contract Bid Number PW Tymco Sweeper #E126 2008 Elgin Crosswind J Sweeper $231,495 Owen Equipment #02613 CS Chevrolet Van #B107 2002 Ford Cargo Van $41,000 Columbia Ford #05916 PW INTE Vactor #E122 2009 Vactor MC1511 $408,619 GapVax, Inc. HGAC AGENDA ITEM #6. e) EXHIBITS: A. Owen Equipment Company #10252017 B. Columbia Ford #2018-4-527 C. GapVax, Inc. #SC01-18 STAFF RECOMMENDATION: Authorize the purchase of three replacement vehicles. All vehicles are within the approved budget. The vactor was approved as part of the Equipment Rental Fund 501 Vehicle Replacement and Acquisition Schedule in the 2017-2018 biennium budget. Replacement of the sweeper and van was approved as part of the 2018 carry forward and first quarter budget adjustment ordinance. AGENDA ITEM #6. e) OWEN EQUIPMENT COMPANY WSDOT CONTRACT 02613 Crosswind J Sweeper Owen Equipment Company Municipality City of Renton Address 3555 NE 2nd Street City, State, Zip Renton, WA. 98056 Contact Name Ron Kahler Contact Phone #(425) 430-7440 Contact Fax # PO Number Dave Armstrong Quote Date:10/25/2017 Qty Part #DESCRIPTION 7/24/2017 Ext 1 Crosswind J Sweeper/M2 Convnetional Chassis 208,049.00$ 208,049.00$ General Specifications (See Bid Specs for More Detail) Crosswind J Sweeper/M2 Convnetional Chassis John Deere T 3 115hp Aux Engine (Now Replaced by Tier 4i) Dual Gutter Brooms Total Sweeping Path = 120inches 2700 Sq In Pickup Head 20,000 CFM Blower 8 Cubic Yard Debris Body 240 Gallons Water Spray Nozzles (16 Total) M2 Conventional Chassis (2010 Emissions) Non Standard Options Included in Price (With Deduction Amounts Listed) 1061652 Anti Siphon 2-1/2" Air Gap (126.00)$ 1059209 Hopper Deluge (675.00)$ 1075400 AM/FM CD (583.00)$ 1087729 SB Tilt Left (753.00)$ 1087730 SB Tilt Right (753.00)$ 1092227 Lifeliner Hopper System w/Warranty (5,193.00)$ 1078045 Turbo II Precleaner (333.00)$ 1082931 In Cab Air Cleaner Restriction Guage-Chassis (664.00)$ 1 1086456 Variable Speed Side Brooms (2,333.00)$ (2,333.00)$ 1 1078204 Air Filter Restriction Indicator Light in Cab (426.00)$ (426.00)$ 1090157 (2) Rear Bumper Mounted Strobes (575.00)$ 1090458 (2) Rear 7" Alternating Flashers (534.00)$ 1088219 Two Rear Strobes with Guards (720.00)$ 1088229 Rear LED Arrowboard (1,796.00)$ M2 Conventional Chassis (2010 Emissions)(66,990.00)$ 1032484 25' Water Fill Hose (115.00)$ 702430 Crosswind Service Manual (89.00)$ 704050 John Deere Parts Manual (44.00)$ 704052 John Deere Service Manual (134.00)$ 704005 M2 Parts Book (285.00)$ 704007 M2 Service Manual (230.00)$ TOTAL DEDUCTIONS (2,759.00)$ Contract # Sales Representative WSDOT 02613 - Regenerative Vacuum Pickup - Crosswind J Company 1 OF 2 AGENDA ITEM #6. e) OWEN EQUIPMENT COMPANY WSDOT CONTRACT 02613 Crosswind J Sweeper Available Options (With Pricing) 1 Tier 4i Shared Power System 7,364.00$ 7,364.00$ 1 LEFT HAND FENDER MOUNTED MIRROR $560 560.00$ 1 BATTERY DISCONNECT SWITCH $560 560.00$ 1 (2) BOSTROM AIR 905 CLOTH HI-BACK $2,040 2,040.00$ 1 1085864 Right Hand Side Inspection Door 454.00$ 454.00$ 1 1087829 PM10 Water System 3,205.00$ 3,205.00$ 1 1086441 Hydraaulic Wandering Hose 4,558.00$ 4,558.00$ 1 1070059 Air Purge for Water System 367.00$ 367.00$ 1 LED / STOP / TAIL / REAR TURN LIGHT $641 641.00$ 1 AUXILIARY HYDRAULIC PUMP $1,271 1,271.00$ 1 LOW PRESSURE WASH DOWN $1,119 1,119.00$ 1 6" HOPPER DRAIN $897 897.00$ 1 HYDRAULIC OIL LEVEL GUAGE W/THERMOMETER $181 181.00$ 1 AUTO LUBE SWEEPER ONLY $4,599 4,599.00$ TOTAL ADDITIONS 27,816.00$ Total Tag Price (Before Applicable Taxes)233,106.00$ DES Management Fee - .076% (Mark Roush DES 360-407-9311)1,771.61$ 1 Trade in unit -25000 (25,000.00)$ Price Before Sales Tax 209,877.61$ Tax Rate Applicable Taxes 10.30%21,617.39$ Total Tag Price 231,495.00$ Delivery per the contract is 120 days after receipt of order (Dependent on chassis/options selected) Customer Approval Date 2 OF 2 AGENDA ITEM #6. e) Contract & Dealer Information Contract #: 05916 - Motor Vehicles Dealer: Columbia Ford Dealer Contact: Marie Tellinghiusen 700 7th Avenue Dealer Phone: (360) 423-4321 Ext: 187 Longview WA 98632 Dealer Email: orders@colford.com Organization Information Organization: RENTON CITY OF - 21725 Order Contact: Ron Kahler Contact Email: rkahler@rentonwa.gov Contact Phone: 425-430-7440 Organization Reference #: 190193 Vehicle Location: COVINGTON Quote #: 2018-4-527 Comments: Allied body kit per quote # 36642 Color Options Race Red (PQ) - 1 Tax Exempt: N Vehicle Options Order Code Option Description Qty Unit Price Ext. Price 2018-0418-001 2018 Ford Transit Low Roof T15 Full-Size Cargo Van, 60/40 Hinged Passenger Side Cargo Door (HSD), 8600# GVWR, Regular Wheelbase, 130 inch Wheelbase, 220 inch Overall Length, 83.6 inch Overall Height (E1Z/101A/130WB) 1 $22,370.00 $22,370.00 2018-0418-004 Low Roof T25, 9000# GVWR, Long Wheelbase, 148in WB, 238in OL, 83.6in OH (R2Z/101A/148WB) 1 $2,116.00 $2,116.00 2018-0418-021 Alternative Side Cargo Door(s): Sliding Passenger Side Cargo Door in lieu of 60/40 Hinged Door (ONLY available to be ordered with Low Roof Van, Standard with Medium/High Roof Vans) 1 $141.00 $141.00 2018-0418-026 HD Dual Batteries (70 amp-hours each and Absorbed Glass Mat) (Included w/ diesel engine)(63E) 1 $285.00 $285.00 2018-0418-036 Daytime Running Lights (942) 1 $43.00 $43.00 2018-0418-041 Mirrors, Long-Arm Non-Telescoping, Power Glass Adjust Heated with Turn Signals (544) 1 $213.00 $213.00 2018-0418-042 Reverse Sensing System (43R) 1 $286.00 $286.00 2018-0418-049 Power Inverter - 12V to 110V (must also order HD Dual Batteries #63E)(90C) 1 $97.00 $97.00 2018-0418-056 Wheels, Steel with Full Black/Silver Wheel Covers (Not available with Dual Rear Wheels)(Included with Exterior Upgrade Package #18D)(64H) 1 $33.00 $33.00 2018-0418-060 Back-Up Alarm (43B) 1 $121.00 $121.00 2018-0418-064 Fixed Rear Door Glass with Fixed Passenger-Side Door Glass (17B) 1 $243.00 $243.00 2018-0418-087 Seats: Cloth (Pewter Grey or Charcoal), 2-way manual (fore/aft/recline) driver and front passenger, driver-side and front passenger-side airbags, inboard armrests and driver-side manual lumbar. Also includes Safety Canopy side curtain airbags. (21L/21M) 1 $58.00 $58.00 AGENDA ITEM #6. e) 2018-0418-093 Vinyl, Front and Rear, includes wheel well cover and rear/side scuff plates (Not available with Auxiliary Air-Conditioning/Heat #57G) (Included with Load Area Protection Package #96D) (16E) 1 $236.00 $236.00 2018-0418-206 Fire Extinguisher (DLR) 1 $35.00 $35.00 2018-0418-208 Mud flaps, front and rear (DLR) 1 $144.00 $144.00 Request Totals Total Vehicles: 1 Sub Total: $26,421.00 8.4 % Sales Tax: $2,219.36 Request Total: $28,640.36 Dealer Comments: 04/30/18 Revised to add #923 Van package: custom package arrangement based on customer drawings per details in Allied estimate #36642, 80-1 conduit carrier, loose dividers: 12in and 14in deep shelves, upper and lower shelf of 4450. (DLR/ABW RC0201) $6,559.00. PO received. 6559.00 8.4% Sales Tax on Upfitting 550.96 Request Total Vehicle & Upfitting 35,750.32 AGENDA ITEM #6. e) tg?gOO2.E~>O._.wEQ.znSowwmmmmaQazimo.:.;93 Sea 5:.m3__&_:_E5323wswnrwmamWwnawwwmmnm 83.,»<<E.~a.~$S..w~.§s.&3.n§§a%ER.?.<§8miGums.bea5%uwN.&.=§-Es§.n.=§$§u.gr? x§&8m.m>o.®Eu.&a-&&.§_§§§EmamaMES262.3.“~mw~.E.<. W03.omW38?9%.Oo=:.wn8_."mQ~6<mx.:8. wumuuqmn m?%:w-5:Hmm:-$m-o§ m§L$._::;Wm:-§-8: mm_om®:goE_.Q.ooBco"Q©m~6<mx.ooE wmmmm.uaa_a...=mzaizoaisa.wa¢:.Eo_.%% A,wu.a.W_w.Hn..m..n..m_w._%.»M§.mm§%m.%.m%mmam?a?mgammamymaymy.a....am.mixmy$20.8 wWwW_w_.wmwwmm._E,wm.m.%§%%_&Mu?miaa?_%E.w§_.._.§_.%_...e%y..§&uma3:%_Esm... ..... §_%g.ma_%%e£%..:HE.n_.£Ho..oH..H%@... Uamolumos Z08”mamawannH:o_:n_om 3:39:053; Qmw/Sx309% 43%>=o.<m=oo3<32 a_._.._m.._@..auwwgw“_..%_%_.Aw.H<.y..,w¢.iw.._§§._§umM 2%a%aMa.a.W%§mav..n§%Ha_W2H.:w..&§§__EE2%m;ma§%@..wm9w. Ummnlumos 95%1_;o8_oom?2.CawcgmrnmOunosmRu25:9oxomnm~.§cm:58S_cm:5wmmnCa:vinomE.H».3H. HE5wzwzmraaOunoamA>+mv.onH5gamma8:a@285mmo5 ?aw.w.a._.§_§.m.a?iw,m_a,.<H._w.”%_..§....H_m,.m.”._U..¢H.m..“+H%e.UW_M uuuuuuuunil OEEQQ02:89 amQaamowimgm.._m...Hw&.H.m.m»..H..H.sM.%_m.a_§_..§EU Ummnlwmon AGENDA ITEM #6. e) mQ:.& 98E05wnaumwmataOO2.HW>O€Ea?znSowwmmwmaOsage»Ewowmaanma.3552:wannrwmmm2o." Him<<o..wm=m2mmcwaumnaa3.Oost??owEamm?é8madmoa.:.mwemm$23.8:. monsaaimEmmaanExam8?.G>O©du-€.f_m&.HranamcwaEammaGun3.war:_am=:%. _w:w.m:m >wm_._nv."Q3omwmzaoz. 93%:uQmu<mx.:5. H20.was .mE-&m.$3 m358-33 ¢n3.®mmw<wx.noB.G8Q>HHO2€>amw5<3cmwimwoum.mmzmrmMZQHZH Nw?oo W”,Eamw?.o.%m._mHw.Hm_§..;..mw_,z.,”.H%.a.§_mEg3%E:Eaguagw_E.WA_ww.m.m.um.~wM3..__mwww._w”m %_%_%@_%WEE..m,&.“”H,_m.@.H..._n.mq.n._Hm.._Hh_mm_wwH.w.m_mas...H..+ 682.5%:U08"Uamnlcmou .?mzoa:-amo>za+55“,<>%Cw.H.>:.Q>.Hm.0..ww>mmwzzum<>r<m154$.mumwmmzoa:xO>F<>ZHNm_umtumrmwHZEm€>amw.H>ZW .u.nmZoG:.3.0>.Ha?umCOEDrm<mrH2UHO>HOWOZmamO1ummaw.H.>ZwHommmwmzoa:.Hzmgrrncmaozmwmcsucmo,<>ammzmamx .@303:-wczmuO3“m<m1m:-5mooOFS(SHE_..>%.3..>._.momm>20O>?_.rm?mwwnmzoa:.S.ow>um4.0WOO._.m.3%m<>OC.C§wczmC803$>ZUHm, .smzoa:.Bram»mowmmzMONcw>_z<>r<mF020movecamnaznaz.S.ow>um.—.0xrd$zm_umxn>mm .5:30GI.aim»mowmmz10%uczw03..Baamz2:020mox.momEuzna:.O_>Z._.2.88mmamm£>amwwczmw>._.mUmo9.3®Nuoomm .NZSOGE-ncwwmzumP>UUmwHOVOW....zm_vmn.=oz>wm>NOAOU~#.Z_O_m:-5OPS38NEI<UW>~.=._O>C..<UW_<mZuczv .EESOGC->00HHOFUHZOr>o_umxmxamzzoz 5303:-wcwom<>r<m>4ox><_.2uw>_zGL3.w>:.<>_.<mV .33305:.Suomaummoc<_ZC.uaHO>.Z2OZHO5..IXm.H.<_..m’<E.$E.OPm>2m n€E_~_.?_£pm?mmEa?_w_%..%w&.E.a§§$3..MWN. EamnmsmvnwywamomaywumuwmEwnw.Em3.w_.%..§Ma.2%Em9H3_na.._.nQ3 Ummnlunoa mma(<>mmuo,<2Qxoc:aome??oaazomwmmmcxm am,mxr>zom2::Emm>2zowwrm 038o§ur><Zoczamoozmxozaoozaxorm>zmrm>mm_.<miamzH205.Emmm1.wo_E_&mmU:<nn_mmam23an?RN, Eonommamrm<mr:9:.w>r>x§Ewmoao<>nccZwmimm rim325$.Eorcummm.>ZUHZQwmzzmmzoo>am .>H2.HEcyzm>24OOFOWoammwam>zmrynw 9.85ads:now"omc%:c_E_2_OwnoamA995:0"nxnnnm~§cm:88::cmEnwmmoCa: mienE5Fa_£_&Owmozm3+5. Hm.Harmnomnwmmomawow_a_.w_n».6..:§.Emnm%m.wm.H.mw¢E_m....>_=w.:_m.__nwm,”Emwowmnmm E.”_U_wH.»%w_H_m§.%_uu§..%§.E.,_§%% Uamnluzoz omocoa36:m>mm.m>mmzoomrEramwmowmmz .mucQ36:m>mm.m>mmzoom.€>amx32:. omucgWWOZm>mm.2>._,mwO2\O3u2,50:HZOOZHWOFmox omocgmxozm>mm.m>mmzoomrmaxommComam:_u8:w_H ......“m“H..mmuw.___;...&u%m.”.”.H.HRWmmm§.§m§a_a§.megg AGENDA ITEM #6. e) Umna 03.5L:\m $§.:a oHm5OOZ.Ew>OH.m.W~OHZ®Soimmmmma0om.<_m._..um.n.hmowOmazom%5.?»max.ammowcwnrmmam Him€o:a_.§mm2.25:;3Oo==.mn8_.E3mmaaa8E5dmaw.:mwemm_._%a&.3:. monaaaimEEHcaExam8?-®>O@dm-€.f_m&.HraaamoaaEammmQuaS.3::_am=._u.. 9.1.5W034omwmzaoz9..§%:mo%<a£.a.>mm=nwa Ociuop m.m..mo_.: "$3.mag. mE-&m-33 Hmrraoaaz ?.@_n_am:m.H Uamnlcsoa .u~oczoG:.wmzo<>mrmr>amx>rmommwmmr.Go.xE,momm .mmZnG:-zmzoamreamMONWOOK:3.>20_~QH>.:OZ .m§n::.$3..=m><<U544.WOOZmrwoé53.3o.mowzmcn=>zzm_.w>c_cm Bozo:Z.U_OE.>_..~..OO.H>QmnoczamwzoczamuO2Bumommmoor 3Z$0_m:->:.HO?_>.EOzomm_.m<m_.sazumx M39306._.UOCELMworrmwO2>C.—.O_.m<mr€_zu Q3303:.WOUKcwE034. QNFZOG:.émwmrmmmmmzo?m«<53WOOZ.<>OCC~<_.mwozamommwmmr>75IX0253.. mazna:xEmdwommmm>oozCQEH-_uWOZq.-émmrmzF5mcwmwrmu EMUZOGZ-A8mawommmm>nozCOEH-EN.émmrmzP5mcwmmrmc . .... " mo?zna:-a>=.o>amcm:9: wmmozoa:XEwoo:29%EOwE.m.E0::?m2m:<mmrrmmG8:8a<OEAEomamCV2"Easwas Hon:58...039.mi: mmgmmmmm?wm?mwm?mm?nmmEmaUmam?Emam%mm§@w..JJ.......n...u. e%”UE%mm.%..$%myW1? .....pm$53".EUHEEmiEVE3&_§g%E2 Uamolusou .03.>nEmamaW2:_:\OEo:Wm:5_o .zoam”Zena.O30:>N#>0:EnOczum?mAmu?oum:35«M09 .3»./<:m_m:dyamz?mannarmc>202mam.H._M:._n>%n22::5run?m=..oE=na0::6Eu0..Ezmm? L305:,<mm:ao=.=WalEmac..."2..HEoFtown8us:0:.~o=.Edm:5a_._<m_..mmEm m:c8»m_mu dmmnrna_;o8_comaowncswc5awsoamEomsso?oxnma .“WWM.HWNMWwW.H.a_.H%.._.a_E._%§§.»..+»m+Q"A AGENDA ITEM #6. e) moS.& 9.8?ozmwwmcmnomtaOOZHW>O.H3:920éowwmmmma09:33 5:Omazom.mmica9.8.Hu?owcwormmam2o." HamQcawmra?mmu_.ouE.aa3.Ooznnw?onBEmm<m:8EaCm»?H...mwemmmama»?co»: %2==2:mREM.”caExam8?-®>O®dm-m.8-§_m.HrauamonwEammmQuaonu1=:am=._v: “Q3omwmzaoz9__.§.§33$.:5. _.3E=& 3""$3max: 23:2mE-&m-3% .1... max".mE-m$-maS jm:_w=€3©mmw<wx.ooB Ow.w_am\ulnam=mm~ 23:9 02.2.».Ummoluzaa om3&5: _W,“mA(,W_m,am”&,HnH.¢,H$_W.nwHm_?..,HwW_m Unmnlumoa +5203:.9wm>xéomxEmma-:m:.>o3FcxrmoéowwEomamQ2”rmaskmov 5330;:-Em?méowxEmma-mmF>owdrcxEmuéowwEomam$2..rmaswny:wmxEmmy @Ew.Zn§_ ‘,<:m_.mz52mcvmwrmc3.>m=mwm-3Emma:m>cm :§na__..:~>mEonozm:o_bmwoz_uw_<mw.mmam ._:9:nG__.._.w>_.._...nnozmzorumxozncwuuom 45285:.émmmrnzooxmorcmxEmurum..cE<mw_mBum Euzoa:.zoNN_.mw>n_».m_x@2oNN_.mm. _. Hsozoa:-mm;322mommx>nnmoma._.><m..>amommxGrozo _smoEo;:.Ezzmreoorwox.matzrmmmmammr8.:5:x2.26mx8.Emma .s®:oG:.?<omczmmxaoormoxmm.mbazrmmm?mmr.3.maxx5,(SUNx5.cmmmaimmornoo,<zuoox E203:-a?yzmmmwn>mm0Frm<mrmamaor>mm\EC...zoczamoozoE<mw_mmammw>zmw>FQ?o>c8@a$ mmzoa:-32moowmENOZA. mmmmmmmMmmmmmmmwm?mm?mmmmEmammwmmmm_%m@Mmmmmw....I!..u.......u....... a%mH._,.g,.M_.,“.m.wm_m_mH.a_mHmmm§§a%%m3%%%m§_%,%§_wm.an_....M .l.n|~._?m=..|.|.|.. Ummnlcnondb:5.ea»_macs:33092..I059,8waso_=E.%::Z:_Wzoam”WEzoam.mans8%6Va:025eamageawo&_ma:5Xm:zzaoo o _Hem:$2:O92.ma?a,:.>3"I m.:U3»m_W"#9 wonEaS?dmmonon:5u2.nm=:~m¢mm" ASEM33092.mrm?m.:.>5.AGENDA ITEM #6. e) OOZHm~>O.HHAQOHZQSowwmmwmeOosnwwan . Um? mowOmzzomanwloamag.Hv?m3.355%2:.”. mOoHLmw:..E:a£52m Him€2._a_:§mmunauwaaacmOoznawnnonmamn22.8madman.Ruwemm§_§_.co? mooanaimREMHcaExam8E-Q>O©:u.m.8Lm&.._._§&o:EnmmaQuaonc1=:am=._u: "034O1wmzaozoo=.2.n.o:mQ~6<wx.:8. ww?a.was:52.23 0m3_om\w1nmmi: Zwimu _v...._wuaéman3.,m>mm_=%&m=wa.m.2m$wm5§__mEm?m. dmmnlcmoz .zmH>FKCUmraumHZMHWOZHomxm>wdwmm .230:Z.U501>x_.m.Choc_.w.mm...”wammw-KOUMF303:».Z_O_u— _.7—O_m_~.28.5.384-0. ~m§O_mZ.m.::z_.mmmmammrUC?=u>385_.>z02am;mczmmw E203. _.E..o_~>cm<>OCCZ—HCEZO4.0_u_..>.—...._.>zom Vain:Z._u=._..momm8.XNin. W?_mm§D_m__._.m>cmwzowm8.X_. ?<EmZO_u:.—.Ew>.Z~._>mmémwzomm.nusweXwas3.:.>m:n.ow>zom.2.2“_._omSBm~. mezwzoa:.z_>2:orm_.=..:zmE003 M35283:.$<UW>Z.H.«<WmZOI m~<:m§O_mZ.>UUE.HOZ>_..ommw>.:ozm>ZU:>Hzamz>zom§>ZC>?Vm>om WZMQKOGZ.,EQmW.H.>:..G.O._.>_..omj_<OV wmmmwwm?ww?mmmmwwwwwwwmmmWmMMEmm“.AMamawmamm?mmmmm?mm?q11.4.1.11. 2%ni?za?amEya,”EE3%.mm_g.=%g?z?.H._mow.H§.cw.%E Ummoluaos »..,§_H%._w§%_@§_E§_wm%,§§wagzmgmaE.3m%__w.§.=wmE%%mm m:c88_O" pWmyHanH”H%%_w%m..w%AGENDA ITEM #6. e) Umna wnowmnmm OO2H.%>OH.w-~OHZQEoimmmmma wowOmS_om.6win»mag.diva33.3% Ooznumon38-; 2o.".=m>...u$.£52m Him<<S.wm_.8_HacnaumnamcwOosnnm?oaE5n75:853dmmw.:.wwemmimam?cc? 3652.;REMHcmExam8E-Q>O@§u-8.f_m&.HrauamonaEammaQuaS.3::_am=._v.. Q3omwmzaoz ME.,§_~w..mmiNN,§a,§_Ww@H” mzmoczna:..E<Oo>zmw>-m>Qn.cwn>Zmw>mkmamz«Sam4..OOWOW§OZE.OW.Hzorcommmwoza>20wm>w-a<.uom>>ZUVOLH m=Eo»m_NV"Nmmo wu.H_H.H_H._w_..w_w._uo.3..H._aH>H$mmoH_m..H,.E.%gagEma.“3%.§._§._a..,,..E..m..z??wan33%.ME%n&.E.E_._&%3....._.EE%%w§w.aK%E?gm Ummnluzoa .3&3“.m.%“AGENDA ITEM #6. e) wonOmS_om@win»m__$._Hana5.5.38Zo.”53.33jOOZ.H->O.Hm.W~OH2Q<<O-~mmEmHHOonnnmnnmOoH.Hm Umao £52m 12%€o:a_.§mmc_.¢cw_.am3.Oo=:.un8_.manM32.8Eadmmw.:.wwemmmmmzaa..82. monaiaanmEBHan$3..8l.®>O®du-€mLm&.HranmmoaaE33QuaE.3::_am=._u: 9.5.5M93ommmzaozOc==.wn83mQm_w<mxL=o. >m¢=ow;m _.3E.:& mwE-&m-33 mE-&c.wSq Om.w_ow:.1nmwas 25:2 Gm=m_.w_Ummnlwzoz an5&5:w..vm._m,Em_m_H,qH...Wm.H.(_HmH,m_H\.%wegmWH.3»,&,a_aa%_w®".H.3? Ummnlumoz Mw.;.H.H__.,H._...w,_m,.m_mo_%..@»..”.§,A_,§.uH..“m..a%Ea._...m.%%_._.$2%E._m...§_._$3..:.z¢.amm.m_._.<HH 3%”E3§_m:.a§am,_<.:_§.r.Ewwéw%&E_&KEN3%.B_u_o=§9_S..¢.ExH.UW...Ummnlwmou Hex:3.cBO32.mrga.:>5a m:c8§_mu .anH1_;oB_oom?o=E:am&GwcosmA58559mxoommM3.ow2.583:ow... ....wow:5=.m=mmn=o:EmUmwomanmmm5" vi-IuIn..n -I..u-...co.ht AGENDA ITEM #6. e) taOO2H.W>OH.2:920SowwmmmmaOonnnmonmOo_-Hm GuamLzotm .wonOm?zcmwV18mag,Hv?mwcnormmmmZo.”383$ Him<<o_.wm_5£mmuwacmnam3Oo:_Hmn8—.NSQM78:8manEma?:mwea5.8.cc? aonaamimRFHMHcamia83.9570®:~.e3-n_.u.&.HrownmouaEmmmaG6»8.61:»_a.._u.=._u: MD?omwmzaoz9a::s_.umo%<§.:5 Om?_om:.1nm2.2, w¢.H.m_.g§m§.§wm_.§..%_.um_..@.M%..w_....,w.H.3?x.._§.m_Hm.w.w._H.&.nH. e%&_m_.§a._w§g__m%1%.:%E_Am.nwgwma.E%£3g=§n,E¢..a..xH ... Ummnlumon aw.H_H.mH.m?um%m.E%..m AGENDA ITEM #6. e) =6OO2.H->OH_3:920Soimmmmme02.35mnowhmEmma 3:Omazom.wmica9.8..560waanrmmmmZo."wwncwwmm Himgcnwmramammuuocmwamcm02:35.2.E5«:2.8EaCm»?Hwwemmimam?.52. aoaaiasnmEEHcmExam83-990©dwémsma.HranomoaoEmma»QuaS.w1::amE_v: wzisn >wm=nw;W93ommmzaoz9_..a§:mo%<§.Fe. mE-$m,S$ mE,&o.w¢3 :§Q©mmw<mx.ooB Owniow\ulnami: 23:9 Om=m_.w_Uamnluzoz on_.8a=.,.: M.$_@§.£o3%wmagi_wE.%2.3%..Ea?E3.”E3?E_.&.§._mg..2.7§aE _.H.H._. 3%“cm_.g.%_.x_w.%mm%E3,”E3.3%E_.%,§.a.=W§%.E...xWMHNHH _ .Ummnluzos dmmnw"HOE.com"omCEE.arm.owzoamQwvamaze”axon»..ooH0SSo .GS.«Em:.m=mmn:o=:5umwnasammmmm" ..uh.....-..u.|..O|.|o|.|»-AGENDA ITEM #6. e) 1“OO2H_w>OH.wmw~O~2QSowmmmmma0.53.2mOoH-Hw UmnaA:QHmwowOwS_om%:28mag,Hw?awswnrmmmmZo."wwmwmnma Him<<o..wm_.$nmmuamuanam5Oo=:.wn8_.BaM75:8EaCm»?:.mwemm:23.co»: 32.52.:HECMHcaExam8?-®>O®dm.8uLw_m.HrmnamonaEomma$6»3.3.:_am=._u.. w.i__mW93omwmzaozne_.a§:m§.§.§. >mm=n.?uu w_.€3&Tw2Qmax: Ow.m_om:.1nm2.2. 23:2 Om=m_.m_Umwoluzo: on33:2" w..a.§_%.£ma?a.$3.%oE_.._,.$,%:.£_m..Ea?”.33m?_.&_.£..=.%...w_mix:.z§m.m.~ . _E&§,§m“WE. WKM.in......é%&§%AGENDA ITEM #6. e) Emma wnmumnam 02:32 Zo." OO2.E~>OHEz?zoSowxmmmmaT5wonSOHO”<E_:oEm0:5. m?e Him<<o_.wm_E£mmuuacwwam5Oo=:.wn8~Ean75:8E5damn.H.wwemmimam?.83 aonaiaimHKEMHcaExam8E-®>O®.:ue8Lm&.HranomoaaEwmma$6»2.u1=:£=._«. méymM93omwmzaozne_.§a:Wo%<§.:5 waznwa. “E3was .wE-&m.38 “E95 UmmnluzoamEwamww=.aemaXA.umeE1.3.8.._..w.D<4.<-.>50:0?ZOUNF:05: §..a%m__.wi%a.._;mi?E.E§%m-m%mea?a...3.H.I..9...masHP. am.H_....._mw._.m&..9?.§.§%mma;a?aai?amg%_%§.mEHmggam?i??.. %m.._nEn.¢.:Hm%.m.n._E._..w....22,...w_%_g.o.33Maw..%..,.%.§..H..a.”E...=w§H Uamnlunoa w>oo>wE3mzo?zm .rcmozmmwmmu>CA.O?r>.EO 908rmENOZH>xrm _..o8rmwm>w>xrm z<roo_vumm .:.Emaweanmcmvmaaoz 05Z82<9:Ormmmmm3.0:.O=u<=xman.” na§___§__Eegg.“E??am%_.?wESE»E..m.eE3%w. 3%m=%z_m§nma%mM2,?25%E.._Em..%..§2%Evan?E5 m_._o3s_O." Cumineon:now"omc€=zE_&OumosmADVamaze»oxonna~§om:58::cm:5wmwoGa: vinoEcmwczzxaOunosmA>+mV. m...§.E%E%Emw.H_.§§..a.m_._m._..w_a%.“a%.Haw%_%__m_§_M%.m~.m.mwma...593:; 05:3o&§9n??xm=_§S_3.>+w+QI_Mmm&I._I o_,§é,.§%wn_§naWHUH _ Uamnlumos m:c8S_mu H.W_%,._WEw&%m_..m_@ ..maven:my AGENDA ITEM #6. e) AB - 2144 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Supplemental Agreement No. 1 to CAG-17-149 with KPG, Inc. for the Final Design Phase of the Williams Avenue South and Wells Avenue South Conversion Project RECOMMENDED ACTION: Refer to Transportation (Aviation) Committee DEPARTMENT: Transportation Systems Division STAFF CONTACT: Bob Hanson, Transportation Design Manager EXT.: 7223 FISCAL IMPACT SUMMARY: The Wells Avenue South and Williams Avenue South Conversion Project ha s a 2018 budget of $2,856,236 (317.122908.016.595.11.63.000). Supplemental Agreement No. 1 with KPG, Inc. is $728,636 and is within budget. SUMMARY OF ACTION: The project will design and construct new traffic signal systems and raised concrete intersections at four intersections: • Wells Avenue South and South 2nd Street. • Wells Avenue South and South 3rd Street. • Williams Avenue South and South 2nd Street. • Williams Avenue South and South 3rd Street. The project will also design and construct revisions to the traffic signal at the intersection of Williams Avenue South and South Grady Way. The project will provide new channelization and revised railroad signals on Wells Avenue South and Williams Avenue South. The project also includes upgraded ADA and bicycle facilities and improved signage in the corridor. The supplemental agreement includes survey and basemapping, stormwater analysis, traffic signal foundation design, right-of-way and environmental support, public involvement, utility coordination, final design, and bid document preparation. Construction support services and construction management may be added as future amendments at the City’s discretion. EXHIBITS: A. SUPPLEMENTAL AGREEMENT NO. 1 TO CAG-17-149 STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to execute Supplemental Agreement No. 1 to CAG -17-149 with KPG, Inc. in the amount of $728,636 for the final design of the Williams Avenue South and Wells Avenue South Conversion Project. AGENDA ITEM #6. f) Q '7"W h“St tV,ofaTI?ansportation Supplemental Agreement Number 1 OriginalAgreementNumber OrganizationandAddress KPG,PS,3131 Elliott Avenue Suite 400 Seattle WA 98 l 2] CompletionDate I 2/3 1/20 C/“'17-'49 Phone:253-627-0720 ProjectNumber ExecutionDate 10/24/20 l 7 ProjectTitle NewMaximumAmountPayable Williams Ave S and Wells Ave S (Conversion) Descriptionof Work Develop Bid Ready Plans,Speci?cations,and Estimates for the Williams Ave S and Wells Ave S (Conversion)Project The Local Agency of desires to supplement the agreement entered in to with KP PS. and executed on _L_and identified as Agreement No._Z_j_ All provisions in the basic agreement remain in effect except as expressly modi?ed by this supplement. The changes to the agreement are described as follows: I Section 1,SCOPE OF WORK,is hereby changed to read: The General Scope of Work of the Original Agreement is supplemented to include the attached Exhibit A. II Section IV,TIME FOR BEGINNINGAND COMPLETION,is amended to change the number of calendar days for completion of the work to read:Remains U han ed -I2/3 1/2 Section V,PAYMENT,shall be amended as follows: See attached Exhibits A,D,and E. as set forth in the attached ExhibitA,and by this reference made a part of this supplement. If you concur with this supplement and agree to the changes as stated above,please sign in the Appropriatespacesbelowandreturntothisofficefor?nal action. By:Jason Fritzler KP By: ConsultantSignature ApprovingAuthoritySignature DateDOTForm140-063 Revised 09/2005 AGENDA ITEM #6. f) A. EXHIBITA CITYOF RENTON WILLIAMSAVENUE S AND WELLSAVENUE 5 CONVERSIONPROJECT FINALDESIGN CAG 17-149 SCOPE OF WORK APRIL26,2018 PROJECTBACKGROUND/DESCRIPTION The City of Renton (”City”)was recently successful in obtaining an STP Federal Grant for the Williams Avenue S and Wells Avenue 5 Conversion Project ("Project”)that will provide roadway,channelization,utility,and intersection improvements between S Grady Way and N 1st Street to support the two-way conversion of Wells Avenue S and Williams Avenue 5.Primary components of this project will improve mobility and safety for all modes of travel and update urban design and streetscape amenities within the Downtown Core.This will encourage new economic development opportunities and transform Downtown Renton into a destination.The Project will construct the following improvements: New concrete raised intersections at Wells Ave S/S2nd St,Wells Ave S/S3rd St, Williams Ave S/S2nd St,and Williams Ave S/S3rd St New channelization on Wells Ave S and Williams Ave S from S Grady Way and N 1st St to accommodate the two-way conversion New roadway illumination at the intersections of Wells Ave S/S2nd St,Wells Ave S/S3rd St,Williams Ave S/S2nd St,and Williams Ave S/S3rd St New Bicycle Boulevard on Wells Avenue 5 between Houser Way S and the Cedar River Trail New traffic signal systems at the intersections of Wells Ave S/S2nd St,Wells Ave S/S3rd St,Williams Ave S/S 2nd St,and Williams Ave S/S3rd St,and revised traffic signal at the Williams Ave S/SGrady Way intersection Asphalt overlay on S 2"“and S 3"‘Streets from Wells Ave S to Williams Ave S and on Wells Ave S and Williams Ave S from S 2"“St to S 3"‘ Support railroad crossing revisions on Wells Ave S and Williams Ave S at Houser Way S New wayfinding and signage City of Renton Wells/WilliamsConversion Project (CAG17~149) FinalDesign Project Number:16125 KPG 1 Apri|,2018 AGENDA ITEM #6. f) 0 Removal of accessibility impediments at the intersections of Wells Ave S/S2nd St,Wells Ave S/S3rd St,Williams Ave S/S2nd St,and Williams Ave S/S3rd St 0 Water,Sewer,and Storm improvements at the following locations: 0 Storm —On S 3"‘St from 150’east of Wells Ave S to Burnett Ave 5,new 12"storm drain with laterals and mid-block catch basins. Storm -New roadway drainage at each of the raised intersections Water —On 3”‘St,new 12”extensions and hydrants at each of the raised intersections except where existing 12"main extends past raised intersection. Water -On 5 2nd St,new 12"main from Wells Ave S to Burnett Ave S. New 12"extensions and hydrants at each of the raised intersections except where existing 12"main extends past raised intersection. Sewer -—On 5 2"“St,new 8"main extension to the north on Wells Ave S and new 12"main from Williams Ave S to Burnett Ave S. In March 2018,the preliminary design roll plot was delivered to the City and now the City has a desire to enter into a supplemental design agreement with the Consultant to complete the Final Design effort for the Project.The following services will be rendered that will result in delivering Bid Documents to the City: 0 Updated Topographic Survey and Basemapping Environmental Permitting Support Right of Way Acquisition Support Final Geotechnical Reporting Construction Phasing/Traffic Control Public Involvement Stormwater Documentation Coordination with Utilities and Stakeholders 0 Preparing Plans,Specifications,and Estimates B.ASSUMPTIONS The following assumptions were identi?ed to provide direction with design: u The project is funded through the Surface Transportation Program (STP)and other City funding sources. CI There is no design DBEGoal established for this project. D The Project will require NEPA Documentation (assumed Categorical Exclusion)and all permitting efforts and approvals will be led by the City.The Consultant shall support the permitting process with graphics where necessary. D The Project will require ROW Acquisition Services.The acquisition and certification of all ROW will be the led by the City.The Consultant shall support the ROW Acquisition process with graphics and plans where necessary. City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 2 April,2018 AGENDA ITEM #6. f) U Design of kiosks,wayfinding signs,and parklets are not included in this scope of work. D The City's Streetscape Design Guidelines and design elements from the Main Avenue Project will be utilized as a basis for urban design treatments. WSDOT Channelization Plan Approval will not be required. BNSF coordination for the revised railroad signals on Wells Ave S and Williams Ave S at Houser Way 5 will be conducted by the City.it is assumed that BNSF will design and construct the signals prior to the City's Project advertising for contractors. DU C.KPG DELIVERABLES Deliverables prepared by the Consultant are identified at the end of each Work Element (WE). D.CITYor RENTDNPROVIDEDITEMS: The City of Renton will be responsible for the following: Submittal reviews,comments,and approvals (1 to 2 sets of comments per submittal) Public notices,property owner mailings,postage,and host a project website Meeting room arrangements Open House room arrangements Right-of-entries for surveying,geotechnical review,and/or construction,if required Wayfinding,Kiosk,and Parklet Designs Environmental Permits ROW Certification Coordination of BNSF Design and Construction of revised railroad signals DDCBDUDDU E.SCOPEor WORK WORKELEMENT10-MANAGEMENT/COORDINATION/ADMINISTRATION The Estimated project duration is 10 months. 10.1 The Consultant will provide continuous project management for the project duration of the project through Preliminary Design (estimate 10 months).The Consultant will prepare monthly progress reports identifying work completed in the previous month,work in progress,upcoming work elements,and reporting of any delays,problems,or additional information needs.These reports will be submitted with the Consultant invoices. 10.2 Prepare for and attend bi-weekly design coordination meetings with City Staff and other project stakeholders.These meetings are to be held at Renton City Hall (estimate 12 meetings total). City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 3 April,2018 AGENDA ITEM #6. f) 10.3 The Consultant will update the project schedule. 10.4 The Consultant will conduct regular project team meetings (estimate 30 meetings total)with internal staff and subconsultants. 10.5 The Consultant will provide internal quality assurance/quality control (QA/QC) reviews of all major deliverables prior to submittal to the City. Work Element 10 Deliverables: I Monthly progress reports (10 months) I Project Schedule and Updates 'Meeting notes I QA/QCChecklist (Signed and initialed) WORKELEMENT11 —ADDITIONALSURVEYAND BASEMAPPING This Work Element includes additional survey,basemapping,and potholing not outlined in WE 2 of the Preliminary Design.As the City and Franchise utility designs become more defined,additional survey and potholing of areas not in the previously defined project limits may be required. 11.1 Re-establish horizontal and vertical control points along the corridor for field topographic survey.Basis of control will be City of Renton Datum.(Horizontal NAVD 83/91,Vertical NAVD 88).Control points will be established and will be made available for use during design/construction.The consultant will locate,field survey,and calculate positions for monuments and control points throughout the project limits,using the Washington State plane coordinate system.Conventional or GPS surveying methods will be used on this project. 11.2 Field survey will be conducted on any areas not defined in the Preliminary design WE 2.It is assumed for the purposes ofthis scope that two (2)additional days of field will be required for additional ground survey. 0 Field survey of planimetric features and utilities.Topographic mapping of the existing ground will be taken at approximately at 25-ft intervals (to 2-ft.contour intervals). 0 Included in this WE are locate overhead lines,signal loops,locate paint marks in WE 11.3 at 50-ft intervals,locate surface features (valves,manholes,catch basins, junction boxes,vaults,etc.).Irrigation systems will not be included.Perform observation and measure—downs of existing storm drain catch basins and manholes and sewer manholes within the two intersections.The approximate size,type (brick,concrete),and general condition of the structures to confirm City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 4 Apri|,2018 AGENDA ITEM #6. f) suitability for continued use,and approximate size and location of pipes will be documented.These observations will be made from the surface. 11.3 The Consultant shall coordinate utility locates,identification,survey,and other work,as necessary,to locate franchise underground and overhead utilities in order to identify any potential conflicts with the proposed improvements. Consultant shall subcontract with a utility locating company to paint all utility locations within the complete survey sections so that they can be surveyed in WE 11.2. 11.4 CADD mapping work to prepare 1”=20’topographic base map and digital terrain model (DTM)in AutoCAD format of the project within the limits.It is assumed for the purposes of this scope two (2)additional days of CADD mapping. 11.5 Potholing to identify potential utility conflicts will be completed as necessary for design (80 additional estimated).The locations of the potholes will be surveyed and added to the base map. Work Element 11 Deliverables: -Electronic copies of the updated base map will be delivered to the City. D Additional Basemapping Delivered to 10 Months afterNTP. WORKELEMENT12 —FINALSTORMWATERANALYSIS This Work Element includes the effort required to complete the project's stormwater documentation in accordance with the 2016 City of Renton SurfaceWater Design Manual. 12.1 Prepare a Draft Surface Water Technical Information Report (TIR)for the project. The Draft TIR will address comments from the City of Renton on the Draft Stormwater Technical Memorandum submitted as part of the preliminary design phase.The draft TIR will be submitted with the 60%plans. 12.2 Prepare a Final TIRthat addresses City review comments and documents the final design.The final TIRwill be submitted with the 100%plans. Work Element 12 Deliverables: 9 DraftSurfaceWater TIR,hard copy and Electronic PDF. I Final SurfaceWater TIR,hard copy and Electronic PDF. t:i Stormwater Technical Memorandum Delivered to City with the 60%and 100% P5&E submittals. Work Element 12 Assumptions: City of Renton Wells/WilliamsConversion Project (CA6 17-149) Final Design KPG Project Number:16125 5 April,2018 AGENDA ITEM #6. f) 'The project willnot be subject to flowcontrol or water quality treatment requirements. As a result,the TIRwill have a concise formatsimilar to the previous/y-submitted Draft Stormwater Technical Memorandum. WORKELEMENT13 -TRAFFICSIGNALFOUNDATIONDESIGN The following items are to be performed by the sub-consultant,Amec Foster Wheeler Environment &Infrastructure,inc.(Amec Foster Wheeler),under this task.Amec Foster Wheeler will provide geotechnical and structural engineering services for design of traffic signal pole foundations.These services will include conducting engineering analyses and drafting plan notes and design details for the recommended traffic signal pole foundation types. 13.1 Administration,Coordination and Supervision 0 Supervision of Amec Foster Wheeler personnel and activities to ensure compliance with contract scope and schedule. 13.2 Project Meetings 0 Design coordination meeting with City and Consultant staff.It is estimated that Amec Foster Wheeler will attend one meeting at Renton City Hall. 0 Internal design coordination meetings—Amec Foster Wheeler will conduct regular internal design coordination meetings with key design team members. 13.3 Geotechnical Engineering Analysis: 0 Reviewsubsurface information data obtained from the borings conducted during the field assessment. 0 Develop soil parameters to be used for the structural design of pole foundations. 0 Assist structural engineer with application of soil parameters and with selecting constructible options for the pole foundation design. 13.4 Structural Engineering Analysis: 0 Review draft geotechnical report and additional information relevant to traffic signal pole foundation design. 0 Provide structural engineering for up to 8 foundation types.These foundation types are based on two soil profile conditions and up to two different traffic signal pole loading criteria (a total of 8 structural evaluations). 0 Compile engineering analyses and prepare recommendations for up to four different signal pole foundation types. 0 Prepare general notes and draft modified traffic signal pole foundation details based on WSDOT and AASHTOcriteria,to be done CAD. 13.5 Revised Geotechnical Engineering Report.The report will include: City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 6 April,2018 AGENDA ITEM #6. f) In addition to subsurface information and pavement design recommendations, revised geotechnical engineering report will include the following: 0 Description ofthe subsurface conditions and a summary table of soil parameters used for pole foundation design including lateral soil bearing pressure and torsional soil friction; A draft of the revised report will be provided to the Consultant for review by the Consultant and City.Once review comments are received,a final report will be submitted to the Consultant to deliver to the City. Work Element 13 Deliverables: I Trafficsignal pole foundationdesign calculations; I General plans and construction details relevant to trafficsignal pole foundations, stamped and signed by a Washington State professional engineer and provided as CAD files; I Draftof Revised the Geotechnical Engineering Report;and I Final Geotechnical Engineering Report that incorporates review comments,stamped and signed by a Washington State professional engineer. [3 Foundation design delivered to the Consultant 3 months afterNTP [3 Amended Geotechical Report Delivered to the City 10 months afterNTP. Work Element 13 Assumptions: I The budget shown in Exhibit G assumes this task is less than three (3)months in duration. I Design plans showing location of tra?ic signals will be provided to Amec Foster Wheeler. I Demand structural loading will be provided to Amec Foster Wheeler. I Engineering for pole foundationswill be based on WSDOT and AASHTO design methods. I A non-standard design of trafficsignal pole foundationwill be conducted based on ”Very Soft”soil profile. I Wherepossible,Amec Foster Wheeler will modify and expand WSDOTstandard details to accommodate signal pole foundationdesign based very softsoils. WORKELEMENT14 -RIGHTor WAYACQUISITIONSUPPORTSERVICES This WE covers the necessary effort to provide the City's selected ROW Acquisition Consultant with ROW Acquisition Support Services. 14.1 The Consultant will prepare up to 8 property owner exhibits and legals to be utilized during meetings/negotiations with the property owners.The purpose of these exhibits is to give each property owner a clear understanding of the ROW City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPGProjectNumber:16125 7 'Apri|,2018 AGENDA ITEM #6. f) impacts along their frontage.The exhibits will contain the following information: Existing parcel features,ROW lines,and Parcel Lines Proposed Frontage Improvements and dimensions where necessary Proposed temporary easement lines Parcel name and number Scale,north arrow,and legend (in color) Legal and Exhibits D D D D E D Work Element 14 Deliverables: -Up to 8 parcel exhibits in PDF and 11”x1 7"format. CI Parcel Exhibitsdelivered to the City when requested. Cl Legal Exhibits [3 Updated Title Reports Work Element 14 Assumptions: 'Only Temporary Construction Easements are assumed. I Existing and proposed ROW/Easementstaking is not included in this scope ofservices. 'Acquisition of all new ROW/Easementswill be the responsibility of the City's selected ROW consultant. WORKELEMENT15 —ENVIRONMENTALSUPPORTSERVICES This WE covers the necessary effort to provide the City's selected Environmental Consultant with Environmental Support Services. 15.1 The Consultant shall provide documentation support to the City's selected environmental services consultant for the development of the environmental permitting documents.These include,but are not limited to technical reports, aerial maps,quantities,and figures. Work Element 15 Deliverables: I Electronic pdf copies of aerial maps,quantities,and figures CI Supporting permitting documents delivered to the City when requested. Work Element 15 Assumptions: 'Preparation of all necessary environmental permits will be the responsibility of the City's selected permitting consultant. WORKELEMENT16 —PUBLICINVOLVEMENTFINALDESIGN This WE covers the effort required to continue the public involvement process outlined City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 8 April,2018 AGENDA ITEM #6. f) in the Preliminary Design Phase (WE 7).This WE will support one (1)additional Open House and supporting documents to be held at the completion ofthe 100%Design Phase. 16.1 The Consultant shall prepare for and attend one (1)Open House after the 100% Design Phase is complete.It is anticipated that the following items will be updated by the Consultant for the open house:open house flyer,sign in sheet,comment form,roll-plots,photos of existing conditions,before/afterphoto simulations, project schedule exhibit and other informational exhibits conveying general project information (i.e.project goals,project budget,etc.). 16.2 The Consultant will assist in the preparation of website graphics and up to two (2) project fliers to be distributed to the public. Work Element 16 Deliverables: I DraftOpen House Materials,Electronic PDF I Final Open House Materials,Hard Copies and Electronic PDF I Website Graphics and Project Fliers (2),Electronic PDF and JPEG'5 Cl Open House materials delivered to the City after the 100%Design Phase. Work Element 16 Assumptions: I General project informationsuch as project goals,budgets,etc.shall be provided by the City to the Consultant to be incorporated in the Open Houses. I City will host and update the project website. WORKELEMENT17 -UTILITYCOORDINATIONFINALDESIGN The Consultant will continue to coordinate with private utilities affected by the proposed improvements.Efforts included under this WE are as follows: 17.1 Prepare letters with updated design plans to send to purveyors at each submittal phase. 17.2 Update Utility Conflict Plan:This plan will be submitted to all purveyors with utilities in the project limits to assess whether said utilities may be in conflict with the proposed improvements. 17.3 Prepare for and attend Final Design meetings (2 assumed)with franchise utilities to discuss utility conflicts and relocations. Work Element 1 7 Deliverables: I Letters to Purveyors I Utility ConflictFigure (11x1 7) I Franchise Utility Meeting Notes City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 9 April,2018 AGENDA ITEM #6. f) I Updated basemap showing utility potholes and actual utility locations Cl Utility Coordination EffortsUnder this WEwill be complete 10 Months After NTP Work Element 1 7 Assumptions: I Survey required for utility relocations is not included. -Any franchiseutility expansion which is required to be incorporated into the project is not included. WORKELEMENT18 —FINALDESIGN(60%,100%) The Consultant shall prepare 60%and 100%Plans,Specifications and Estimates for review and approval by the City.Plans shall be formatted to provide sufficient detail for convenient field layout of all proposed facilities.City Standard Details and WSDOT standard plans will be supplemented with project specific details as required.All design plans and documents will be signed by a licensed professional engineer in the State of Washington. 18.1 The consultant shall prepare 60%plans for review and approval by the City.The 60%submittal will include all comments received from the Preliminary Design project meetings. 18.2 The consultant shall prepare 100%plans for review and approval by the City.The 100%submittal will include all comments received from the 60%review. 18.3 Consultant will calculate quantities and prepare construction cost estimates in support of the 60%and 100%submittals. 18.4 Consultant will prepare specifications based on 2018 WSDOT Standard Specifications,using contract boilerplate,federal funding requirements,and general special provisions provided by the City for the 60%and 100%submittals. 18.5 Consultant will prepare a preliminary construction sequencing and traffic routing exhibit.The exhibit will be in a roll plot format with aerial backdrop showing % and ‘/2intersection closures with associated traffic routing. Work Element 18 Deliverables: I One (1)%-size unbound,five (5)%-size bound of the 50%Design Plans 'One (1)%-size unbound,five (5)15-size bound of the 100%Design Plans I One (1)hard copy,and two (2)electronic versions (PDF and Excel)of the 60%and 100% Engineer's Estimate I Five (5)hard copies,and electronic versions (PDF)of the 60%and 100%Specifications :1 60%P$&E will be complete 5 Months afterNTP City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 10 April,2018 AGENDA ITEM #6. f) D 100%P$&E will be complete 9 Months AfterNTP 'Rollplot of the construction sequencing and trafficrouting WORKELEMENT19 -WSDOT REVIEWAND BIDDOCUMENTS The Consultant shall provide WSDOT Review Plans,Specifications and Estimates for review and approval by WSDOT.Bid Document Plans,Specifications and Estimates will be developed after addressing WSDOT review comments.WSDOT Review documents and Bid Documents will be stamped,signed and dated by a licensed professional engineer in the State of Washington. 19.1 The Consultant shall prepare a set of WSDOT concurrence submittal documents (Plans,Specifications and Cost Estimate)for WSDOT Northwest Region for review. The WSDOT review submittal will include all comments received from the City's 100%Design review and include the WSDOT Checklist. 19.2 Prepare and submit a Public interest Finding (PIF)for all agency supplied and sole sourced materials and Maximum Extent Feasible (MEF)documentation in accordance with WSDOT requirements. 19.3 The Consultant shall prepare Bid Documents (Plans,Specifications and Cost Estimate)for advertisement by the City.The Bid Documents will include all comments received from the WSDOT review submittal. The estimated sheet count is the following: 1 Cover Sheet 2 Sheet Index,Alignment Plan,and Survey Control 1 Legend and Abbreviations 2 Typical Sections 3 Roadway Details 1 Driveway Details 12 Site Preparation Plans and TESC Plans 12 Roadway and Drainage Plans Drainage Profiles Concrete Panel Plan Flowline and Sidewalk Layout Plan Water Plans and Profiles Water Details Sewer Plans and Profiles Sewer Details Signalization Plans Signalization Notes DDUDCUDCDDDEEDDDD-l>-lhl-IUJUJCDOO-bO'\ City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 11 April,2018 AGENDA ITEM #6. f) Signal Pole Specifications Wiring Diagram Illumination Plans Illumination Details One Line Notes ITS Details Urban Design Plans Urban Design Details Landscape Plans Landscape Details Irrigation Plans Irrigation Details 12 Channelization and Signing Plans 2 Right of Way Plans Total:119 Sheets UDDDDDCDCUDDDCI—|-l>-I-I-l>r\.J-l>l\Jl—Il-— \-l>-l>-l> 19.4 Consultant will assist the City during the bidding process in answering questions by the Contractors,or in providing information for an addendum,as requested by the City.Assistance Work Element 19 Deliverables: I Two (2)hard copy 7 -size bound of the Plans,Specifications,&Estimate,delivered to WSDOT I Public Interest Finding for sole source and agency supplied materials I MEF Documentation I One (1)%—sizeunbound,five (5)%-size bound of the Bid Plans I One (1)hard copy,and two (2)electronic versions (PDF and Excel)of the Bid Engineer's Estimate I Five (5)hard copies,and electronic versions (PDF)of the Bid Specifications D WSDOTP$&E Submittal will be complete 2 weeks after100%review comments D Bid P$&E Submittal will be complete 1 week after WSDOT review comments I Addenda and Answers to Questions During Bidding Work Element 19 Assumptions: I The City will provide the Consultant with copies of approved PIF documents from a recent similar project and will include CertificatesofMaterials Origin (CMO)for all sole sourced materials. I Only one (1)review by WSDOT will be required. ADDITIONALSERVICES The City may require additional services of the Consultant.The scope of these services will be determined based on the unanticipated project needs or otherconsiderations at City of Renton Wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 12 April,2018 AGENDA ITEM #6. f) the sole discretion of the City.This work may include items identified in the current WE authorizations as well other items,which may include,but are not necessarily limited to the following: 0 Design of Wayfinding Signs,Kiosks,and Parklet’s 0 Design of Art Features o Providing Construction Administration Services These services will be authorized under a future contract supplement if necessary.At the time these services are required,the Consultant shall provide a detailed scope of work and an estimate of costs.The Consultant shall not proceed with the work until the City has authorized the work and issued a notice to proceed. City of Renton wells/WilliamsConversion Project (CAG 17-149) Final Design KPG Project Number:16125 13 Apri|,2o13 AGENDA ITEM #6. f) E33:m?scmmmunS.o¢>.«—»S<«=3aau9ue=39cany._:_.2.Eunm2...~.a...:.sA._..:n:S33.nuanell3.30RC5N:8So.n2:.E3E5.:guise1...:..o=_..._v.o8>E_5.tmi8.39.2u3..3aaRoemae33anaa.50..away3E;n.3-u.m.1nz=Ev:Ivu£a~.0x_.Ia-§No.8.3.2.»Gm’-cuatw.o.V252EKG.O..533_...m....u.Ez..>=_...__..€.2.N3S.»§.m.an9u9u._ua=uD.«a..Bob.1.»823aan.Rc..3..m..8:i..nuonI..§sa.s..m_.2IMUYCUWeonnam_u§uU:-=9.=>_m:mwW;San».—u»8==aa3eaH6au.ae.50»33SS»:n3SS_S€45-w>>Dm—_.:?uiomcoanamEu=_.Eu<;om.2M33.2.:»nu.oee9o0a9aB20uis».7:82:aEE=oamK1vE5n39Gvc¢vnx3.25u..it-.1u.._.8..H..u_5.€aauw:<.2.nonets.x?s?a63.5332.35...55::v&...uw..2~1.nu._2.._a§.oSE04Um?i.3.5_ln..§€§£_2.n.muE:_..2Es2.63.:m3=5uaa._a04au29.._l°>5|»3£3wan5.KFIr:Na.8R:mNn«N_nKC:20_u_:11:<§:..::3n_...E.u..mi_=..u$.3.E.cSuuun93.a3ou6.?a>G:82V.3mE3a—8$5422S3..vnEE.S25mon_...=.aau:to00¢:mVvB250125)3:1:m=_E-635E.1Fz=m_-=o_i..w<.2N2.»?uuau=Euuan2EHaan..15>gnu»w8-u9maE91.3100303.m3.ne.2N.92NV47?.._uo2=is:n:.aE_-2SNnv_maoE?m_u-ES252.3nE82...mcmtn..32a>x.u._...mE03.88....u22_3E2;:..na.Es...5_§2&:.i5;;2:.._Eu<>.o.==_Eo..o=:!Sa=.n:.2miozis:5.3.8.:.Sm:.8.2.2::.8.:»8.5u9::.8,!.3.3..n.5:.Bus.83.8.082.,..§._Es__.u..uu.:.E2.58......_a3.52anLaw.365any.33sass2.:5.?.._..,a...s....:.,5.551_in_..€?53.6:IsuumISIDIM.U:.§u::.sur-ao.:_.u~<965.22..Exam‘£95u:.J5353.a:§=_.¢.a:.:.u.m»u559:63,._.&...t-»__51:5.»au???35::B:.as..5::......:w...:3sea.355.5».55._...:,._...m:2325:52sic«£2;._.5:..5EnssuzuIii5.s.:sEm_:.u..Exuxaduizizla»zzaaumhsxsn?=2.__.3..N532;."mwmzazpumwoxa03.cm_mmD>._mc__u_um__u._m_c_5.5E:5.21.s_:.zaum.3._u>>E.m5Egzs....u_ELEVW53.13._..__umzo_._.<Sm:ouGoo»z<»._:mzoom_2_aED.:m_:xmAGENDA ITEM #6. f) Bowen: m»<§..mmmm. r_m_mwD>._m:__a_um_u._m.c_ huU?.HVH .::.5.E....5...nE.A2...nWu§nmE.5.:t..cs.o..=NE.15gunwuminu.uan.2.:.3er...aEu.save 8asem8~:&SE25...... S23:nS2~3..A-.._m.am......u.8a.._.__.m...‘..:85.:n9.:5~3 3uinnmzx.. N8N3.MmmN.w.:8:2....SomN.3~2n:58§_z.......__ mSN5aan:.a._s!........s:u._ou...§ uE2~2EnEEN82n22~maan.numw n2~N»EnE~2. m2~1.E....._..5E.2....Es... »EN2§5::2:4153E..32.:,3N9H~8Mmoo.N35anm8.N3SR.8~2..2~:EmSN:E... :x..:.5..E.2...:n.. .228_.....mE..5.......,..8_z52..:5..o.263.6u39ulti.-late.2 38.::835.301::..a.N3 in5....33..3:.:2:u3::u95:.S....8.5o3::.3:..S63».232.Su?. .223... ‘ 5.5.......,......u.......§..m.s...._.... §.o....u.»u:_€:<3:33PmBea5:.:an8..E8.Eva??oamid§a..._§8aS?inau5:n<u«.a8_.§<a.....usazwz. ......u<_...£.z2»5.2.5:.8.&.m.Brim.as5. 58.5.50-.3»-«.61one5.m..uv.Iz«ism .5._m §.ow.~...853:.s25:0.m.$3.5.»iuz?-»=..«.u....uop.v«..n:wfirm5-It.8.i..u.h.1:E8!...» .._.....<85_.x:u>:.5m_..Eu#25........§..mF.-.mux3§?:(5.55.2..¢s!._...n....n.....!..o8...-§..w In.2...viE5:.4.»Sueuau=3:.33 E2.3“win 2;._zmmsSz.uu3Eus. u_a.a.K_m.3.Bumu><muu>>uzcWu>(mEl.—_5>.0191 :n_=uK_u26.5__o m2oF<5._:oowmou._.zE.5m=ouasp: D.:m_:xu AGENDA ITEM #6. f) Eem?: W._.<2Fwwmm» cm_mmn_>._m:__u_um__.:o.c_ .mUan.HVH .«E63asaBatnnanE5...amSom=.w3acanE:E39:.2....52..5ua..a..3a3.3NC._._..s..itumA.uaH552vsuem.2uS.Eu.anE2wS&.t!...xn§C.n22:N.42.38mm:asanN:nS2EE. E_um§;.mmama53:3. BanEmE:.su_>uzpoem:.2Es8:2:...... E.2Sn3E:a"3Eo..3.:.52:3:u23u3...:2::E.u=0=~=oum,.S.=..a..ou0.:Swann. E:E8~+.3—JS3IBn!£DuamZ.85%. E2922§8..xS:r.....smu...t£!.a3.35HmM.Eix._.z:E...e ».zAul?um?mitS..:iE.5».. o. Rm.u. glen:a.....:q.2E:1:33!!.:.3~._-.8Eco:35nE.9..~.5:EfvnE5., 2. itsm:m. En2...;:3:5un_ 2. .355.5.5..n_ E. «.35..3..__...;_m9 _ 2-..:.uaouM.§mX _ <~2:§.!2minlamm9. E2. E _ 22n_.um.ya.._ A. u. 8. a_ Ezm. 2Sn. S2m. 232m.2S:4..55XEvi2.5§.E...aama_... .357:25.. 2a£55.oé...x» _ 2. Esuom3...:an.5355as2&3m. _2.,su323E.in_§..§_z.52...36u.uucmEuu» :ln§e.a....o£ususe:8.:.2::n83... 23$ .S4:.S4:»:35u.5:«8.3.Sn!»8,3.»aqua»Su? swan. .=E..i:.§..w..c.....o.ME5:3.55.8:..6_.3.5uéiz.5.-tamnew.35...H....3Aug..3A§.....xo5869.63:90 m 5:.-:3Eugoilnl.az?s .t.u<.i.u....8.53.28»ua_...mat..Seaiaao.ax=6..w935.3.5_Ew8¢ugwutm«Eat!.m513ie:02E33.5:13M ..:....?a».I..Eu.» __ 535.2......m._m=.?.mE5:5:anim,.3:.5.F:-saum...Ev<320__x!utram.256E:mu.._z«s..m{tamo-?§_?.<.5155%.:_E...-:..mE?aulau..musnucn?1&5: 3.1.51.211523». 2-E=uu:5::51. 2%.:K¢"E3 m«—m.EmmszzBw_.oz...unx ra?vn_-Em.CKEA=n,...oz8umu>(m__.u>>YEmu>(nE-ES:Eek Eima:62.3.0 mzo:<:E:ouE8Eaiamzouwest 0_._m_:xm AGENDA ITEM #6. f) 8§.Ewtuuam:3-...=nm.53. 865.. Sauna uScxuu.1-n=.n....~¢38 «xii?S5..eo§x.::...x_.§..:.§..s nuco.Eu_-m.eo:V25-_?E!.E.-x 8\u0.nIevn..m:H=.:§un..n.3n._ 3533r?c?uxh 8Sn3.:..x$.§m.3.2 883..8Ra3:.:.s& SS3.8o»&...S?moe:§=ka DB8o.N!!2uWO—5a43§ 8:5_.§.ooe.m In-Sexin.8.m.«wage...8.3:«Cd:8..8!.«an,2}:n8a.¢cosy!8&3» suit. _l1i8»E.asnua...asuK».:....z..a..mvnaI._..a,. s.uasho£0.23.s.a!.a&sagain?ux9:....a.8539ea! 5_u3¥ro‘gr551»: uu!I¢nuts:.8-..mi..u.¥$§.b:...§.&ni?dué.I....€a.—...a_£Up.....uI..l»bx?n.IQEFN!..._.E.psi.ulwkuistu...£-leo__£.ouim35-_Enwauvt?FinEtltz5.3912..§n.I¢.£53550L:u£Il5.w lu.oaJ!l-38:338aE=umh.£:m.n!. :m_mwD>._mc__a_ow_n.mE_mvnnvm AGENDA ITEM #6. f) wticmwmummc?mi 3.2.aananaSm:u8.3.066.1.:»SR:u2.3.»352u3&1.aSan.wSaar»8.}.uS.S«»S?un3-zvqisouz mumom~uNWRn(mc—?.:I.-‘III 0am33.»~u~N.N»-e-L?lxiii '..uEftn?wuEico?n?$2.E:C;..=.:a¢zu:3.:.IE£=: mXm?....__E9.8.3m3anm2.3mu! » _mlain;.,.n..!:uS:aNam:3 In2.8..8.2aSH»sawu8!.o9Russ...eq?un uai-«sec...u.sv.», .511!.185»....uan.5: §§.I.8.593.8Sv??i5:8331:?»..3_. .?3l<553Has...» ‘.8:—. .16..‘ 5...»83.52828:as 5:5:B 25.1‘..!._.6.»i¥.9.»._.l.__...,«.:...8..?w:zabm..!e-1.9.. uiurslauu3355.1388__..:u.!.3_..eutz$Elswa5.3Slzu.<Sin1....5......»ElisaIi?aP.I:..Bu.32.: .c.8..:..:._§:3£s...§?§a:.§...._ Emma.c2__%%.2c_azeé.§ss2£2mH,w.w EM:g nwwuxmo» n_.:m_xxm AGENDA ITEM #6. f) L WI’ Exhibit D washinmon spate ?anspanauon Building 310 M 1 P .E.Department of Transportation R0,Bf,‘,‘:273%‘’‘‘’°"”‘’5 Olympla,WA 98504-7300 360-705»70D0 Tl'Y:1-800-B33-5386 www.wadol.wa .gov April 19,2018 KPG.P.S. 3131 Elliott Avenue,Suite 400 Seattle,WA 98121 Subject:Acceptance FYE 2017 ICR —Risk Assessment Review Dear Ms.Suzy Rowe: Based on Washington State Department of Transportation‘s (WSDOT)Risk Assessment review of your Indirect Cost Rate (ICR),we have accepted your proposed FYE 2017 ICR of 146.70%.These rates are applicable to Washington Local Agency Contracts only.These rates may be subject to additional review if considered necessary by WSDOT.Your ICR must be updated on an annual basis. Costs billed to agreements/contracts will still be subject to audit of actual costs,based on the terms and conditions of the respective agreement/contract. This was not a cognizant review.Any other entity contracting with your ?rm is responsible for determining the acceptability of the ICR. If you have any questions,feel free to Contact our office at (360)705-7019 or via email consu1tantrates@wsdot.wa.gov. Regards; w.l«- ERIK K.JONSON Manager,Consultant Services Office Jonson,Erik Apr 20 2018 8:02 AM cosign E1(J:l<ms Acceptance [CR Audit Office Review AGENDA ITEM #6. f) Exhibit D Project Name:Wells and WilliamsAve Conversion Project Consultant:KPG,Inc. Consultant fee calculation worksheet Appendix 31.77 Degree of Risk 25 0-32 8.00 E <100,000 =0.35 100,000 -5,000,000 proportionate from 0.34 to 0.21 5,000,000 -10,000,000 -proportionate from 0.21 to 0.17 Period of Performance >24 months =0.35 months 2 -24 months proportionate from 0.17 to 0.35 <2 months =0.17 The degree of risk for this project is : Weight from 0.17 to 0.35,0.35 being riskiest Relative Difficulty of Work The difficulty of work for this project is: Weight from 0.17 to 0.35,0.35 being most difficult Size of Job $600,000.00 Assistance by the Agency The amount of assistance from the agency is: rate from 0.17 to 0.35,0.35 being few items provided Few items provided 0.35 5.25 Sub-Consulting of cost >4o%=o.35 0-40%proportionate from 0.17 to 0.35 0%=0.17 Fraction,rounded to two digits AGENDA ITEM #6. f) April 26,2018 Keith Woolley City of Renton Public Works -5"‘Floor 1055 S Grady Way Renton,WA 98057 Re:KPG Project Team Commitment —Wells Ave S and Williams Ave 5 Conversion Dear Mr.Woolley: KPG is committing for the duration of the project the discipline leads listed below.These professionals will not be replaced without advance notification and subsequent authorization from the City. Employees Sessyle Asato Paul Fuesel Nelson Davis Jason Fritzler Olivia Paraschiv KirkSmith Ray Edralin Michael Lapham Jan Ciganik Janessa Donato Mike Bowen Ron Reichel Phil Adams Justin Williams Karen Weisser Chris Johnson Elizabeth Gibson Phuong Nguyen Coreen Schmidt John Davies Hidemi Tsuru George Hilen Brunye Adams Judy Johnson Danielle Winklemann Terri Simms Michelle Torres Joe Giacobazzi Vonnie Stockman Daniel Clark Sincerely, Jason Fritzler,PM KPG Title QA/QCManager LA Manager Principal Project Manager Engineering Lead Stormwater Lead Stormwater Engineer Traffic Analysis Lead Signal/Illumination/ITS Lead Roadway Lead Survey Lead ROW Lead Survey Field Survey Field Survey Tech Survey Tech Landscape/Irrigation Lead Urban Design Lead LA Traffic Analysis Engineer Signal/Lighting Engineer Lighting Engineer Roadway Engineer Landscape Tech Admin Admin Admin Public Inv Lead CADTech CM Lead AGENDA ITEM #6. f) umudwmmmmwSod«NW:mmméSmm:_c.._xmm.Em_m_Swmm“.om:.<_2_._.mm.25»mwODO._<_.O._.mu:x:wEaxaommwmcmaxmSmzcoonzm_EoE_..mmmmm?axmomsz_s2%w$mummmamammEm.CmNW‘,Cmm.828893.98:m8wmmmmm«mm;mSm;mmGmo.xoneu&mmomm0%;mmwB.wmmmodwmSm:XowenIOwmom9.“NB;mmwt...m33mmomoo>:.._mm50:9omammmiomw?oea9:02.52vNo—mm:o:m.mawaozm282.team:m:_:o%mm.wCGQ?mmzm__m_®DDEM$.02_m_mcmwSwami3.cm?:9_m:EEouone.+:3E9E$:aSccznuczo.Bunm::wmc_m:m_m..:«u:.zw¢.Nmwm..928cmm:c_.mu::o_Eon.m__.om:_m:m_auE_..u9ow0m.Nmwax25>5muE_mm2.mm:=$_2N.“mN<EmEmam:nEUmrzmNN955:.:o_m_>.vu:w,:o=m:__u..ooU.:o_.m.:m_EE_u<_..Nmodwmmm._mm3.3»mmSm.B.cn,:ummD«mmh«mug.W3»oaa_m_wwEsma0%.hea.Lwwmou.J/./9sh.MnUWEQm.Ebom?muEmm?mm53oIE=E.cQ§bcmEcco?mmmEzxm,w.mE_.mmm.5oItermwe_w>w;_AGENDA ITEM #6. f) EXHIBIT E -SUMMARYOF COSTS Signal -Pole Design and Reporting Wells and Williams Avenues amec Renton,Washington foster wheeler Amec Foster Wheeler Environment &Infrastructure,lnc. DIRECT SALARY COST (DSC): Classification §AMEC Class Code)Hours x HOUr|vRate =Cost Task Total Principal Geotechnical Engineer (624 to 625)9 $72.63 $653.67 Associate Engineer (620 to 623)62 $66.85 $4,144.70 Senior Geologist!Engineer (616 to 619)94 $44.40 $4,173.60 Project Geologistl Engineer (614 to 615)0 $39.57 $0.00 Stall Geologistl Engineer (611 to 613)0 $32.10 $0.00 CAD Drafter (517)34 $31.52 $1,071.68 Clericall Word Processor 1808to 809)8 $26.06 $208.48 TOTAL DSC §07 $10,252.13 OVERHEAD COST (OH COST -including salary additives): OH Rate of 1.4557 X DSC 1.4557 X $10,252.13 =$14,924.03 FIXED FEE (FF): FF Rate of 0.30 X (DSC)0.3 X $10,252.13 =$3,075.64 REIMBUFISABLES: Field Expenses (mileage,equipment,etc.)$0.00 Subcontract Expenses (0%mark-up)$0.00 TOTAL REIMBURSABLES =$0.00 TOTAL $23,251.79 AGENDA ITEM #6. f) EXHIBIT E Subconsultant Fee Determination Summary Sheet ACTUALS NOT TO EXCEED TABLE Wells and Williams Avenues.Flenfon,WA Amec Foster Wheeler Environment &Infrastructure,Inc. Current Flales —Overhead Fee BilllnsRafe Base Direct Labor lass Code Class Code Descri tion -Billing nate=Direct PROFESSIONAL LEVELS EIHIIIHHIEIEE Professional Level 1 602 Professional Level 2 603 Professional Level 3 604 Professional Level 4 605 Professional Level 5 606 Professional Level 6 607 Professional Level 7 608 Professional Level 8 609 Professional Level 9 610 Professional Level 10 611 Professional Level 11 612 Professional Level 12 613 Professional Level 13 614 Professional Level 14 615 Professional Level 15 616 Professional Level 16 617 Professional Level 17 618 Professional Level 18 619 Professional Level 19 620 Professional Level 20 621 Professional Level 21 622 Professional Level 22 623 Professional Level 23 624 Professional Level 24 625 Professional Level 25 626 Professional Level 26 TECHNICALLEVELS $15.49 $17.57 $3.40 $3.62 $31.22 $33.26 $17.56 $19.91 $3.62 $4.10 $33.29 $37.70 $19.93 $22.26 $4.11 $4.59 $37.73 $42.13 $22.27 $24.60 $4.59 $5.07 $42.16 $45.57 $24.52 $26.95 $5.07 $5.55 $46.60 $51.01 $26.95 $29.29 $5.56 $6.04 $51.04 $55.44 $29.30 $31.52 $6.04 $6.52 $55.47 $59.65 $31.63 $33.96 $6.52 $7.00 $59.66 $64.32 $33.99 $36.32 $7.01 $7.49 $64.35 $66.75 $35.33 $36.65 $7.49 $7.97 $66.76 $73.16 $36.66 $42.40 $7.97 $6.74 $73.19 $60.27 $42.42 $46.66 $8.74 $9.56 $60.30 $66.71 $45.67 $51.46 $9.66 $10.61 $66.73 $97.41 $51.47 $55.93 $10.51 $11.53 $97.44 $105.67 $55.94 $60.73 $11.53 $12.52 $105.90 $114.97 $60.75 $65.30 $12.52 $13.46 $115.00 $123.52 $55.32 $70.76 $13.45 $14.58 $123.65 $133.95 $70.76 $76.02 $14.59 $15.67 $133.96 $143.90 $76.03 $61.29 $15.67 $16.75 $143.93 $153.66 $61.30 $65.54 $16.76 $17.64 $153.91 $163.63 $66.56 $91.61 $17.64 $16.92 $153.65 $173.60 $91.63 $97.07 $16.92 $20.00 $173.63 $163.75 $97.06 $102.34 $20.01 $21.09 $163.76 $193.73 $102.35 $107.59 $21.09 $22.17 $193.75 $203.57 $107.51 $112.66 $22.16 $23.26 $203.70 $213.65 $112.67 $217.41 $23.26 $44.61 $213.56 $411.56 Technician Level 1 502 Technician Level 2 503 Technician Level 3 504 Technician Level 4 505 Technician Level 5 506 Technician Level 6 507 Technician Level 7 508 Technician Level 8 509 Technician Level 9 510 Technician Level 10 511 Technician Level 11 512 Technician Level 12 513 Technician Level 13 514 Technician Level 14 515 Technician Level 15 516 Technician Level 16 517 Technician Level 17 Technician Level 18 $11.99 $11.99 $2.47 $2.47 $22.71 $22.71 $12.01 $13.35 $2.46 $2.75 $22.73 $25.27 $13.36 $14.69 $2.75 $3.03 $25.30 $27.61 $14.70 $16.04 $3.03 $3.31 $27.63 $30.37 $16.06 $17.40 $3.31 $3.59 $30.40 $32.93 $17.41 $16.75 $3.59 $3.65 $32.96 $35.49 $16.75 $20.25 $3.67 $4.17 $35.52 $36.33 $20.26 $21.75 $4.16 $4.46 $36.36 $41.17 $21.76 $23.25 $4.49 $4.79 $41.20 $44.01 $23.26 $25.49 $4.79 $5.25 $44.04 $46.25 $25.50 $27.75 $5.25 $5.72 $46.26 $52.52 $27.76 $30.74 $5.72 $5.34 $52.55 $56.20 $30.75 $34.49 $6.34 $7.1 1 $56.23 $55.26 $34.50 $36.24 $7.1 1 $7.66 $65.31 $72.39 $38.26 $41.96 $7.66 $6.65 $72.42 $79.47 $42.00 $45.74 $6.66 $9.43 $79.50 $66.56 $45.75 $49.46 $9.43 $10.20 $66.51 $93.57 $49.49 $59.97 $10.20 $12.36 $93.69 $113.53 .ADM.l.N|$:T?A.TlV.E’.|-.EVEL5 AGENDA ITEM #6. f) AdministrativeLevel 1 AdministrativeLevel 2 $9.53 $13.76 $1.97 $2.84 $18.05 $26.04 AdministrativeLevel 3 $13.77 $16.39 $2.84 $3.38 $26.07 $31.03 Administrative Level 4 $16.41 $19.03 $3.38 $3.92 $31.06 $36.02 Administrative Level 5 $19.04 $21.66 $3.92 $4.46 $36.04 $41.00 Administrative Level 6 $21.68 $24.31 $4.47 $5.01 $41.03 $46.02 Administrative Level 7 $24.32 $26.95 $5.01 $5.55 $46.05 $51.01 AdministrativeLevel 8 $26.96 $30.70 $5.56 $6.33 $51.04 $58.12 AdministrativeLevel 9 $30.72 $35.21 $6.33 $7.26 $58.15 $66.66 Administrative Level 10 $35.24 $39.74 $7.26 $8.19 $66.72 $75.23 $39.76 $74.97 $8.19 $15.45 $75.26 $141.92 Labor rates below the Wasnington State Minimum Wage apply to employees in other states Table may have minor rounding errors. Alldirect reimbursables will be billed at cost with no mark-ups. All travel will be billed per the WSDOT Accounting Manual M 13-82,Chapter 10,Travel. These rates may be used for the life of the contract,assuming 5%escalation each year. Direct Reimbursable Costs Reprographics At Cost Couriers I Deliveries At Costs Telephone At Cost Copies $012 I copy Tmck Rentals At Cost Fax $1.00 /page Field equipment At Cost Mileage.per Travel Directive $.54 I mile AGENDA ITEM #6. f) Project Name:Rainier Avenue S Subconsultantz AMECFW Environment &Infrastructure,Inc. Degree of Risk The degree of risk for this project is :0.29 7.25 weight from 0.17 to 0.35,0.35 being riskiest Relative Difficulty of Work The difficulty of work for this project is:20 0.29 5.80 Weight from 0.17 to 0.35,0.35 being most difficult Size of Job <1oo,ooo =0.35 15 0.35 5.25 100,000 -5,000,000 proportionate from 0.34 to 0.21 5,000,000 -10,000,000 -proportionate from 0.21 to 0.17 Period of Performance >24 months =0.35 months 2 -24 months proportionate from 0.17 to 0.35 2.85 <2 months =0.17 Assistance by the Agency The amount of assistance from the agency is:15 0.35 5.25 rate from 0.17 to 0.35,0.35 being few items provided Sub-Consulting 10 0.32 3.20 of cost >4o%=0.35 0-40%proportionate from 0.17 to 0.35 0%=0.17 29.6 .o(H3 Fraction,rounded to two digits AGENDA ITEM #6. f) AB - 2146 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Supplemental Agreement No. 4 to CAG-17-082 with Perteet, Inc. for the Preparation of Construction Documents Up to 60% Design for the Park Avenue North Extension Project RECOMMENDED ACTION: Refer to Transportation (Aviation) Committee DEPARTMENT: Transportation Systems Division STAFF CONTACT: Bob Hanson, Transportation Design Manager EXT.: 7223 FISCAL IMPACT SUMMARY: The Park Avenue North Extension Project has a 2018 budget of $649,908 (317.122190). Supplemental Agreement No. 4 with Perteet, Inc. is $392,389 and is within budget. SUMMARY OF ACTION: The purpose of the Park Avenue North Extension Project is to construct improvements to extend North Park Avenue from the existing intersection with Logan Avenue North northward to connect to the Southport site now under construction. The supplemental agreement is to prepare construction documents up to the 60% design level and includes: 1. Public involvement. 2. Stakeholder coordination and planning. 3. Right-of-way acquisition support. 4. Geotechnical engineering services. 5. 30% plans and estimate. 6. Franchise utility review and coordination. 7. Supplemental survey and base mapping. 8. Structural design of signal pole foundations. 9. Boeing electrical duct bank modifications. EXHIBITS: A. SUPPLEMENTAL AGREEMENT NO. 4 TO CAG-17-082 STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to execute Supplemental Agreement No. 4 to CAG -17-082 with Perteet, Inc. in the amount of $392,389 for the preparation of construction documents up to 60% design for the Park Avenue North Extension Project. AGENDA ITEM #6. g) A _‘:::::'t‘I%t:nntitfa'|t'|?ansportation Supp|ementa|Agreement Organizationand Address Number 4 Perteet,Inc. ..505 -5th Ave.S.,#300OriginalAgreementNumberSeattle,WA 98104 CAG-17-082 Pho?ei 425-252-7700 ProjectNumber ExecutionDate CompletionDate June I,2019 ProjectTitle NewMaximumAmountPayable N.Park Avenue Extension-Preliminary Design and Design $626,721 Descriptionof Work This phase of the project will prepare construction documents up to the sixty percent (60%)design level to construct improvements for the Park Avenue N extension between Logan Avenue N and the Southport development. The Local Agency of desires to supplement the agreement entered in to with & and executed on M8 I 2017 and identi?ed as Agreement No.CAG-17-032 All provisions in the basic agreement remain in effect except as expressly modi?ed by this supplement. The changes to the agreement are described as follows: I Section 1,SCOPE OF WORK,is hereby changed to read: See exhibit 4—AScope of Work II Section IV,TIME FOR BEGINNING AND COMPLETION,is amended to change the number of calendar days for completion of the work to read: Section V,PAYMENT,shall be amended as follows: Increase total contract amount from $234,332 to $626,721. as set forth in the attached ExhibitA,and by this reference made a part of this supplement. If you concur with this supplement and agree‘to the changes as stated above,please sign in the Appropriate spaces below and return to this of?ce for ?nal action. By:By: ConsultantSignature ApprovingAuthoritySignature Date DOT Form 140-063 Revised O9/2005 AGENDA ITEM #6. g) City of Renton Park Ave.N.Extension -60%Design Exhibit "A" Summary of Payments Basic Supplement #1 Supplement #2 Agreement Time Extension Time Extension Supplement #3 Supplement #4 Total DirectSa|aryCost 46,162 -$4.905 $33.300 5134.353 Overhead (IncludingPayrollAdditives)5 84,911 S -S -S 9,025 $153,222 $247,158 Direct Non-Sa|aryCosts S 2,450 -5 54.176 5 129,211 $185,837 Fixed Fee 14,77 -5 1,570 $26,656 $42,998 Management Reserve 11,360 -$5,000 5 16,360 Total 159,655 --$74,677 $392,389 $626,721 AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGNPHASE Agreement with Pcrtcei lnc.April 30.2Ol8 Exhibit 4A During the term of this Contract,Perteet,Inc.(CONSULTANT)will perform professional services for the City of Renton (CITY),as detailed below: INTRODUCTION The project will construct improvements to extend Park Avenue N from the existing intersection with Logan Avenue N northward to connect to the Southport site now under construction.The purpose of the roadway extension is to provide a connection to the Southport development and relieve congestion on Lake Washington Boulevard. GENERAL SCOPE OF SERVICES This phase ofthe project will prepare construction documents up to the sixty percent (60%) design level to construct improvements for the Park Avenue N extension between Logan Avenue N and the Southport development.Services not included in this scope of services are specifically excluded from the scope of the CONSULTANT’sservices.The CONSULTANT assumes no responsibility to perform any services not specifically listed in this scope of services.If agreed to in writing by the CITY and the CONSULTANT,the CONSULTANT shall provide Optional Services.Optional Services are not included as part of the Basic Scope of Services and shall be paid for by the Client in addition to payment for Basic Services,in accordance with the CONSULTANT’sprevailing fee schedule as agreed to by the CITYand the CONSULTANT.At the ClTY‘srequest,the CONSULTANT may be asked to provide environmental support and/or construction management services.The CONSULTANT reserves the right to shift funds within the Contract between Tasks,and between members of the CONSULTANT team during the prosecution of the work. Currently only local agency funds will be used in the planning,design,and/or construction of the project.The CONSULTANT will use procedures outlined in the WSDOT Local Agency Guidelines (LAGManual)during development of the project. Task 1 —Project Management Task 2 —Agency/Large Property Owner Coordination and Planning Task 3 —Public Involvement Program Task 4 —Right-of—Way Acquisition Task 5 —Geotechnical Engineering Services Task 6 —30%Plans and Estimate Task 7 —60%Plans,Specifications and Estimate Task 8 —Franchise Utilities Review and Coordination Task 9 —60%Stormwater Report Task 10 —Supplemental Survey and Basemapping Task 11 —Structura|Design of Signal Pole Foundations Fileloconon Y -Cormoci Administration Conilacrs Renion Pork Av:-N Eu Scope 50":Design_4-30-IE5 doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreerneniwiih Perleei lnc.APfil3Oi2OlB Task 12 —Boeing Electrical Duct Bank Modifications Task 13 —Management Reserve OPTIONAL SERVICES The CONSULTANT may be asked by the CITYto provide optional services.Optional services that may be performed include: 0 Assistance with preparation of environmental documentation and permits -Assistance with preparation of grant funding packages -Preparation of 90%and Final Design Documents 0 Assistance during Bidding 0 Services during Construction Providing optional services will require a supplement to this agreement. TIME FOR COMPLETION All work under this contract will be completed within four (4)months (120calendar days)of notice to proceed. Task 1 —Project Management 1.1 Continuous Project Management The CONSULTANT will provide continuous project management administration (billing invoices, monthly progress reports,consultant coordination)throughout the project's duration (assume four [4]months). 1.2 Budget and Schedule Oversight The CONSULTANT will monitor project budget and schedule.Schedule will be developed using MS Project 2013.Schedule will be updated on a monthly basis. 1.3 Work Plan The CONSULTANT will update the work plan developed during the previous phase ofthe project for this phase of the project including communication plan,deliverables,quality control plan, and procedures for change management. File locmion Y ‘Conlmcl Adrrunisimucn C0v\lru(is‘Renl(m\POIk Ave N Exi Scope 60‘:Desngn,4-30—l8.doc AGENDA ITEM #6. g) PARK AVENUE N EXTENSION—FINALDESIGN PHASE Agreernenl wilh Pericei lnc.April30.2Ol8 1.4 Project Coordination Meetings The CONSULTANT will attend bi—weekly Project Coordination meetings with key CITYstaff to discuss the project and report on progress.Attendance will consist of up to two (2) CONSULTANT task leads,CONSULTANT project manager,CITYproject manager,and other CITY staff as determined by the ClTY’sproject manager to review project status and coordinate activities for current work tasks.Meetings will be held at Perteet's offices.Prepare and distribute meeting minutes.Assume eight (8)meetings total. 1.5 Quality Assurance/Quality Control Program The CONSULTANT will conduct an internal quality assurance program prior to major submittals. Major submittals are defined as the 60%construction documents.This task will supplement the continuous quality assurance program by conducting a detailed review of each major submittal for compliance with project criteria and consistency with the project goals. Deliverables: 0 Invoice and progress reports submitted monthly in hard copy via US Mail.Twelve (12) prepared invoices will be submitted. -MS Project Gantt Schedule submitted every other month in hard copy with project invoices via US Mail.Four (4)schedule updates will be submitted. 0 Project work plan,and change management procedures submitted via e—mailin PDF format.One (1)project work plan will be submitted. -Meeting Agendas outlining likely discussion topics for each Project Coordination Meeting,submitted via e—mailin MS Word format at least one (1)working day before each meeting. 0 Meeting Minutes documenting each Project Coordination Meeting,submitted via e—mail in MS Word format within three (3)working days of each meeting. 0 Markups of major submittal quality control reviews in hard copy format with each major submittal.One (1)quality control review document will be submitted for each of the following: o 60%Construction Documents 0 Utility Conflict Analysis Memorandum o 60%Stormwater Report Task 2 —Agency/Large Property Owner Coordination and Planning This element of the work includes efforts to coordinate the project development with other agencies and adjoining large property owners.Known key entities include the City of Renton (CITY),the Boeing Company (BOEING),Burlington Northern Santa Fe Railroad (BNSF),Puget Sound Energy (PSE)and SECO.The US Fish &Wildlife Service (USFW),the US Army Corps of Frleloconon Y Conliotl Adn’1IF\lS'{C'lOF\Conirocis Rcnion Park Ave N in Scope 60':D:-sign,~‘—30—iBdoc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FlNALDESIGNPHASE AgreemenlwithPerleel lnc.APril3O.2Ol8 Engineers (USACOE),the Tribes,and Washington State Department of Ecology (DOE)will also have interest in the project,and the CONSULTANT encourages their involvement early in the project. 2.1 Agency/Large Property Owner Coordination and Planning Organize and attend up to six (6)two-hour coordination meetings with the agency/large property owner stakeholders.These meetings will to the maximum extent possible be joint meetings to share project status,issues,and areas of concern.Keeping these entities informed typically benefits the project with shorter approval cycles from the agencies and keeps the large property owners informed of project status. Deliverables: 0 Attendance of up to two (2)CONSULTANT staff members for each Coordination meeting,for a total of two (2)hours per staff member.Up to twelve (12)meetings are anticipated. 0 Meeting Agenda for Coordination meetings,submitted via e—mailin MS Word format at least two (2)days before each meeting.Up to six (6)coordination meeting agendas will be prepared. 0 Meeting Minutes from Coordination meetings,submitted via e—mailin MS Word format within three working days of the meeting.Up to six (6)Coordination meeting minutes will be prepared. Task 3 —Public Involvement Program The key goal of the public involvement program is to inform the community about the proposed improvements to the Park Avenue N Extension by providing public information.Tasks to achieve this goal include: 3.1 Council Briefing CITYstaff will conduct a study session meeting with the Renton City Council (COUNCIL)to keep the COUNCIL informed of project progress and to solicit decisions.The meeting will follow the 60-percent design submittal to inform the COUNCILof project status.The CONSULTANT will provide a brief summary of presentation purpose for inclusion in COUNCIL pre—meeting packets. Deliverables: 0 Summary of presentation purpose for inclusion in COUNCIL pre—meeting packets, submitted in MS Word format via e—mailone (1)week before each presentation.The CONSULTANT anticipates the summary will be brief,on the order of "250 words. File location V ‘Ccnivccl Adrmmsircmon ConimcIs‘Remon Park Ave N Exl Scope 60‘:Design,”-—30—l8.dcc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Perfect Inc.APHI30.2Ol8 3.2 Project Web Site The CONSULTANT will support a project web site maintained by the CITYto provide current project information and opportunity for project feedback.This allows active community participation throughout the project.The CITYwill host the project website and post materials to the website.The CONSULTANT will provide up to two (2)project updates for posting by the CITY in conjunction with project meetings and presentations. Deliverables: 0 Two (2)project updates consisting of meeting materials,presentations,comment summaries,and other materials prepared under other tasks in PDF format for posting by the CITYon the project website. Task 4 -Right-of-Way Acquisition Right—of—wayacquisition services to be provided include development of right—of—wayplans along with fee simple or easement documents to be used by Abeyta &Associates (ABEYTA)to acquire property necessary to construct the project. 4.1 Right-of-Way Plans The CONSULTANT will prepare right—of—wayplans for the project following the WSDOT LAG Manual procedures.The right—of—wayplans will have the appearance of WSDOT style right-of~ way plans,but will not follow the strict adherence to line symbology and font format of WSDOT.The right—of—wayplans will be prepared at l"=50’scale,and for each property identify the existing property area,any required acquisition (whether fee simple or easement),and remaining property area. 4.2 Legal Descriptions The CONSULTANT will prepare two (2)legal descriptions describing each property fee simple or easement acquisition.Legal descriptions will not be prepared for right—of—entrysituations for elements such as driveway reconstruction.A total of two (2)parcels have been identified that may require property acquisition.No parcel maps will be prepared for the legal descriptions. 4.3 Right-of-WayAcquisition ABEYTAwill prepare and review appraisals and conduct negotiations with property owners in the corridor under a separate contract directly with the CITY.The CONSULTANT will coordinate with ABEYTAduring this process and anticipates up to six (6)meetings will be required specifically for the right~of—waynegotiations,each lasting up to four (4)hours.Appraisals, review appraisals,and negotiations will be conducted by ABEYTA in accordance with the WSDOT Right—of—WayManual and the project's federal funding. Fulelocuuon Y Coniroci Adrmmsncmcm Comvucvs Rcmon Pm’.Ave N Ext Scope 60‘:DcsIgn_4-30-l8.doc AGENDA ITEM #6. g) PARK AVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Perteet lnc.April30,20l8 Deliverablesz One (1)set of Right—of—WayPlans at 1"=50’scale on 22"x 34"bond,submitted in hard copy form and delivered by US Mail. Legal descriptions on 8.5”x 11"documents describing the easement or right—of—wayto be acquired.lncluded with the legal description will be a diagram illustrating the acquisition (the diagram will not illustrate the entire parcel). Task 5 —Geotechnical Engineering Services The proposed work for geotechnical services will be conducted by HWA Geosciences (HWA)as a SUBCONSULTANT to the CONSULTANT (Perteet)and include the following tasks: 5.1 5.2 Geotechnical Project Setup Geotechnical Invoicing Setup:Upon notice to proceed,HWA will complete project setup procedures.This will include configuring the project in HWA’s accounting software. Attend Project Kickoff Meeting:HWA will attend one (1)project kickoff meeting with the CITY and the design team.This meeting will review project objectives, communication protocol,and schedule.HWA assumes that this meeting will take place at the C|TY's office. Collect and Review Available Geotechnical Data:HWA will review readily available and relevant information along the project corridor.This review will include online geotechnical databases,geologic maps and HWA library. Explorations (Geotechnical Borings) Plan Field Exploration Program:HWA will plan and coordinate a geotechnical exploration program for the project.The program will consist of conducting up to six (6) geotechnical borings along the corridor in support of retaining wall design,signal pole design,luminaire foundation design,railroad crossing design,and identification of potentially compressible soil deposits that could affect the proposed roadway.Planning will include identification of the location of the geotechnical borings,development of traffic control plans (if required)and coordination of required equipment,flaggers,and utility clearance. Conduct Utility Locates for Geotechnical Explorations:Prior to generating the geotechnical work plan,HWA will mark the proposed exploration locations and arrange for utility locates using the Utility Notification Center.Utility location marks will be used to verify proposed field exploration locations prior to development of traffic control plans. Filelocation.Y ‘Conlroci Adnimisnonon‘Connucis‘—Renvon‘PmkAve N Exl Scope 60%Design_!.—30-lB.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Pertecl lnc.April30,20l8 Generate Geotechnical Work Plan Memo:HWA will prepare a Geotechnical Work Plan Memorandum for the exploration program.This work plan will be submitted to the CITY for review and approval.The work plan will detail the type,location,and extent of proposed field explorations along with logistics necessary to perform the work such as traffic control plans and staging areas.The work plans will also be used for utility locating clearances and for permitting that may be necessary to access the exploration locations.We assume the CITYor the CONSULTANT,in support of this project,will acquire and provide any required permits or right of entries at no cost to HWA. Conduct Explorations (Geotechnical Borings):HWA will conduct a series of up to six (6) geotechnical borings along the project corridor to assess the subsurface soil conditions. Geotechnical borings will be conducted both within and outside existing pavement areas.Any geotechnical borings conducted within the pavement areas accessing BOEING will be drilled during the day—time hours of 9am to 3pm with appropriate traffic control measures.Each boring will be drilled to a depth of 20’to 30'below ground surface.Boreholes will be patched with rapid—setting Portland cement concrete.Traffic control to consist of Arrow Board Mounted Attenuator Truck behind coned off work area for both coring and pavement patching by subcontractor.Flaggers may be utilized as needed (assume one [1]day of ?aggers). HWA will install a groundwater monitoring well in one (1)boring location along the corridor to monitor groundwater fluctuations.The location of the well will be determined in the field based on observed soil and groundwater conditions at the time of drilling.HWA will install a flush—mounted steel monitoring well monument at the location of the monitoring well.HWA will install data logging transducers in the well to measure water levels over a period of one (1)year.Upon completion of design,the monitoring well will be decommissioned by the contractor in accordance with the DOE requirements. Each geotechnical boring will be logged by an HWA geotechnical engineer or HWA engineering geologist.HWA will patch each boring conducted through the pavement with quick drying concrete upon completion of the boring. Generate Boring Logs and Assign Laboratory Testing:HWA will prepare summary boring logs and perform laboratory testing to evaluate relevant physical properties of the site soils.Laboratory testing would include moisture content,hydrometers,grain» size distribution,one dimensional consolidation tests,and Atterberg Limits. Groundwater Monitoring:HWA will install a groundwater monitoring transducer in the proposed monitoring wells.The transducer will be set to acquire groundwater elevation readings every half an hour for the duration of one (1)year.A Hydrogeologist from HWA will make two (2)visits to download and process the groundwater data.This data will be used to provide geotechnical design recommendations and to provide prospective contractors with an accurate representation of the seasonal groundwater variations across the site. FileIOCOYIOWV Contract Admimsiroiion‘ConIroc!s‘Renlon Purl Ave N Exr Scope 60”:DesIqn_4~50-l8.do( AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Perieei Inc. 5.3 April30,2018 Geotechnical Design Services Evaluate Field and Laboratory Data:Based on the borings and the laboratory test results of selected samples,HWA will generate estimates of the soil strength and other properties needed to evaluate the effects the subsurface conditions will have on the proposed improvements. Develop Geologic Profiles:HWA will develop a geologic profile along the project alignment.The location and orientation of the geologic profiles will be determined based on the needs of the project.All geologic profiles will be included in our geotechnical reports. Generate AASHTO Seismic Design Parameters:Based on the soils encountered along the alignment,HWA will determine the Site Class for seismic design.The design spectral acceleration parameters will then be selected in accordance with the AASHTO Specifications for Road and Bridge. Settlement Evaluation:In the event that HWA identifies potentially compressible soils along the project alignment,HWA will evaluate the soils for potential primary and secondary settlement impacts associated with the proposed improvements. Evaluate Retaining Walls:HWA will evaluate the impact of the proposed improvements and fill retaining wall options along the corridor that may be used to minimize impacts on adjoining properties.HWA will provide design parameters for retaining wall design. Stormwater Facility Analysis:HWA will provide geotechnical recommendations for required stormwater facilities as they pertain to this project.HWA assumes that stormwater management facilities will consist of detention facilities that could be either open ponds or detention vaults. Signal Pole,Railroad Crossing Arms,and Luminaire Foundation Analyses and Recommendation:HWA will evaluate the data derived from our field investigations and laboratory testing to complete geotechnical engineering analyses to provide required signal pole,railroad crossing arm foundations,and luminaire foundation recommendations as required.HWA assumes that signalization improvements and luminaire foundations will be designed based on WSDOT standard plans and procedures. HWA QA/QC:HWA will have all design calculations and recommendations reviewed by a senior principal prior to distribution to the CONSULTANT or the CITY. Project Coordination Meetings:HWA will attend up to two (2)project coordination meetings,at either the ClTY’soffice or CONSULTANT’sSeattle office.HWA's attendance will be used to convey the geotechnical considerations of the site to the CITYand the CONSULTANT. Prepare Draft Geotechnical Engineering Report:HWA will prepare a draft geotechnical engineering report for the project.This report will contain the results of the geotechnical engineering investigation,including description of surface and subsurface conditions;a site plan showing exploration locations and other pertinent features; Filelocuvion V‘Con1rociAdmmisnaiion Cannons Ramon PmL Ave N Exi Scope >30‘:Desigr,»‘v30—l8.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGNPHASE Agreemenl WlII"lPerleei Inc. 5.4 April30,20l8 summary boring logs;and laboratory test results.The report will provide geotechnical recommendations for each of the proposed improvements. Prepare a Final Geotechnical Engineering Report:HWA will finalize our geotechnical engineering report once we receive review comments from the CONSULTANT and the CITY. Conduct Plan and Specification Review:HWA will conduct a plan review at the sixty percent (60%)milestones to ensure that the geotechnical aspects of the project have been properly incorporated into the project plans. Project Management Invoice Generation and Processing:HWA will prepare monthly invoices and progress reports for the duration of the design phase of the project. Geotechnical Task Management:HWA will provide geotechnical task management to all geotechnical related aspects of the project.HWA will correspond with the CITYand the CONSULTANTin the form of emails,fax,and telephone calls,as necessary. CITY Responsibilities: All required rights of entry will be provided by the CITYat no cost to HWA. Assumptions: The geotechnical explorations proposed herein will not be used to assess site environmental conditions.However,visual or olfactory observations regarding potential contamination will be noted.Analysis,testing,storage,and handling of potentially contaminated soil and ground water (either sampled or spoils from drilling) are beyond this scope of services.If contaminated soils and/or ground water are encountered,the material will be properly contained on—site for disposal as mutually agreed upon without additional cost to HWA. All non—contaminated drilling spoils and related debris will be drummed on—site and transported off-site for disposal by the drilling subcontractor. HWA will be responsible for all post—dri|Iing clean up. HWA assumes no concrete pavement below the surface asphalt and assumes that coring will not be required prior to drilling the proposed borings. No Phase 1 or Phase 2 Environmental Site Assessment will be completed by HWA. All required street use permits will be provided by the CITYat no cost to HWA. All geotechnical borings conducted through the pavement and pavement cores will be patched with quick~drying cement.Sawcutting of the pavement or hot-mix asphalt patches will not be completed. The borehole locations will be surveyed by others. Pavement Design will be completed by the CONSULTANT. Filelownon.Y Ccnlrnrl Admimsvciion Conrrncis Rcnion Park Ave N Exi Scope 60':Design.-'1-30-i&.do: AGENDA ITEM #6. g) PARK AVENUEN EXTENSION—FINALDESIGNPHASE Agreement with Perleef lnc.April30,20l8 No stormwater infiltration testing,above and beyond grain size screening,will be completed as part ofthis scope of work. The site soils will support standard plan signal pole and luminaire foundations design. No non-standard signal pole or foundation design will be required. The monitoring well installed as part of the field explorations will be maintained throughout design and abandoned by the contractor during construction. The monitoring well will be installed within the shoulder or beyond the shoulder where no traffic control will be needed for accessing the monitoring well. No uniform police office will be required for traffic control implementation during the exploration program. Traffic control will be limited to only one (1)work day of a two (2)flagger crew to conduct the exploration. Task 6 —30%Plans and Estimate Thirty percent (30%)preliminary plans for a preferred design alternative will be prepared for the project,based on the draft layout in Figure 1,and additional detail refinement discussions with project stakeholders and CITYstaff,and approved by the CITY.The CONSULTANT assumes that the preliminary plans will fit on three (3)"base sheets”,utilizing 11"by 17"sheets at 1"= 40’scale,and all components of the 30%plans featuring work in plan view will follow this assumption. FT.it/4out Figure 1.Conceptual Park Avenue N Extension. 10 Filelocation V \Conimci Admimsimuon‘Conivocvs\Renion‘Park Ave N Ex!Scope 60’;DcSign,4>50‘l8.doC AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESKENPHASE Agreement with Perfect lnc.April30,20l8 The CITYanticipates that some or all ofthe parcel north of the BNSF railroad tracks currently owned by PSE will be purchased by SECO in order to extend the Southport development and its network of proposed access roadways,and that this revised alignment will form the northern tie—inpoint for the Park Ave N Extension.As a result,the roadway alignment illustrated in Figure 1 is likely to be changed north of the BNSF railroad tracks to correspond to these revisions.The CONSULTANT assumes that SECO will identify the revised access roadway alignment early in the development of the 30%plans and submit to the CITYfor review and approval,and that the revised alignment will be informed by the CONSULTANT’sdesign of the proposed railroad crossing location,as vetted by the CITY.Once the CITY approves the alignment and profile ofthe access roadway system,it will provide them to the CONSULTANT for incorporation into the 30%plans,and these elements will not be changed thereafter. At this time,a total of up to fourteen (14)plan sheets (based on three [3]base sheets)are assumed as necessary for the 30%plans.These 30%plans will be used as a basis for development of detailed plans in the PS&E phase of the project,and to develop a budget level opinion of cost for the project.Specific preliminary plan components are anticipated to consist of the following: 6.1 Cover Sheet (one [1]sheet,not to scale) 6.2 Typical Roadway Sections (one [1]sheet,to scale with vertical scale exaggerated as needed/applicable) 6.3 Paving and Grading Plans (three [3]sheets) The CONSULTANT will prepare plans demonstrating the project footprint and will include horizontal alignment information,paving limits,limits of cut/fillrequired and match elevations for other area projects identified in Task 3 from which basemap information is developed. Existing utility features will be shown in halftone (screened). 6.4 Roadway Profiles (three [3]Sheets) The CONSULTANT will prepare plans illustrating the roadway centerline profile.They will be developed in conjunction with how the roadway profile will be compatible with the other area projects identified in Task 3 from which basemap information is developed. 6.5 Preliminary Drainage Plans and Profiles (three [3]sheets) The CONSULTANT will prepare plans demonstrating the project's proposed drainage conveyance system and water quality/detention facilities.Existing utility features will be shown in halftone (screened).These plans will illustrate the profile view for storm water drainage pipes.Crossing utilities will be shown as a single vertical line if the elevation is unknown. ll FileIOCDNDHY ‘Contract Adnumsuuucm‘Cumrnrls Remon Park Ave N Ext Scope 60’:Design,4—50—l8doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FlNALDESIGN PHASE Agreement wilh Perleei lnc.APT!)30,2mg 6.6 Channelization Plans (three [3]sheets) The CONSULTANT will prepare plans illustrating the preliminary channelization for the project, including intersection channelization. 6.7 Opinion of Cost The CONSULTANT will prepare an opinion of cost based on the 30%plans.The opinion of cost will be based on unit prices,and incorporate about a 30%contingency to account for the level of completeness of plan preparation,and to reflect past experience on similar projects within the region. The CONSULTANT will compile a draft set of the 30%plans and opinion of cost estimatefor review and comment by CITYstaff.CITYstaff will consolidate all comments into one (1)package for response by the CONSULTANT.The CONSULTANT will prepare a proposed response to each comment received,and then conduct one (1)meeting with CITYstaff to reconcile any outstanding comments.After reconciling comments at this meeting,the CONSULTANT will prepare and submit a final set of 30%plans and opinion of cost. Deliverables: I Five (5)copies of the draft 30%plans (half size,l"=40’scale)and opinion of cost estimate submitted in hard copy form and delivered by US Mail. 0 Five (5)copies ofthe final 30%plans (half size,1”=40’scale)and opinion of cost estimate submitted in hard copy form and delivered by US Mail. Task 7 —60%Plans and Estimate The CONSULTANTwill prepare sixty percent (60%)construction plans based on the recommended alternative identified during the 30%design and design report phase of the project.It is assumed that the 60%design plans will fit on three (3)”base sheets",utilizing 11”x 17"sheets at 1"=40'scale.All plans identified below will be developed at this scale unless noted otherwise.A key assumption is that the CONSULTANT will develop plans for the roadway improvements across the PSE site. At this time a total of up to 44 plan sheets (based on three [3]base sheets)are assumed as necessary for the schematic plans.Specific 60%plan components are anticipated to consist of the following: 7.1 Cover Sheet (one [1]sheet,not to scale) I2 File Iocanorr Y Conimzi Admimsimlion Conivcczs Ramon Pml Ave N ExvScope 60‘:D€SIgf‘i,‘l~30-l8dc: AGENDA ITEM #6. g) PARK AVENUE N EXTENSlON~FlNALDESIGN PHASE Agreement with Perteel lnc.April30,20l8 7.2 Legend and Abbreviation Sheet (one [1]sheet,not to scale) 7.3 Survey Control and Alignment Sheet (one [1]sheet,1"=100’scale) 7.4 Typical Roadway Sections (two [2]sheets,not to scale) 7.5 Site Preparation,Erosion Control Plans,and Miscellaneous Details (four [4] sheets) The CONSULTANT will prepare plans identifying areas of removal and site preparation along with Best Management Practices (BMPs)for erosion control.Existing utility features will be shown in halftone (screened).One (1)sheet to document details for Temporary Sedimentation and Control is included. 7.6 Paving and Grading Plans and Miscellaneous Details (four [4]sheets) The CONSULTANT will advance the 30%paving and grading plans to the 60%design level, including horizontal and vertical alignment information,paving limits,,limits of cut/fill required,and earth retaining systems.Existing utility features will be shown in halftone (screened),One (1)sheet to document details for curb ramps are included. 7.7 Drainage Plans/Profilesand Miscellaneous Details (seven [7]sheets) The CONSULTANT will advance the 30%drainage plans and profiles to the 60%design level, including the proposed drainage conveyance system and water quality facilities.Existing utility features will be shown in halftone (screened).Two (2)sheets to document details of anticipated water quality facilities are included. 7.8 Channelization and Signing and Details (four [4]sheets) The CONSULTANT will advance the 30%channelization and signing plans to the 60%level, including intersection channelization and sign tables documenting sign type,size and location. One (1)sheet to document details for channelization and signing is included. 7.9 Illumination Plans and Details (four [4]sheets) The CONSULTANT will prepare plan sheets at the 60%level for the illumination system along the corridor detailing luminaire pole and foundation locations and associated conduit systems. One (1)sheet to document details for luminaires,foundations,and associated conduit system is included. 7.10 Traffic Signal Plans (five [5]sheets) l3 Filelocnllon:V ‘Connoci Admm-sivcmon Convrucrs\Runron Park Ave N ExvScope 60:’:Dcsugn,4—30~l8.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreement Wlll’\Pcrleel lnc.April30.2Ol8 The CONSULTANT will prepare signal plans at the 60%level,including detailed pole and foundation information for the signal revision at Logan Avenue N and Park Avenue N.The CONSULTANT assumes that a modified signal will be included for the intersections of Logan Avenue N and Park Avenue N. 7.11 Planting Plans and details (four [4]sheets) The CONSULTANT will prepare planting plans at the 60%level for proposed landscape improvements.Irrigation will not be included in the project.Drought tolerant planting materials will be utilized,with the anticipation that water trucks will be used on a limited basis through plant establishment.Planting plan sheets will include schedules,notes,and details. 7.12 BNSF Railroad Crossing and Details (four [4]sheets) The CONSULTANT will develop plans at the 60%level for the proposed roadway crossing at the BNSF railroad tracks,including up to three (3)detail sheets to illustrate crossing gates and other specific features required by BNSF. 7.13 Construction Staging Plans (three [3]sheets) The CONSULTANT will prepare construction staging plans at the 60%level to demonstrate possible traffic sequencing scenarios to maintain traffic in the corridor during construction. Construction project stages will be illustrated on 11'’x 17"plan sheets at 1”=100’scale. 7.14 Opinion of Cost The CONSULTANT will prepare an opinion of cost for the 60%schematic plans,and will include allowances for acquisition of right—of—way.The opinion of cost will be based on unit prices,and incorporate contingencies to account for the 60%level of completeness,and to reflect past experience on similar projects within the region.When preparing the opinion of cost,the CONSULTANT will endeavor to keep the project within the construction cost identified in the Design Report prepared by the CONSULTANT during an earlier phase of work.If the CONSULTANT discovers that likely construction costs have increased from the 30%opinion of cost,the CONSULTANT will make suggestions on how to bring the project back within budget. In providing opinions of probable construction cost,the CITY understands that the CONSULTANT has no control over the cost or availability of labor,equipment or materials,or over market conditions or the Contractor’s method of pricing,and that the CONSULTANT's opinions of probable construction costs are made on the basis of the CONSULTANT's professional judgment and experience.The CONSULTANT makes no warranty,express or l4 Fuleloconon V Ccnvrcm Admmisirmion Contracts Rt'l'\VDl'\Park Ave N Ex!Scope 60‘:DL‘SIgF\J<'-30-:8.dOC AGENDA ITEM #6. g) PARK AVENUE N EXTENSION—FINALDESIGNPHASE Agreement wilh Perleet lnc.April50,20l8 implied,that the bids or the negotiated cost of the Work will not vary from the CONSULTANT’s opinion of probable construction cost. Deliverablesz 0 The CONSULTANT will submit plans and opinion of cost estimate for the 60%level of design for review and comment by CITYstaff.CITYstaff will consolidate all comments at each review stage into one (1)package for response by the CONSULTANT.The CONSULTANT will prepare a proposed response to each comment received,and then conduct one (1)meeting with the CITYto reconcile any outstanding comments. 0 Five (5)copies of the 60%plans (half size,1”=40'scale)and opinion of cost estimate submitted in hard copy form and delivered by US Mail, Task 8 —Franchise Utilities Review and Coordination 8.1 Final Utility Conflict Analysis Based on the thirty percent (30%)preliminary design,the CONSULTANT will prepare a one—to two-page (1-2 page)memorandum to document potential utility conflicts and the potential locations for franchise utilities to relocate.The CONSULTANT will develop a plan identifying locations for potholing by the utilities of potential conflict locations and share it with the respective franchise utilities as part of Task 8.2. Deliverablesz I One (1)draft Utility Conflict Analysis Memorandum for CITYreview and comment submitted via e—mailin PDF format. I One (1)final Utility Conflict Analysis Memorandum submitted via e—mai|in PDF format. 8.2 Franchise Utility Coordination Meetings The CONSULTANT will attend C|TY—facilitated project utility coordination meetings at the CITY (up to two [2]are assumed for this phase of the project).Topics to be covered include anticipated project impacts and schedule,future utility infrastructure,potential conflicts and their resolution,and timeframes required for any anticipated utility relocations. Deliverables: 0 Meeting Agenda for coordination meetings,submitted via e-mail in MS Word format at least two (2)days before each meeting.The CONSULTANT will attend up to two (2) coordination meetings will by two (2)CONSULTANT staff members per coordination meeting. 0 Meeting Minutes from coordination meetings,submitted via e—mailin PDF format within three (3)working clays of the meeting.The CONSULTANT will prepare up to two(2) utility coordination meeting minutes. I5 Filelocation:Y;‘.ConIrccv AdministrationiConnccis‘~Renion‘\ParL Ave N Ext Scope 60::DesIgn_4—30—l8.doC AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Pcricci lnc.April30,20l8 Task 9 —60-Percent Stormwater Analysis and Report The CONSULANTwill perform a stormwater analysis of the project based on the sixty (60%)percent schematic design.The results of this work will be summarized in a Technical Information Report (TIR)conforming to CITYstandards (based on the 2016 King County Surface Water Design Manual (KCSWDM),with Renton Amendments.Coordination and concurrence with CITYstaff on Task 9.1 will be completed prior to performing Tasks 9.2 through 9.3.Prior to the CONSULTANT beginning this work,the CITY will provide available relevant studies in the area for the CONSULTANT to review. 9.1 Offsite Analysis The CONSULTANT will delineate the project Threshold Discharge Areas (TDAs)and respective discharge locations using available GIS mapping with contours,drainage basins,and known stormwater conveyance systems.A total of up to two (2)TDAs are assumed.Maps to be submitted as part of the Stormwater TIR will identify the project TDA limits and their relation to the City's established basins if available,contributing off—sitedrainage areas,direction of flow, existing conveyance and stormwater facilities if known,and downstream routes.The drainage maps showing contributing land located up-gradient (upstream)ofthe project will be based upon GIS contours provided by the CITY.This scope does not include conducting a detailed field survey of land—use,impervious areas,or land cover of the drainage basins.The CONSULTANT will conduct a downstream analysis consistent with the requirements of the KCSWDM for each project discharge location.This will be a visual inspection ofthe downstream routes for one quarter mile downstream of project discharge locations.The CONSULTANT will provide the CITY with a summary of downstream parcels needing right—of—entrypermission for downstream observation.The CITYshall obtain right—of—entryto parcels to be visually inspected and provide them to the CONSULTANT in advance of the visual inspection.The CONSULANTwill prepare a written assessment of the condition of the downstream conveyance which will be included in the Stormwater TIR.This scope does not include any detailed hydraulic capacity analysis or backwater analysis ofthe downstream conveyance systems. Deliverablesz -Up to one (1)drainage basin/TDAmap at a scale reasonable for the basin size (to be submitted as part of the 30%Stormwater Technical Memorandum (See Task 9.2)and the Stormwater TIR (See Task 9.3)). I Design Criteria Memorandum listing design standards to be followed for stormwater management on this project. 0 Downstream drainage map identifying point discharge locations and downstream routes extending from the project limits for one quarter mile (to be submitted as part of the 30%Stormwater Technical Memorandum (See Task 9.2)and Stormwater TIR (See Task 9.3)). I Downstream Analysis consistent with the KCSWDM (included in the 30%Stormwater I6 Fuleloconon.Y ConvianAdmmis1vanon Contracts RL'I'\IOY\Pmk Ave N Ext Scene 50‘:Dcsign_4~30-l8.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESlGN PHASE Agreement Wiil"lPerteet lnc.April 30.20l8 Technical Memorandum (See Task 9.2)and the Stormwater TIR (See Task 9.3)). 0 Transcribed field notes and relevant photos from the visual inspection site visit (included as an appendix in the 30%Stormwater Technical Memorandum (See Task 92) and the Stormwater TIR (See Task 9.3)) 9.2 Threshold Analysis,Water Quality Treatment,Flow Control,and Conveyance The CONSULTANT will perform a threshold analysis for each project TDA delineated in Task 91, and determine which core requirements will apply for each TDA.The CONSULTANTwill calculate the sizes and identify locations of flow control and water quality facilities if necessary and flow control BMPs if any are feasible.A total of two (2)facilities for each flow control and water quality may be necessary to serve the length of the project.The approximate size of the facilities will be determined with the goal of locating them within the roadway prism.The CONSULTANT will prepare a 30%Stormwater Technical Memorandum summarizing the minimum requirements,recommendations for compliance,and appropriate comparison criteria for the project. Deliverables: 0 Change in Land Cover Types Maps showing existing and proposed land covers to assist with threshold analysis. 0 Five (5)copies of the 30%Stormwater Technical Memorandum for CITYreview and comment submitted in hard copy form and delivered by US Mail as part of the 30% submittal. 0 Calculations necessary to size all stormwater facilities proposed for the project.These calculations will include any maps or figures necessary as backup documentation to the calculations and will be included as an appendix to the Stormwater TIR (See Task 9.3)as part of the 60%submittal. 9.3 Technical Information Report (TIR) The CONSULTANT will prepare a Stormwater Technical information Report (TIR)documenting the drainage analysis and design.The TIR will address the Core Requirements and how each is being met,including any flow control and water quality facilities and flow control BMPs proposed for the project.The report will follow the King County TIR format and include the design information and calculations described in Task 92 of this scope. Deliverables: -Five (5)copies of the draft Stormwater TIR for ClTY review and comment submitted in hard copy form and delivered by US Mail as part of the 60%submittal. Task 10 —Supplemental Survey and Basemapping l7 File location.Y ‘Conlroci Admimsnoixon Convrccvs‘~RenionPark Ave N Exi Scope 60‘:Dcsngn_4~30-l8.doc AGENDA ITEM #6. g) PARK AVENUE N EXTENSION—FINALDESlGN PHASE Agreement with Perieet lnc.APT”30.Zola The proposed work for supplemental surveying and basemapping services will be conducted by 1 Alliance Geomatics (1AG)as a SUBCONSULTANT to the CONSULTANT and include the following tasks: 10.1 Supplemental Survey and Basemapping 1AG will conduct potholing of existing utilities at up to six (6)locations,which may conflict with proposed drainage facilities identified in preliminary design.1AG will prepare field survey the pothole locations to determine the location of utility conflicts for both horizontal and vertical position.The CONSULTANT will incorporate field survey data collected into the basemap for the final engineering phase of the project. Deliverables: 0 Incorporate supplemental utility conflict survey information into project basemaps for use in project design. Task 11 —Structural Design of Pole Foundations The proposed work for Structural design services will be conducted by Chudgar Engineering Company (CHUDGAR)as a SUBCONSULTANTto the CONSULTANT and include the following tasks: 11.1 Foundation Type Options The SUBCONSULTANTwill review design drawings for illumination and signals,geotechnical report,and project criteria.The SUBCONSULTANTwill evaluate feasibility of foundation types: deep foundation (shaft)and shallow foundation (pad footing).Concerns of encountering groundwater and caving of excavation walls during construction is based on previous similar work,and will be considered in feasibility. 11.2 Luminaire Pole Foundations The SUBCONSULTANTwill design foundations for two (2)types of luminaire poles:one (1)for roadway—scale lighting and one (1)for pedestrian—sca|e lighting.The SUBCONSULTANTwill review the Geotechnical Report (See Task 5),evaluate the feasibility of using either a shaft or pad footing,and recommend a design to the CONSULTANTfor review and the CITYfor review and concurrence.if the CITYselects a shaft foundation type isselected,CHUDGAR’sapproach will be to develop a design similar to foundations shown on WSDOT Standard Plan,Signal Standard Foundation Plan (J—26.10-O2).Both round and square foundation sections that include a base plate and anchor bolts. Develop drawings and details for luminaire pole foundations.The drawings and details will be adapted from WSDOT Standard Plan,Steel Light Standard Foundation (J—28.30~O3). l8 FllElOCG7lOF\'V Ccnlrocl Admimsnciion Comimcts Renian PovtAvu N En Srcpe 60‘:Design,4~30-i8.dcc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGN PHASE Agreemenl with Perieel lnc.April30.2Ol8 11.3 BNSF Railroad Gate Foundations The SUBCONSULTANT will design foundations for BNSF railroad gates based on a review of the Geotechnical Report (See Task 5).The SUBCONSULTANT will evaluate the feasibility of using either a shaft or pad footing,and recommend a design to the CONSULTANT for review and to the CITYfor review and concurrence.If the CITYselects a shaft foundation,the approach will be to develop a design used on similar BNSF railroad crossings.The SUBCONSULTANT will design both round and square foundation sections that include a base plate and anchor bolts. The SUBCONSULTANT will develop drawings and details for BNSF railroad gate foundations. 11.4 Signal Pole Foundations The SUBCONSULTANT will review proposed plans prepared by the CONSULTANT for signal poles with signs and luminaires,and verify the adequacy of WSDOT standards for their design in relation to the recommendations in the Geotechnical Report (See Task 5).The SUBCONSULTANT assumes that poor soil conditions and a high water table are two (2)factors to be considered in this evaluation. All foundation calculations and drawings will be stamped and signed by a registered structural engineer licensed in State of Washington. Deliverablesz 0 Foundation plans and details for poles described above.Foundation drawings will be cross~referenced in the Illumination Plans and Details (See Task 7.9)and the Traffic Signal Plans (See Task 7.10)to denote site—specificbackground information.Separate foundation plans along roadway alignment will not be developed. 0 Supporting design calculations for poles described above. Task 12 —Boeing Electrical Duct Bank Modifications 12.1 30%Design Plans and Opinion of Cost The proposed work for BOEING electrical duct bank design services will be conducted by Casne Engineering (CASNE)as a SUBCONSULTANT to the CONSULTANT and include the following tasks: The proposed extension of Park Avenue N encompasses an existing manhole used by BOElNG that will need to be relocated outside of the proposed roadway right—of—way.This will require reconfiguration of existing power duct banks connecting to the manhole.The duct banks originate in the power substation located just east of the extension of Park Avenue N and lead 19 Filelocation:Y Coiiii:i:iAdrninisvro1ior.Conivocls Roiiioii Pan Ave N Ext Scope 60‘:D£’<lqr‘i,4'.7)O‘l8 doc AGENDA ITEM #6. g) PARKAVENUEN EXTENSION~FINALDESIGN PHASE Agreement with Perleet lnc.AP'll30v2Ol8 into the BOEING Renton plant.The approximate location of the existing manhole and the related duct banks are illustrated in Figure 2. CASNE will develop thirty percent (30%)preliminary plans for relocation of the manhole and the related duct banks and submit to CITYstaff and BOEING for review and approval.CASNE will design the new manhole and duct bank system any proposed splices will be at the location of existing electrical system splices,ie.at the completion of the relocation there will be no more splices in the electrical system running from the electrical substation into the Boeing plant than exist in the current electrical system today. In order to develop the thirty percent (30%)plans,CASNE will prepare ten percent (10%) conceptual plans of the proposed relocated manhole and associated duct bank work and submit to CITYstaff and BOEING for review and approval before proceeding to development of thirty percent (30%)plans.Drawings will be created to meet BOEING Standard CAD files. CASNE assumes that the ten percent (10%)conceptual plans for the relocated manhole and associated duct bank will fit on two (2)"base sheets”,utilizing 11"by 17”sheets at 1"=40’ scale. 20 Filelocation Y \ConIrocI Admrmstrunon\Conrmcis\Ramon‘Pork Ave N Exl Scope 60’;Design,/I—30—I8.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSlON—FlNALDESlGN PHASE Agreement with Perteei lnc.April30,20l8 CASNEassumes that the thirty percent (30%)preliminary plans for the relocated manhole and associated duct bank will fit on eight (8)sheets,utilizing 11"by 17”sheets.Drawings shall be created to meet BOEING Standard CAD files. CASNE will prepare an opinion of cost for the relocated manhole,related duct bank system,and associated electrical wiring work and submit the cost with the thirty percent (30%)plans. Deliverables: 0 Five (5)copies of the 10%BOEING Duct System conceptual plans (half size,l”=40’scale) submitted in hard copy and delivered by US Mail. 0 Five (5)copies of the 30%BOEING Duct System plans (half size,l”=40’scale)and Opinion of Cost Estimate submitted in hard copy form and delivered by US Mail. 12.2 60%Design Plans and Opinion of Cost CASNEwill advance the thirty percent (30%)plans for the relocated electrical manhole and associated duct bank to a sixty percent (60%)design stage,including the following elements: -Plan view of proposed relocated manhole,associated duct bank,and BOEING electrical drawings that will fit on thirty six (36)sheets,utilizing 11"x 17"sheets at l”=40'scale. The plan view will include station and offset to the manhole and any points where the duct bank changes direction.The design will include BOEING electrical drawings that will be required by Boeing to be updated for record electrical drawings.The design shall include electrical removal drawings for Boeing to verify the scope ofthe duct bank work. Drawings shall be created to meet BOEING Standard CAD files. 0 Profile view of the proposed relocated manhole and associated duct bank at a horizontal scale of 1”=40’and a vertical scale of 1"=10’when plotted on 11”x 17" sheets. 0 Electrical wiring diagram illustrating the proposed electrical system inside the new duct bank system. I 60%Opinion of Cost Estimate to be submitted with the sixty percent (60%)plans. Deliverables: 0 Five (5)copies ofthe 60°a BOEING Duct System plans (half size,l”=40’scale)and Opinion of Cost Estimate submitted in hard copy form and delivered by US Mail. Assumptions: I No ductbank profiles or wiring diagrams will be developed for the thirty percent (30%) submittal. 0 The limits of new duct bank work will not extend more than 400—feetin either direction of the existing manhole that is to be relocated. 2l File locumn Y \Cormacl Aclmirusivmion Cannons‘Renlovfpork Ave N Ex!Srnpc 60::DESlgl‘i_4'.7)O'l8doc AGENDA ITEM #6. g) PARK AVENUE N EXTENSION—FINALDESIGN PHASE Agreement with Perleel Inc.APHI50.2018 Task 13 —Management Reserve Additional services may be performed by the CONSULTANT at the request ofthe CITY,but only after written authorization has been given by the CITYdefining the Scope of Services to be performed. Items to Be Prepared and/or Furnished by the Consultant See deliverables under each task. Items to be Furnished by the City I Meeting rooms for public meetings. 0 The CITYwill be responsible for the printing,postage,and mailing of information to the community. I The CITYwill advertise the project for construction. I The CITYwill print and distribute construction documents to plan hold centers and prospective bidders. DESIGN CRITERIA The CITYwill work with the CONSULTANT to develop the basic premises and criteria for the design.Reports and plans,to the extent feasible,will be developed in accordance with the latest edition and amendments of the following: 1.AASHTO 2010,”A Policy of Geometric Design of Highways and Streets.” WSDOT,"Standard Specifications for Road and Bridge Construction.” WSDOT,"Design Manual.” WSDOT,"Materials Laboratory Outline.” WSDOT,"Construction Manual." WSDOT,"Local Agency Guidelines.” Highway Research Board's Manual entitled ”Highway Capacity.” FHWA and WSDOT,”Manual on Uniform Traffic Control Devices for Streets and Highways.” .°°.\‘.°‘.V‘.4>E“!" 9.Standard drawings prepared by City of Renton and furnished to the Consultant will be used as a guide in all cases where they fit design conditions and where no City of Renton standard drawings are applicable;WSDOT Standard Plans will be used as a default. 10.AASHTO "Guide for the Development of Bicycle Facilities.” 11.AASHTO 1993 ”Guide for the Design of Pavement Structures.” 12.WSDOT Highway Runoff Manual. 13.WSDOT Hydraulics Manual. 22 Filelocollon Y ‘\Ccnnocv Admmislvohon\Comrucvs~Renion Park Ave N Ext Scope 60°:Dcsign_4-30-l8.doc AGENDA ITEM #6. g) PARKAVENUE N EXTENSION—FINALDESIGNPHASE Agreement with Perleel Inc.April30,2OI8 14.King County Surface Water Design Manual. 15.2012 Department of Ecology Stormwater Management Manual for Western Washington. 16.City of Renton Municipal Code. 23 File IOCONOH.Y ‘Contract Adrnmisivcmor?Cannons‘Renion‘Povk Ave N Ex!Scope 60":D-2sign_4»30-i8.doc AGENDA ITEM #6. g) ;PERTEET EXHIBIT 4-D P101001 000010 »P0n1Av0N 5111011111111-0091.0001911 001101101510110010 5121/2010 Lasl Updula 0010 41270010 Cn0111 Cky 0|1101111111 00111101:5110000:050/2010 0.11001Pmjm N0.20100200002 PM P010100 00101 00111101:1301011011;4 M01101: Pnndpal 51.2110111001Lam:2110111001111011911100111511011100111Land Accoununl 01.111211 T0L3I Labor 13011.1: IMnr 5110010011 10011111010111 Hum: M01 001191101 Tm B,,,,,,wM,503.17 551.00 545.00 535.59 531.00 531.95 030.75 $35.00 $20.30 Pmjoci M011umm11 00111001.:P101ec1M0r1.3gemen1 24 00 20 00 4.00 10.00 53 350.00 0000011.Schedule Ovcmqhl -1.00 .100 $32100 1-/011Plan 2 00 4.00 5 00 5111.00 Plo12clCoum1na|10I1 Meenngs I6 00 24.00 0.00 40 00 $2,059.00 04/ac Program 12 00 12 00 5900 00 Tmal P101911Mlnauetnerl 50.00 40.00 0.00 0.00 0.00 0.00 0.00 4.00 0.00 110.00 50,057.00 Agmquwe p..,,.n,om...cm;5 12.00 10 00 0.00 30.00 32 210.00 Planning 10111144010.7/LnrnoPmoony (M101 coom 12.00 10.00 0.00 0.00 0.00 0.00 0.00 0.00 5.00 30.00 $2210.00 0 0101011110 1>u011c|r1v0NsrnanI ramgmm Cu11nc1lEm:f1ng 4.00 4 00 53:1300 Pro1eClWEDS?e 300 300 4 00 15.00 551500 r.m1p..uc1..m...w.1 Pmgmm 4.00 2.00 0.00 0.00 0.00 0.00 4.00 0.00 0.00 10.00 5040.00 Rlghl-0!-Way Acqnlsuon R1qnX-cl-Way Plans 2.00 8 00 32 00 32 00 74 00 S2 970 D0 |.0g;1lDesc1111110r1s 2 00 -000 5.00 $411.00 1:1,,11m1.w.1y1100015111011 1100 .10 00 40.00 53 100 00 1010101901-o1.w0y;0:qu1a1o«1 12.00 52.00 0.00 32.00 0.00 0.00 32.00 0.00 0.00 120.00 30,400. Gem0c!1nIu0l51101110011110Samoa:1 00 0 00 7.00 1450.00 T01alBoo1nd\11lulEnuh1ur1nvSuvlcu 1.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 7.00 $450.00 2101101.11:1.110Esdmma 30-‘.Plans 20 00 50 00 30 00 132 00 112 00 304 00 515102.00. 3001.Omnmn010051 0.00 12 00 32.00 12.00 04.00 52 539 00* T0'1aI30%Flam and 50:11».20.00 04.00 40.00 154.00 12.00 0.00 112.00 0.00 0.00 420.00 510.711. 0090 Plans 0110Esmum 00%00511111 001.01011:22 00 1-1 00 70.00 200 00 300.00 7.1000 020520.00 001.0p1111011olC:1s1 1.00 0.00 24.00 10 00 52 00 51054.00 Total 001;Phm -101Estlnuu 22.00 40.00 70.00 320.00 10.00 0.00 300.00 0.00 0.00 702.00 $31,474.00 01011011150uunuusReview -1111Coomlnallon 2 00 10.00 30.00 40.00 52.05000 T01alF1Ind1|u0 [M1100 Run and 2.00 10.00 0.00 30.00 0.00 0.00 0.00 0.00 0.00 40.00 52050. 00010111011011 5101111100101RBPOII 100111.»,Drmnzape Basms 0 00 0.00 10.00 5054.00 Yn1csn0ldAna1ys1s,Wmer Qualwy 60 D0 32 00 0 00 I00 00 $~|.0I6 001 Tlealmcnl.Flaw Conlvol and Conveyance 01011 Smvmwalev Report 0.00 40.00 0.00 4.00 50 00 32,004 00 'nm1s1o111mu1R0001!0.00 0.00 100.00 0.00 0.00 32.00 24.00 0.00 4.00 170.00 07,334.00 s.,,,,,1.mg....1 sum,.1";Bgxgfngpplng 4.00 0.00 0 00 20 00 5112300 T010150091011101001Survey-1111 0.00 4.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 20.00 302:1. 10.101110111111111 511110111111100010110150711011001:100 0 00 12 00 3520.00 Foundations 70101511111.-11110117011170015101101Pale 0.00 4.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 12.00 5529.00 Fou110a0o11s Boeing 51.90111:-100010.1111Modmna?ons 0 00 32 00 32 00 12.00 04 00 54 100.00‘ 101010001110Elucmcul001:0.1111 0.00 32.00 0.00 32.00 0.00 0.00 12.00 0.00 0.00 04.00 $4,109.00 Moammnons BCDNISOS Tot0|Ex0e11sn 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 $0.00 10151110111:147.00 207.00 234.00 000.00 20.00 32.00 500.00 4.00 10.00 1,000.00 Tnlal D-vI|-II $12,220.00 $10,135.00 $10,530.00 321030.00 $000.00 $1,022.00 $10,375.00 $140.00 $305.00 $03,300.00 Expenses:5uh1;z1ns1ma11IFue C051 Mmup 011 CAUU/Cumpumr 4,000 111 am 1201111101105110 0 003 M00092-S545 I01‘CASNE ENGVNEEHINK INC Paslaucam 130110011,30‘cm10g.11 51101111.-211111;Company Remoducllan-Rmmhuvsctl 200'NW/\G00Sc1u11c0s111c rams:5200 10011:: 1 suumnv 011001Salary C1131 501300.00 000111.10C051 103.94 91 $150,222.00 F00 3211 $20,650.00 um s2s3.170.0o Expenses 05203.00 sumnsunanu $123,010.00 connucr mm.$202,300.00 07 0 72o(AswANsaN1—Faga 1 01 1 AGENDA ITEM #6. g) AB - 2153 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Declaration of Emergency for the NE 4th Street and Jefferson Avenue NE Signal Pole Replacement RECOMMENDED ACTION: Council Concur DEPARTMENT: Transportation Systems Division STAFF CONTACT: Eric Cutshall, Transportation Maintenance Manager EXT.: 2601 FISCAL IMPACT SUMMARY: Costs for this work are estimated to be $40,000. Actual repair costs will not be known until the City receives an invoice from the contractor. The Risk Management Division is in the process of filing a claim with the motorist’s insurance company for reimbursement of the repair cost for the damage. Until the cost can be subrogated back to the insurance company of the motorist, the work will be funded thr ough the approved 2018 Transportation Maintenance Section Repairs and Maintenance Property Loss budget 03.000000.016.542.95.48.050. There is sufficient funding in the budget to cover this work. SUMMARY OF ACTION: State law requires that in the event of an emergency when the person designated by the governing body declares an emergency allowing the waiver of competitive bidding requirements, a written finding of the existence of an emergency must be made by the governing body and entered into the record no later than two weeks following the award of the contract. On May 3, 2018 Mayor Law made an emergency declaration so that the competitive bidding laws could be waived to allow an immediate emergency repair of a dam aged signal pole located at the intersection of NE 4th Street and Jefferson Avenue NE. The damage was caused in the early morning hours on Saturday, April 28 when a vehicle struck the pole. The damage was assessed by staff who determined it was necessary to replace it and believed the pole’s condition presented imminent danger to life and property. NE 4th Street is a heavily traveled major arterial and Jefferson Avenue NE serves as a major residential neighborhood connection through the Renton Highlands. The damage to the pole is an unforeseen circumstance beyond the control of the City that presents a real, immediate threat. The work involved under the terms of the contract include all labor, materials and equipment necessary to replace the compromised signal pole. More specific, the scope of work includes, but is not limited to the following items: 1. Disconnect the electrical power to the existing signal pole. 2. Disassemble, and salvage useful components (signal displays, video detection equipment, ped estrian displays, push buttons, Opticom, and street signs to be reused). 3. Dispose of damaged signal pole. 4. Install City supplied signal pole and mast arm. If unable to locate a new signal pole, temporary span wire poles will need to be installed until the new pole is received and installed. 5. Reinstall all salvaged signal components. 6. Connect to the power source and put the signal pole in operation. 7. All traffic control shall follow Washington State Work Zone Traffic Control Plans. AGENDA ITEM #6. h) 8. Removal and replacement of the concrete foundation and bolts securing the signal pole. The City selected Totem Electric of Tacoma, Inc. to perform the emergency repairs. Construction began on April 28, 2018 and was completed on April 29, 2018. Payment to the contractor will be mad e based upon actual costs using the Force Account method as specified in section 1 -09.6 of the APWA/WSDOT Standard Specification for Road, Bridge and Municipal Construction. EXHIBITS: A. PHOTO OF DAMAGE B. RESOLUTION STAFF RECOMMENDATION: Adopt a resolution declaring an emergency for the purpose of replacing a damaged signal pole located at the intersection of NE 4th Street and Jefferson Avenue NE. AGENDA ITEM #6. h) AGENDA ITEM #6. h) CITYOF RENTON,WASHINGTON RESOLUTIONNO. A RESOLUTION OF THE CITY OF RENTON,WASHINGTON,DECLARING AN EMERGENCYFOR THE PURPOSES OF REPLACING/REPAIRINGATRAFFIC SIGNAL POLE. WHEREAS,the City of Renton owns,operates and maintains the traffic signal pole on NE 4"‘Street and Jefferson Avenue NE in the City of Renton;and WHEREAS,on or about April 28,2018,the traffic signal pole was struck by a vehicle,and heavily damaged and in need of an immediate repair/replacement;if immediate action was not taken,it may result in further material loss or damage to property,bodily injury or loss of life; and WHEREAS,on May 3,2018,the Mayor declared an emergency,attached hereto as Exhibit A,pursuant to the provisions of RCW 39.04.280 and Renton Policy and Procedure Manual 250- 02,paragraph 6.10.3,to authorize Gregg Zimmerman,Public Works Administrator,to waive competitive bidding requirements and to award all necessary contracts to address the emergency for the repair/replacement of said signal pole; NOW,THEREFORE,THE CITY COUNCIL OF THE CITY OF RENTON,WASHINGTON,DO RESOLVEAS FOLLOWS: SECTIONI.The above recitals are adopted as findings. SECTION II.An emergency did exist at the time of the declaration of emergency by Mayor Denis Law.By these written recitals and findings,'the City Council does hereby ratify and approve the Mayor's emergency declaration,attached hereto as Exhibit A,to waive competitive bidding AGENDA ITEM #6. h) RESOLUTIONNO. requirements and to award all necessary contracts to address the emergency for the repair of the aforesaid signal pole on NE 4th Street and Jefferson Avenue NE. PASSED BYTHE CITYCOUNCILthis day of ,2018. Jason A.Seth,City Clerk APPROVED BYTHE MAYOR this day of ,2018. Denis Law,Mayor Approved as to form: Shane Moloney,City Attorney Date of Publication: RES:1770:5/3/l8:scr AGENDA ITEM #6. h) RESOLUTIONNO. EXHIBITA DECLARATIONOF EMERGENCY AGENDA ITEM #6. h) RESOLUTION NO. EXECUTIVEDEPARTMENT MEMORANDUM DATE:May 3,2018 T0:Gregg Zimmerman,Public Works Administrator FROM:Denis Law,Mayor mf SUBJECT:Declaration of Emergency for Damaged Signal Pole Located at NE 4”‘Street and Jefferson Avenue NE On Saturday,April 28,2018 at approximately 12:30 a.m.the Transportation Maintenance staff member on call was noti?ed that a traffic signal pole located on the northwest corner of NE 4"‘Street and Jefferson Avenue NE was struck by a vehicle and knocked over.if immediate action had not been taken it could have resulted in further loss or damage to property,bodily injury or loss of life.The on-call staff member noti?ed the Transportation Maintenance Manager who identified this as an emergency situation and identi?ed a contractor to replace the signal pole.The traffic signal was back in operation on April 29,2018 by approximately 5:00 p.m.However,the anchor bolts on the existing signal pole foundation have been damaged.To accomplish a full and safe repair,the signal pole and foundation need to be replaced. Therefore,1,Denis Law,Mayor of the City of Renton,declare an emergency pursuant to the provisions of RCW 39.04.280 and Renton Policy and Procedure 250-02,paragraph 6.10,and authorize Gregg Zimmerman,Public Works Administrator,to waive competitive bidding requirements and award all necessary contracts on behalf of the City of Renton to address the emergency situation.in emergency situations,RCW 39.04.280 requires that a written finding of the existence of an emergency be made and entered into the public record no later than two weeks following the award of the contract. New 5%? Denis Law Date Mayor cc:Renton City Council Bob Harrison,ChiefAdministrative Officer Jan i-lawn,Administrative Services Department Administrator Shane Moloney,City Attorney Jim Seitz,Transportation Systems Director Jason Seth,City Clerk Chris Barnes,Transportation Operations Manager Eric Cutshall,Transportation Maintenance Manager AGENDA ITEM #6. h) AB - 2147 City Council Regular Meeting - 14 May 2018 SUBJECT/TITLE: Agreement with Watershed Science and Engineering, Inc. for the Madsen Creek Improvement Project Phase 1, Surveying, Hydraulic Analysis and Preliminary Design RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: Utility Systems Division STAFF CONTACT: Joseph Farah, Surface Water Utility Engineer EXT.: 7205 FISCAL IMPACT SUMMARY: The Madsen Creek Improvement Project Phase 1 (427.475512) is funded by the King County Flo od Control District Flood Reduction Grant, Award Number 4.17.10 (CAG -17-211) in the amount of $472,000. The adjusted 2018 project budget is $519,132. There is sufficient funding in the 2018 Surface Water Utility Capital Improvement Program budget for this agreement. SUMMARY OF ACTION: Flooding is a recurring problem in the bottom part of the Madsen Creek drainage basin. Flooding occurs from the Madsen Creek Sediment Basin to SR-169, along the channels roadside of SR-169, 149th Avenue SE and the channel through Ron Regis Park. The City was awarded a flood reduction grant by the King County Flood Control District for the Madsen Creek Improvement Project Phase 1. The grant agreement was approved by the Council on November 6, 2017 and executed on December 1, 2017. The first phase of the project includes surveying, hydrologic and hydraulic analysis and environmental analysis to better understand and assess the causes of the flooding problems. It also includes the identification of short-term and long-term solutions to alleviate the risk of flooding in the affected areas, and the preliminary design of the preferred solution. Future phases of the project will include final design, permitting and the construction of drainage improvements. The Surface Water Utility solicited proposals from consultants in accordance with City policy 250-02. All proposals were evaluated and three consultant firms were selected for interviews. Watershed Science and Engineering, Inc. ranked the highest and was selected to perform the Phase 1 work. EXHIBITS: A. Agreement STAFF RECOMMENDATION: Execute the agreement with Watershed Science and Engineering, Inc. in the amount of $466,098 for surveying, hydraulic analysis and preliminary design for the Madsen Creek Improvement Project Phase 1. AGENDA ITEM #6. i) THISAGREEMENT,datedMay1,2018,isbyandbetweentheCityofRenton(the“City”),aWashingtonmunicipalcorporation,andWatershedScienceandEngineering(“Consultant”),aWashingtonCorporation.TheCityandtheConsultantarereferredtocollectivelyinthisAgreementasthe“Parties.”OncefullyexecutedbytheParties,thisAgreementiseffectiveasofthelastdatesignedbybothparties.1.ScopeofWork:Consultantagreestoprovidesurveying,hydrologicandhydraulicmodeling,andpreliminarydesignasspecifiedinExhibitA,whichisattachedandincorporatedhereinandmayhereinafterbereferredtoasthe“Work.”2.ChangesinScopeofWork:TheCity,withoutinvalidatingthisAgreement,mayorderchangestotheWorkconsistingofadditions,deletionsormodifications.AnysuchchangestotheWorkshallbeorderedbytheCityinwritingandtheCompensationshallbeequitablyadjustedconsistentwiththeratessetforthinExhibitBorasotherwisemutuallyagreedbytheParties.3.TimeofPerformance:ConsultantshallcommenceperformanceoftheAgreementpursuanttotheschedule(s)setforthinExhibitC.AllWorkshallbeperformedbynolaterthanApril30,20204.Compensation:A.Amount.TotalcompensationtoConsultantforWorkprovidedpursuanttothisAgreementshallnotexceed$466,098,plusanyapplicablestateandlocalsalestaxes.CompensationshallbepaidasaflatratefixedsumbaseduponWorkactuallyperformedaccordingtotherate(s)oramountsspecifiedinExhibitB.TheConsultantagreesthatanyhourlyorflatratechargedbyitforitsWorkshallremainlockedatthenegotiatedrate(s)unlessotherwiseagreedtoinwritingorprovidedinExhibitB.Exceptasspecificallyprovidedherein,theConsultantshallbesolelyresponsibleforpaymentofanytaxesimposedasaresultoftheperformanceandpaymentofthisAgreement.AGREEMENTFORMADSENCREEKIMPROVEMENTPROJECTPHASE1,SURVEYING,HYDRAULICANALYSIS,ANDPRELIMINARYDESIGNAGENDA ITEM #6. i) B.MethodofPayment.OnamonthlyornolessthanquarterlybasisduringanyquarterinwhichWorkisperformed,theConsultantshallsubmitavoucherorinvoiceinaformspecifiedbytheCity,includingadescriptionofwhatWorkhasbeenperformed,thenameofthepersonnelperformingsuchWork,andanyhourlylaborchargerateforsuchpersonnel.TheConsultantshallalsosubmitafinalbilluponcompletionofallWork.PaymentshallbemadebytheCityforWorkperformedwithinthirty(30)calendardaysafterreceiptandapprovalbytheappropriateCityrepresentativeofthevoucherorinvoice.IftheConsultant’sperformancedoesnotmeettherequirementsofthisAgreement,theConsultantwillcorrectormodifyitsperformancetocomplywiththeAgreement.TheCitymaywithholdpaymentforworkthatdoesnotmeettherequirementsofthisAgreement.C.EffectofPayment.PaymentforanypartoftheWorkshallnotconstituteawaiverbytheCityofanyremediesitmayhaveagainsttheConsultantforfailureoftheConsultanttoperformtheWorkorforanybreachofthisAgreementbytheConsultant.D.Non-AppropriationofFunds.IfsufficientfundsarenotappropriatedorallocatedforpaymentunderthisAgreementforanyfuturefiscalperiod,theCityshallnotbeobligatedtomakepaymentsforWorkoramountsincurredaftertheendofthecurrentfiscalperiod,andthisAgreementwillterminateuponthecompletionofallremainingWorkforwhichfundsareallocated.NopenaltyorexpenseshallaccruetotheCityintheeventthisprovisionapplies.5.Termination:A.TheCityreservestherighttoterminatethisAgreementatanytime,withorwithoutcausebygivingten(10)calendardays’noticetotheConsultantinwriting.Intheeventofsuchterminationorsuspension,allfinishedorunfinisheddocuments,data,studies,worksheets,modelsandreports,orothermaterialpreparedbytheConsultantpursuanttothisAgreementshallbesubmittedtotheCity,ifanyarerequiredaspartoftheWork.B.IntheeventthisAgreementisterminatedbytheCity,theConsultantshallbeentitledtopaymentforallhoursworkedtotheeffectivedateoftermination,lessallpaymentspreviouslymade.IftheAgreementisterminatedbytheCityafterpartialperformanceofWorkforwhichtheagreedcompensationisafixedfee,theCityshallpaytheConsultantanequitableshareofthefixedfee.ThisprovisionshallnotpreventtheCityfromseekinganylegalremediesitmayhavefortheviolationornonperformanceofanyoftheprovisionsofthisAgreementandsuchchargesduetotheCityshallbedeductedfromthefinalpaymentduetheConsultant.NopaymentshallbemadebytheCityforanyexpensesincurredorworkdonefollowingtheeffectivedateofterminationunlessauthorizedinadvanceinwritingbytheCity.0PAGE2OF10AGENDA ITEM #6. i) 6.WarrantiesAndRightToUseWorkProduct:ConsultantrepresentsandwarrantsthatConsultantwillperformallWorkidentifiedinthisAgreementinaprofessionalandworkmanlikemannerandinaccordancewithallreasonableandprofessionalstandardsandlaws.Compliancewithprofessionalstandardsincludes,asapplicable,performingtheWorkincompliancewithapplicableCitystandardsorguidelines(e.g.designcriteriaandStandardPlansforRoad,BridgeandMunicipalConstruction).Professionalengineersshallcertifyengineeringplans,specifications,plats,andreports,asapplicable,pursuanttoRCW18.43.070.ConsultantfurtherrepresentsandwarrantsthatallfinalworkproductcreatedforanddeliveredtotheCitypursuanttothisAgreementshallbetheoriginalworkoftheConsultantandfreefromanyintellectualpropertyencumbrancewhichwouldrestricttheCityfromusingtheworkproduct.ConsultantgrantstotheCityanon-exclusive,perpetualrightandlicensetouse,reproduce,distribute,adapt,modify,anddisplayallfinalworkproductproducedpursuanttothisAgreement.TheCity’sorother’sadaptation,modificationoruseofthefinalworkproductsotherthanforthepurposesofthisAgreementshallbewithoutliabilitytotheConsultant.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.7.RecordMaintenance:TheConsultantshallmaintainaccountsandrecords,whichproperlyreflectalldirectandindirectcostsexpendedandWorkprovidedintheperformanceofthisAgreementandretainsuchrecordsforaslongasmayberequiredbyapplicableWashingtonStaterecordsretentionlaws,butinanyeventnolessthansixyearsaftertheterminationofthisAgreement.TheConsultantagreestoprovideaccesstoandcopiesofanyrecordsrelatedtothisAgreementasrequiredbytheCitytoauditexpendituresandchargesand/ortocomplywiththeWashingtonStatePublicRecordsAct(Chapter42.56RCW).TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.8.PublicRecordsCompliance:TothefullextenttheCitydeterminesnecessarytocomplywiththeWashingtonStatePublicRecordsAct,ConsultantshallmakeaduediligentsearchofallrecordsinitspossessionorcontrolrelatingtothisAgreementandtheWork,including,butnotlimitedto,e-mail,correspondence,notes,savedtelephonemessages,recordings,photos,ordrawingsandprovidethemtotheCityforproduction.IntheeventConsultantbelievessaidrecordsneedtobe’protectedfromdisclosure,itmay,atConsultant’sownexpense,seekjudicialprotection.Consultantshallindemnify,defend,andholdharmlesstheCityforallcosts,includingattorneys’fees,attendanttoanyclaimorlitigationrelatedtoaPublicRecordsActrequestforwhichConsultanthasresponsiverecordsandforwhichConsultanthaswithheldrecordsorinformationcontainedtherein,ornotprovidedthemtotheCityinatimelymanner.ConsultantshallproducefordistributionanyandallrecordsresponsivetothePublicRecordsActrequestinatimelymanner,unlessthoserecordsareprotectedbycourtorder.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.oPAGE3OF10AGENDA ITEM #6. i) 9.IndependentContractorRelationship:A.TheConsultantisretainedbytheCityonlyforthepurposesandtotheextentsetforthinthisAgreement.ThenatureoftherelationshipbetweentheConsultantandtheCityduringtheperiodoftheWorkshallbethatofanindependentcontractor,notemployee.TheConsultant,nottheCity,shallhavethepowertocontrolanddirectthedetails,mannerormeansofWork.Specifically,butnotbymeansoflimitation,theConsultantshallhavenoobligationtoworkanyparticularhoursorparticularschedule,unlessotherwiseindicatedintheScopeofWorkorwhereschedulingofattendanceorperformanceismutuallyarrangedduetothenatureoftheWork.ConsultantshallretaintherighttodesignatethemeansofperformingtheWorkcoveredbythisagreement,andtheConsultantshallbeentitledtoemployotherworkersatsuchcompensationandsuchotherconditionsasitmaydeemproper,provided,however,thatanycontractsomadebytheConsultantistobepaidbyitalone,andthatemployingsuchworkers,itisactingindividuallyandnotasanagentfortheCity.B.TheCityshallnotberesponsibleforwithholdingorotherwisedeductingfederalincometaxorSocialSecurityorcontributingtotheStateIndustrialInsuranceProgram,orotherwiseassumingthedutiesofanemployerwithrespecttoConsultantoranyemployeeoftheConsultant.C.IftheConsultantisasoleproprietorshiporifthisAgreementiswithanindividual,theConsultantagreestonotifytheCityandcompleteanyrequiredformiftheConsultantretiredunderaStateofWashingtonretirementsystemandagreestoindemnifyanylossestheCitymaysustainthroughtheConsultant’sfailuretodoso.10.HoldHarmless:TheConsultantagreestorelease,indemnify,defend,andholdharmlesstheCity,electedofficials,employees,officers,representatives,andvolunteersfromanyandallclaims,demands,actions,suits,causesofaction,arbitrations,mediations,proceedings,judgments,awards,injuries,damages,liabilities,taxes,losses,fines,fees,penalties,expenses,attorney’sorattorneys’fees,costs,and/orlitigationexpensestoorbyanyandallpersonsorentities,arisingfrom,resultingfrom,orrelatedtothenegligentacts,errorsoromissionsoftheConsultantinitsperformanceofthisAgreementorabreachofthisAgreementbyConsultant,exceptforthatportionoftheclaimscausedbytheCity’ssolenegligence.ShouldacourtofcompetentjurisdictiondeterminethatthisagreementissubjecttoRCW4.24.115,(Validityofagreementtoindemnifyagainstliabilityfornegligencerelativetoconstruction,alteration,improvement,etc.,ofstructureorimprovementattachedtorealestate...)then,intheeventofliabilityfordamagesarisingoutofbodilyinjurytopersonsordamagestopropertycausedbyorresultingfromtheconcurrentnegligenceoftheoPAGE4or10AGENDA ITEM #6. i) ConsultantandtheCity,itsofficers,officials,employeesandvolunteers,Consultant’sliabilityshallbeonlytotheextentofConsultant’snegligence.ItisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedinthisAgreementconstituteConsultant’swaiverofimmunityundertheIndustrialInsuranceAct,RCWTitle51,solelyforthepurposesofthisindemnification.ThePartieshavemutuallynegotiatedandagreedtothiswaiver.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.11.GiftsandConflicts:TheCity’sCodeofEthicsandWashingtonStatelawprohibitCityemployeesfromsoliciting,accepting,orreceivinganygift,gratuityorfavorfromanyperson,firmorcorporationinvolvedinacontractortransaction.ToensurecompliancewiththeCity’sCodeofEthicsandstatelaw,theConsultantshallnotgiveagiftofanykindtoCityemployeesorofficials.ConsultantalsoconfirmsthatConsultantdoesnothaveabusinessinterestoraclosefamilyrelationshipwithanyCityofficeroremployeewhowas,is,orwillbeinvolvedinselectingtheConsultant,negotiatingoradministeringthisAgreement,orevaluatingtheConsultant’sperformanceoftheWork.12.CityofRentonBusinessLicense:TheConsultantshallobtainaCityofRentonBusinessLicensepriortoperforminganyWorkandmaintainthebusinesslicenseingoodstandingthroughoutthetermofthisagreementwiththeCity.Informationregardingacquiringacitybusinesslicensecanbefoundat:http://www.rentonwa.gov/cms/One.aspx?portalld=7922741&pageld=9824882InformationregardingStatebusinesslicensingrequirementscanbefoundat:http://dor.wa.gov/doing-business/register-my-business13.Insurance:Consultantshallsecureandmaintain:A.Commercialgeneralliabilityinsuranceintheminimumamountsof$1,000,000foreachoccurrence/$2,000,000aggregatefortheTermofthisAgreement.B.IntheeventthatWorkdeliveredpursuanttothisAgreementeitherdirectlyorindirectlyinvolveorrequireProfessionalServices,ProfessionalLiability,ErrorsandOmissionscoverageshallbeprovidedwithminimumlimitsof$1,000,000peroccurrence.“ProfessionalServices”,forthepurposeofthissection,shallmeananyWorkprovidedbyalicensedprofessionalorWorkthatrequiresaprofessionalstandardofcare.C.Workers’compensationcoverage,asrequiredbytheIndustrialInsurancelawsoftheStateofWashington,shallalsobesecured.0PAGE5OF10AGENDA ITEM #6. i) D.CommercialAutomobileLiabilityforowned,leased,hiredornon-owned,leased,hiredornon-owned,withminimumlimitsof$1,000,000peroccurrencecombinedsinglelimit,iftherewillbeanyuseofConsultant’svehiclesontheCity’sPremisesbyoronbehalfoftheCity,beyondnormalcommutes.E.ConsultantshallnametheCityasanAdditionalInsuredonitscommercialgeneralliabilitypolicyonanon-contributoryprimarybasis.TheCity’sinsurancepoliciesshallnotbeasourceforpaymentofanyConsultantliability,norshallthemaintenanceofanyinsurancerequiredbythisAgreementbeconstruedtolimittheliabilityofConsultanttothecoverageprovidedbysuchinsuranceorotherwiselimittheCity’srecoursetoanyremedyavailableatlaworinequity.F.SubjecttotheCity’sreviewandacceptance,acertificateofinsuranceshowingtheproperendorsements,shallbedeliveredtotheCitybeforeperformingtheWork.G.ConsultantshallprovidetheCitywithwrittennoticeofanypolicycancellation,withintwo(2)businessdaysoftheirreceiptofsuchnotice.14.Delays:ConsultantisnotresponsiblefordelayscausedbyfactorsbeyondtheConsultant’sreasonablecontrol.WhensuchdelaysbeyondtheConsultant’sreasonablecontroloccur,theCityagreestheConsultantisnotresponsiblefordamages,norshalltheConsultantbedeemedtobeindefaultoftheAgreement.15.SuccessorsandAssigns:NeithertheCitynortheConsultantshallassign,transferorencumberanyrights,dutiesorinterestsaccruingfromthisAgreementwithoutthewrittenconsentoftheother.16.Notices:AnynoticerequiredunderthisAgreementwillbeinwriting,addressedtotheappropriatepartyattheaddresswhichappearsbelow(asmodifiedinwritingfromtimetotimebysuchparty),andgivenpersonally,byregisteredorcertifiedmail,returnreceiptrequested,byfacsimileorbynationallyrecognizedovernightcourierservice.Timeperiodfornoticesshallbedeemedtohavecommenceduponthedateofreceipt,EXCEPTfacsimiledeliverywillbedeemedtohavecommencedonthefirstbusinessdayfollowingtransmission.EmailandtelephonemaybeusedforpurposesofadministeringtheAgreement,butshouldnotbeusedtogiveanyformalnoticerequiredbytheAgreement.CITYOFRENTONCONSULTANTJosephFarahJeffJohnson1055SouthGradyWay5062ndAye,Suite2700Renton,WA98057Seattle,WA98104Phone:(425)430-7205Phone:(206)521-30000PAGE6OF10AGENDA ITEM #6. i) jfarah@rentonwa.govjeff@watershedse.comFax:(425)430-7241Fax:(206)521-300117.DiscriminationProhibited:Excepttotheextentpermittedbyabonafideoccupationalqualification,theConsultantagreesasfollows:A.Consultant,andConsultant’sagents,employees,representatives,andvolunteerswithregardtotheWorkperformedortobeperformedunderthisAgreement,shallnotdiscriminateonthebasisofrace,color,sex,religion,nationality,creed,maritalstatus,sexualorientationorpreference,age(exceptminimumageandretirementprovisions),honorablydischargedveteranormilitarystatus,orthepresenceofanysensory,mentalorphysicalhandicap,unlessbaseduponabonafideoccupationalqualificationinrelationshiptohiringandemployment,inemploymentorapplicationforemployment,theadministrationofthedeliveryofWorkoranyotherbenefitsunderthisAgreement,orprocurementofmaterialsorsupplies.B.TheConsultantwilltakeaffirmativeactiontoinsurethatapplicantsareemployedandthatemployeesaretreatedduringemploymentwithoutregardtotheirrace,creed,color,nationalorigin,sex,age,sexualorientation,physical,sensoryormentalhandicaps,ormaritalstatus.Suchactionshallinclude,butnotbelimitedtothefollowingemployment,upgrading,demotionortransfer,recruitmentorrecruitmentadvertising,layoffortermination,ratesofpayorotherformsofcompensationandselectionfortraining.C.IftheConsultantfailstocomplywithanyofthisAgreement’snon-discriminationprovisions,theCityshallhavetheright,atitsoption,tocanceltheAgreementinwholeorinpart.D.TheConsultantisresponsibletobeawareofandincompliancewithallfederal,stateandlocallawsandregulationsthatmayaffectthesatisfactorycompletionoftheproject,whichincludesbutisnotlimitedtofairlaborlaws,worker’scompensation,andTitleVIoftheFederalCivilRightsActof1964,andwillcomplywithCityofRentonCouncilResolutionNumber4085.18.Miscellaneous:Thepartiesherebyacknowledge:A.TheCityisnotresponsibletotrainorprovidetrainingforConsultant.B.Consultantwillnotbereimbursedforjobrelatedexpensesexcepttotheextentspecificallyagreedwithintheattachedexhibits.C.Consultantshallfurnishalltoolsand/ormaterialsnecessarytoperformtheWorkexcepttotheextentspecificallyagreedwithintheattachedexhibits.0PAGE7OF10AGENDA ITEM #6. i) D.Intheeventspecialtraining,licensing,orcertificationisrequiredforConsultanttoprovideWorkhe/shewillacquireormaintainsuchathis/herownexpenseand,ifConsultantemploys,sub-contracts,orotherwiseassignstheresponsibilitytoperformtheWork,saidemployee/sub-contractor/assigneewillacquireandormaintainsuchtraining,licensing,orcertification.E.Thisisanon-exclusiveagreementandConsultantisfreetoprovidehis/herWorktootherentities,solongasthereisnointerruptionorinterferencewiththeprovisionofWorkcalledforinthisAgreement.F.Consultantisresponsibleforhis/herowninsurance,including,butnotlimitedtohealthinsurance.G.Consultantisresponsibleforhis/herownWorker’sCompensationcoverageaswellasthatforanypersonsemployedbytheConsultant.19.OtherProvisions:A.ApprovalAuthority.EachindividualexecutingthisAgreementonbehalfoftheCityandConsultantrepresentsandwarrantsthatsuchindividualsaredulyauthorizedtoexecuteanddeliverthisAgreementonbehalfoftheCityorConsultant.B.GeneralAdministrationandManagement.TheCity’sprojectmanagerisJosephFarah,SurfaceWaterUtilityEngineer.InprovidingWork,ConsultantshallcoordinatewiththeCity’scontractmanagerorhis/herdesignee.C.AmendmentandModification.ThisAgreementmaybeamendedonlybyaninstrumentinwriting,dulyexecutedbybothParties.D.Conflicts.IntheeventofanyinconsistenciesbetweenConsultantproposalsandthisAgreement,thetermsofthisAgreementshallprevail.Anyexhibits/attachmentstothisAgreementareincorporatedbyreferenceonlytotDeheextentofthepurposeforwhichtheyarereferencedwithinthisAgreement.TotheextentaConsultantpreparedexhibitconflictswiththetermsinthebodyofthisAgreementorcontainstermsthatareextraneoustothepurposeforwhichitisreferenced,thetermsinthebodyofthisAgreementshallprevailandtheextraneoustermsshallnotbeincorporatedherein.E.GoverningLaw.ThisAgreementshallbemadeinandshallbegovernedbyandinterpretedinaccordancewiththelawsoftheStateofWashingtonandtheCityofRenton.ConsultantandalloftheConsultant’semployeesshallperformtheWorkinaccordancewithallapplicablefederal,state,countyandcitylaws,codesandordinances.0PAGE8OF10AGENDA ITEM #6. i) F.JointDraftingEffort.ThisAgreementshallbeconsideredforallpurposesaspreparedbythejointeffortsofthePartiesandshallnotbeconstruedagainstonepartyortheotherasaresultofthepreparation,substitution,submissionorothereventofnegotiation,draftingorexecution.G.JurisdictionandVenue.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.H.Severability.Acourtofcompetentjurisdiction’sdeterminationthatanyprovisionorpartofthisAgreementisillegalorunenforceableshallnotcancelorinvalidatetheremainderofthisAgreement,whichshallremaininfullforceandeffect.SoleandEntireAgreement.ThisAgreementcontainstheentireagreementofthePartiesandanyrepresentationsorunderstandings,whetheroralorwritten,notincorporatedareexcluded.J.TimeisoftheEssence.TimeisoftheessenceofthisAgreementandeachandallofitsprovisionsinwhichperformanceisafactor.AdherencetocompletiondatessetforthinthedescriptionoftheWorkisessentialtotheConsultant’sperformanceofthisAgreement.K.Third-PartyBeneficiaries.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.L.BindingEffect.ThePartieseachbindthemselves,theirpartners,successors,assigns,andlegalrepresentativestotheotherpartytothisAgreement,andtothepartners,successors,assigns,andlegalrepresentativesofsuchotherpartywithrespecttoallcovenantsoftheAgreement.M.Waivers.Allwaiversshallbeinwritingandsignedbythewaivingparty.Eitherparty’sfailuretoenforceanyprovisionofthisAgreementshallnotbeawaiverandshallnotpreventeithertheCityorConsultantfromenforcingthatprovisionoranyotherprovisionofthisAgreementinthefuture.WaiverofbreachofanyprovisionofthisAgreementshallnotbedeemedtobeawaiverofanypriororsubsequentbreachunlessitisexpresslywaivedinwriting.0PAGE9OF10AGENDA ITEM #6. i) N.Counterparts.ThePartiesmayexecutethisAgreementinanynumberofcounterparts,eachofwhichshallconstituteanoriginal,andallofwhichwilltogetherconstitutethisoneAgreement.INWITNESSWHEREOF,thePartieshavevoluntarilyenteredintothisAgreementasofthedatelastsignedbythePartiesbelow.CITYOFRENTONCONSULTANTBy:______________________________By:_________________DenisLawJeffJohnsonMayorPrincipal-in-ChargeDateDateAttestJasonA.SethCityClerkApprovedastoLegalFormShaneMoloneyRentonCityAttorneyContractTemplateUpdated04/10/20180PAGE10OF10AGENDA ITEM #6. i) ExhibitAMadsenCreekImprovementProject-Phase1ScopeofWorkBackgroundThefloodandsedimentdepositionproblemsexperiencedalongMadsenCreekaretypicalofsmallstreamsinreachesoftransitioningchannelslope.MadsenCreekcollectsrunofffromalargeuplandglacialmoraineplateauandthendescends400feetthroughasteephillsideravinebeforeflowingontothefloodplainoftheCedarRiver.Thecreekslopebeginstoflattenasitemergesfromtheravineandflowsacrossasmallalluvialfan,andfurtherflattensasitflowsacrosstheCedarRiverfloodplain.Therapiddecreaseinchannelslopereducesthestream’sabilitytoconveybothwaterandsediment,causingsedimenttodepositwithinthechannel.Toaddresssedimentdepositionandreduceflooding,KingCountyconstructedasedimentcollectionbasinattheoutletoftheravineandahighflowfloodbypasschannelextendingfromthesedimentbasintotheCedarRiver.Thesystemhasperformedrelativelywellsinceitwasinstalledinthe70sorSOs;however,after30to40yearsofuse,theCityhasinitiatedthisprojecttodetermineifmodificationscanbemadetoreduceorsolverecurrentfloodproblematseveralsiteswithinthesystem.Baseduponinitialinspectionofthesystem,reviewofexistingprojectdocuments,anddiscussionswithCitystaff,thefollowingscopeofworkdescribesthetasksthatwillbecompletedbytheconsultantteamtoevaluatetheexistingsystemandtoidentifybothnear-termandlong-termactionstoreduceoreliminateflooding.Fororganizationpurposes,theprojectwillbedividedintotwophases:Phase1willbeanExistingConditionAssessment,andPhase2willincludePreliminaryDesignandAnalysis.liPageAGENDA ITEM #6. i) ProjectAdministrationTask1.ProjectManagementTaskLead:WSEWSEwillberesponsibleforadministrativeactivitiesincludingbutnotlimitedto:CommunicationwiththeCity’sProjectmanagerContractdocumentpreparationandreview,bothforthemasteragreementwiththeCityandsub-consultantagreementswithHerreraandPGS>ProjectbudgetmonitoringandmanagementSchedulemonitoringandmanagement>MonthlyinvoicesthatincludeashortprogresssummarySub-consultantsHerreraandPGSwillperformadministrativeactivitiesrequiredto:1)keepWSEinformedofprogressonallimportantprojectactivities,2)efficientlymanagetheirstaff,and3)submitmonthlyinvoicesthatincludeprogressreports.Assumptions:>CommunicationbetweenconsultantandCitywillgenerallytakeplaceviae-mailandphonecalls.ProgressphonecallsshalltakeplacebetweenWSEandtheCityProjectmanageratregularintervals.Anallowanceisincludedfortwoface-tofaceadministrativemeetingsattheCity,attendedbyWSEandCityprojectmanagers.Deliverables:>Monthlyinvoicesthatincludeashortprogresssummary2(PageAGENDA ITEM #6. i) Part1—DataCollectionandExistingConditionAssessmentTask2.ProjectKick-OffMeetingTaskLead:WSECitystaffandtheconsultantteamwillmeetatCityHalltokick-offtheproject.Themeetingagendawillinclude:>Teammemberintroductions>ProjectoverviewandbackgrounddiscussionDefinitionofprojectgoalsandobjectivesReviewofrolesandresponsibilities,projectschedule,keymilestones,anddeliverables>DiscussionofinsightsthatmayusefulwhileconductingfieldinspectionsAssumptions:MeetingwillbeheldatCityHallandwilllast1Y2hours>KeyconsultantteamtaskleadswillparticipateinthemeetingDeliverables:ListofprojectgoalsandobjectivesEmailsummaryofdiscussion(meetingminutes)Task3.DataCollectionandReviewTaskLead:WSETheConsultantteamwillcollectexistingdatarequiredtocompletetheinvestigation.ThiswillincludeexistingGISandCADlayersneededtopreparetheprojectbasemap.Existingmaterialstobecollectedwillincludebutnotbelimitedto:GISand/orCADlayersincluding(CitywillsupplylinktoallowtheconsultantteamtodownloadCityownedGISdatalayersandwilluploadPDFfilesofplansetsetc.):oParcelboundariesoRoadsoEasementsoPropertyboundariesandparcelnumbersoStreams3jPageAGENDA ITEM #6. i) oUtilitiesincludingbothundergroundandoverheadoStormsewerlayoutincludingpipesizesetc.oStreamcrossingdimensionsoZoningoSensitiveareasMostrecentLiDARdata(Consultanttoobtain)>Existingtopographicdata(Citywillsupplyiftheyhave)Photographsshowingpastfloodingandsedimentdepositionproblemareas(Citytosupply)Maintenancerecordsincludingsedimentremovalfrequency,volume,locations(Citywillsupplybutrecordsarelimited)DesigndrawingsandreportforMadsenCreekchannelimprovementsconstructedbytheCountyinthe1970sand1980s(Citytosupply)Historicalaerialphotographsoftheprojectareaandwatershed(Consultanttoobtain)CityandWSDOTstreamcrossinginspectionrecords(Citytosupplywhattheyhave.ConsultantwillcontactWSDOTifnecessary)>Fishpresenceandutilizationdata(Citytosupplywhattheyhave.Consultanttoobtainfromothersourcesifavailable)Wetlandreportsorinformation(Herreratoobtain)SurveyControl(PGStoobtain.CitywillprovidecontactinformationforCitystaffresponsibleformaintainingsurveymonumentrecords)Contactinformationforchurch,landowners,parkpersonnel,WSDOT,KingCountyand/orotherstakeholders(Citywillprovide)Existingtechnicalreportssuchas2002KingCountyWestBasinWaterQualityImprovementEngineeringDesignReport,KingCounty2015GeomorphicAnalysisReportCedarRiverElliottBridgeReachRestoration,KingCountyCedarRiverCorridorPlanandCapitalInvestmentStrategyReports,etc.(Citywillprovidewhattheyhave,consultantwillgatherreportfromothersources)Assumptions>Datawillbeprovided/collectedatstartofprojectsothatitisavailableforusebytheconsultantteamDeliverables>DatautilizedwillbereferencedintheTask11ExistingConditionReport4PageAGENDA ITEM #6. i) Task4.SiteInspectionTaskLead:WSETheconsultantteamwillcompletedetailedinspectionsofthestreamsystemstartingupstreamofthesedimentbasinandextendingdownstreamtotheCedarRiver.Theywillalsocompleteawindshieldsurveyofkeypointsofinterestintheupperwatershed.Thistaskwillspecificallyfocusoncollectingdataneededforthehydrologic,hydraulic,andsedimentanalyses.Thefieldworkwillinclude:Documentingthechannelnetworkconfiguration.InspectingchanneljunctionsInspectinganyculvertsDocumentingvegetationcharacteristics>Inspectingandconfirminglocationsandsizesofstormwaterpipeinflows>ExaminingthecharacteristicsofareaswherefloodinghasoccurredtodeterminewhatmayhavecauseditCollectingsedimentgradationdataatkeylocationsalongthechannelsystem>Identifyingthelocationofchannelslopechangeswithinthechannelnetwork>MarkingknownfloodhighwatermarksAssumptions:>FieldworkfortheSurveywillbecompletedaspartofTask5FieldworkfortheEnvironmentalAssessmentwillbecompletedaspartofTask6>CityandtheconsultantwillworktogethertonotifypropertyownerstoobtainapprovalstoaccessprivatepropertyDeliverables:ObservationswillbesummarizedandincludedintheTask11ExistingConditionReportTaskS.SurveyandBaseMapCreationTaskLead:PGSApproach:P65willcompleteadetailedtopographicsurveyofthechannelnetworktocollectthedatarequiredtocompletethehydrologic,hydraulic,geomorphic,andenvironmentalassessmenttasks,andtopreparetheprojectbasemapneededtoidentify,lay-out,anddevelopalternativesolutions..WithhelpfromtheCity,P65will5(PageAGENDA ITEM #6. i) obtainright-of-entrypermissionsasneededtoaccessprivateproperty.ThesurveywillbeginupstreamfromthesedimentbasinandcontinuedownstreamtotheCedarRiveralongboththeconstructedhighflowbypassandthelowflowchannel,includingdetailedsurveyof:>Sedimentbasinbathymetryanduplandtopography,alongwithallvisibleinlet,outlet,andbypassstructures(weirsandculverts)HighflowbypasschannelfromthesedimentbasintotheCedarRiver>LowflowchannelfromthesedimentbasintotheendofthedefinedchannelinthewetlandjustnorthoftheRonRegisParkcricketfieldAllvisibleculverts,bridges,andhydraulicstructureswithinboththehighflowbypassandlowflowchannelsAllrelevantditchesandassociateddrivewaycrossings(extentsandlimitsdefinedpriortomappingefforts)includingtheoverflowditchanddrainagesystemontheeastsideof149thAveSEfromSR-169tothehighflowbypass.>Highwatermarksleftfrompastfloods(ifWSEcanidentifythemthroughdiscussionswithCitypersonnel,landowners,and/oravailablephotographs).HighwatermarkswillbeflaggedduringWSE’sfieldinspection.Historicalsedimentdepositionelevationswithinthesedimentbasinandchannelsegmentsiftheycanbeidentified.Theywillbemarkedpriortomappingefforts.WetlandboundarymarkersinstalledbyHerreraenvironmentalstaff.PGSwillbeprovidedsketchandnomenclatureofthewetlandflagging.>MainchannelroutethroughthewetlandifaclearanddefinablerouteexistsElevationdatumsforuptosixpiezometersandonestreamcrest-stagegagetobeinstalledaspartoftheEnvironmentalAssessment(Task6).>Portionsoftheresidentialpropertiesat15214and15202149thAveSEwherefloodinghasoccurredUponcompletionofthesurvey,P65willreviewandprocessthedataunderthesupervisionofalicensedprofessionallandsurveyor.ThesurveydatawillbemergedwithavailableLiDARandprovidedtoHerrera’sCADand615specialistsforinclusionintheprojectbasemap.Herrerawillreviewandmaintaintwoprojectbasemaps;oneinCADwhichwillbeusedfordesign,andonein615whichwillbeusedfortechnicalanalyses.61PageAGENDA ITEM #6. i) Assumptions:>PGSwillhavereasonableaccesstoallareasrequiringsurveysPGScrewswillclearaccesspathsasneededtocompletethesurveyalongvegetatedsectionsofthelowflowchannel.ThesereachesarelocatedprimarilyalongchurchownedpropertyandRonRegisPark.CityandPGSwillworktogethertosecurepropertyaccessapproval.Noboundaryretracementisincludedinthissurveyeffort.Culvertsandcontrolstructureswillbelocatedonlytotheextentfeasiblefromthesurface.Noundueeffortwillbemadetocleanexcessdebrisfromthestructurestoobtaininvertelevations.Nostreetmappingisincludedinthissurveyeffort.WetlandswillbeflaggedpriortoPGSperformingtopographicmapping.Deliverables:TopographicdatatobeprovidedaslayersintheprojectCADandGISbasemaps.>Crosssection,crossingdata,...etc.deliveredinaformatthatcanbeeasilyusedbythehydraulicmodelingteam.Formatswillbedeterminedpriortomappingefforts.Task6.EnvIronmentalAssessmentTaskLead:HerreraAvailableenvironmentaldatawillbegatheredandreviewedaspartofTask2.DatawillbeusedtocreatelayerswithintheGISbasemapwhichwillbeusedwhileconductingfieldwork.Herrerabiologistswillconductasitevisittoassessexistinghabitatconditionsandecologicalfunctionsprovidedattheprojectsite,delineatewetlands,andidentifytheordinaryhigh-watermark(OHWM)ofMadsenCreek.FishHabitat.BiologistswilltakemeasurementsandnotesonthecharacteristicsofaquatichabitatandfishspeciespresencefromthesedimentationbasindownstreamtotheconfluencesofMadsenCreekandthehighflowbypasschannelwiththeCedarRiver(e.g.,substrate,waterdepth,inlet/outletconditions,fishpassagebarriers,vegetation,largewoodydebris,pools,etc.).Thehabitatcharacterizationworkwillfocusonhabitatforkeysalmonidspeciesthatcurrentlyusethecreek,andthatmayuseitinthefutureifhabitatimprovementsareimplemented.Wetlands.Biologistswilldelineatetheboundariesofidentifiedwetlandslocatedwithintheprojectarea.Wetlanddelineationswillextendtowithin200feetoftheprojectsite7PagAGENDA ITEM #6. i) limits(thestudyarea)todetermineifbuffersassociatedwithoff-sitewetlandswillbeaffectedbytheproject.Wherepropertyaccessisnotprovided,Herrerawillestimatewetlandconditionsfromtheprojectsiteandotherpubliclyaccessibleareas.ThewetlanddeterminationanddelineationwillbeconductedusingtheroutinedeterminationmethodoutlinedintheU.S.ArmyCorpsofEngineers(USACE)WetlandDelineationManual,andtheInterimRegionalSupplementtotheCorpsofEngineersWetlandDelineationManual:WesternMountains,Valleys,andCoastRegion.DelineatedwetlandswillbeclassifiedaccordingtoUSFishandWildlifeService(USFWS)andhydrogeomorphicclassificationsystemsandtypedinaccordancewithCityofRentonandKingCountycodesandWashingtonStateDepartmentofEcology(Ecology)WashingtonStateWetlandRatingSystemsforWesternWashington.ThefunctionsofwetlandswillbeassessedusingtheEcologyratingsystem.TheCityofRentonandKingCountycodeswillbeusedtoidentifytheregulatedbufferwidthsofthewetlands.Biologistswillflagtheboundariesofthewetlandsandalltestplots.Streams.TheOHWMwillbedeterminedusingthedefinitionsetforthinWAC173-22-030(11)andtheguidanceoutlinedinDeterminingtheOrdinaryHighWaterMarkforShorelineManagementActComplianceinWashingtonState.ThisinvolvesusingsequentiallynumberedflagstoidentifytheOHWMasevidencedbyabruptchangesintopography,dominanceofperennialvegetation,sedimentdeposits,driftlines,andsignsofscouring.BiologistswillflagtheboundariesoftheOHWM.TheCityofRentonandKingCountycodeswillbeusedtotypeMadsenCreekanddeterminetheregulatedbufferwidth.HydrologicMonitoring.Herrerawillprovidetwofieldtechnicianstoinstallhydrologicmonitoringequipment,includingastreamgagenearthe149thAveSEculvertanduptosixgroundwatermonitoringwells.SeveralwellswillbeinstalledinthewetlandlocatedattheconfluenceofMadsenCreekandtheCedarRiver,inadditiontolocationswhereMadsenCreekmayberealignedand/orwetlandscreatedintheprojectarea.Thestreamgageandmonitoringwellswillbeusedtomonitorsurfacewaterandshallowgroundwaterlevels.Thestreamgageandmonitoringwellswillbeequippedwithawaterleveldataloggerthatwillbeprogrammedtocontinuouslyrecordwaterlevelsonceperhour.Onebarometricpressuredataloggerwillalsobeinstalledonthesiteatasecurelocationtocorrecttheabsolutepressuremeasurementsforthestreamgageandmonitoringwellsforatmosphericpressure.Themonitoringwellswillbeinstalledbyhandusinganauger.Thedepthofeachmonitoringwellwillexceedfivefeetbelowthe8(PageAGENDA ITEM #6. i) groundsurfacebutwillbelessthan10feetdeep(monitoringwellslessthan10feetdeepareexemptfromEcology’swellconstructionandreportingrequirements).Afterthestreamgageandmonitoringwellsarecomplete,Herrerawillreturntothesiteonthreeoccasionstouploaddataandensurethedataloggersarefunctioningproperly.Thegroundsurfaceandtopelevationofthestreamgageandeachmonitoringwellwillbesurveyedbyothers.Thisscopedoesnotincludedecommissioningofthestreamgageorwellsaftermonitoringiscomplete.Uponcompletionoftheenvironmentalassessment,Herrerawillprepareawrittensummarythatwilldescribefishspeciespresentinthestudyarea,andthecharacteristicsofaquatichabitat,wetland,andriparianlandcoverthroughoutthestudyarea.Itwillalsosummarizethemethodsandresultsofthedelineationsandhabitatassessment.Thesummarywillpresenttheclassificationofdelineatedcriticalareasandregulatedbufferwidthsandtheresultsofhydrologicmonitoring.Thepreliminarymapswillberefinedbasedonfieldinvestigationstocreatefinalmapsthatdocumentexistingconditions.AssessmentresultswillbepresentedtotheCityduringtheTask11ExistingConditionsmeeting.Assumptions:Off-sitewetlandswithin200feetoftheprojectsitewillbeevaluatedbasedonavailablepropertyaccess.>Fieldworkwillbeconductedbyteamsoftwobiologistsinuptofive10-hourfielddays.Wetland,OHWM,andtestplotflagswillbesurveyedbyPGS.HerrerabiologistswillprovidefieldmapsofallflaglocationstoPGS.>Uptosixmonitoringwellsandonestaffgagewillbeinstalledandmonitoredatthesite.Installationofmonitoringequipmentwillbeperformedbytwoscientistsintwofielddays;datacollectionwillbeperformedbyonescientistonthreeseparatevisits.Deliverables:>DraftandfinalwrittendocumentationwillbepreparedforinclusionintheTask11ExistingConditionsreport.>PresentationofresultswilltakeplaceinconjunctionwithTask11ExistingConditionspresentation.9(PageAGENDA ITEM #6. i) Task7.PermitIdentificationandStrategyTaskLead:HerreraThepermittinganalysiswillidentifythefullrangeofpermitsandapprovalsthatmayapplytoproposedprojectsolutions.ThestudyareacontainsandisadjacenttomultipleregulatedenvironmentallysensitiveareasincludingtheCedarRiver,MadsenCreek,wetlands,andbuffers.TheseareaswillbeidentifiedandmappedduringtheEnvironmentalAnalysis(Task6)andaddedtotheGISprojectbasemap.Thefootprintofproposedprojectactionswillbeaddedtothebasemaptodetermineiftheywouldimpactsensitiveareasandwhethertheycanberefinedtoavoidorminimizeimpacts.MembersofboththeEnvironmentalandPermittingteamswillparticipateintheidentificationandevaluationofproposedactionswiththegoaltominimizeimpactstosensitiveareastoimprovetheabilitytoobtainrequiredpermitsandtominimize/avoidtheneedformitigation.Oncetheactionshavebeenidentified,Herrerawillprepareawrittensummarythatpresentsfederal,state,andlocalregulatoryimplicationsthatpertaintotheproject,andevaluatesthepermittingfeasibilityandrelativedifficultyoftheproposedprojectactions.Thesummarywillincludeapermitmatrixthatidentifiesthesuiteofpermitsrequitedforeachaction,andforeachpermit,theresponsibleregulatoryagency,requiredpermitsupportdocumentation,andtheestimatedreviewtimelines.AsummaryofpotentialpermitswillbepresentedaspartoftheTask11ExistingConditionpresentation.Assumptions:Thistaskdoesnotincludemeetingwithregulatoryagencies.Deliverables:DraftandfinalwrittendocumentationwillbepreparedtobeincludedintheTask11ExistingConditionsReport.>PresentationofresultswilltakeplaceinconjunctionwithTask11ExistingConditionspresentation.Task8.HydrologyTaskLead:WSEMadsenCreekdrainsapproximately2.2squaremilesontheFairwoodPlateau,ahighlyurbanizedareasouthoftheCedarRiverandeastofRenton.Land-useontheplateau10IPageAGENDA ITEM #6. i) includeshighdensityresidentialandgolfcoursedevelopment.Downstreamoftheplateaubasinland-useincludesareasofsteepforestedhilislopes,amobilehomepark,alargeChurch,highdensityresidentialdevelopment,andthelessdevelopedfloodplainoftheCedarRiver.ForthisprojectanexistingHSPFhydrologicmodelofthebasinwillbeobtained,refinedandruntoprovidehydrologicdataforanalysisandinputforthehydraulicmodeldescribedinTask9.TheHSPEmodelwillhave10to15subbasinsdelineatedatsignificanthydrauliccontrolsandkeypointsofinterest.Landuseandsoilsdataforthemodelwillcomefrompastmappingstudies,refinedasnecessaryusingaerialphotographytocapturesignificantrecentdevelopmentinthebasin.ThehydrologicmodelwillincludeseverallargestormwatermanagementfacilitiesincludingtheWestBasinpond,theNewLifeChurchdetentionfacility,andifhydraulicallysignificantthesedimentationpondnearWonderlandEstates.RainfallandevaporationdatatodrivetheHSPFmodelwillbeobtainedfromlocalgagesandpaststudies.Theperiodofrecordwillbeextendedfromapproximately1949to2017,allowingsimulationofallrecentandhistoricalfloodevents.Flowfrequencyandflowdurationanalyseswillbeconductedatupto10locationstocharacterizehydrologyatkeypointsofinterest.EnvironmentallowflowanalyseswillalsobeperformedatlocationsasneededfortheenvironmentalassessmentdescribedinTask6.DesignflowhydrographswillbeextractedfromtheHSPFoutputandformattedforuseinthehydraulicmodel.TheresultsoftheinvestigationwillbesummarizedandincludedintheExistingConditionreportandpresentedtotheCityduringtheExistingConditionpresentation.Ifproposedprojectactionswillalterflowdistributionwithinthesystem,theHSPFmodelwillbemodifiedtoreflectthoseactionsandpostprojectdatawillbeextractedandanalyzedtoinformdevelopmentandselectionofvariousprojectactions.Assumptions:>Thestartdateandtimestepforhydrologicmodelingwillbebasedonmeteorologicdataavailablefrompreviousstudies—theperiodofrecordwillbeextendedaspossibleusingreadilyavailableprecipitationdata.>ControlstructuredataforthedetentionfacilitieswillbeprovidedbytheCity.Deliverables:UpdatedHSPFmodelFlowfrequencyresults11IPgeAGENDA ITEM #6. i) FlowdataforuseasinputstohydraulicmodelingandenvironmentalassessmentsFlowdataasrequiredtoevaluatesedimenttransportanddepositionWrittenSummarytobeincludedintheExistingConditionreport(Task11).HydrologicanalysisresultswillbepresentedduringtheExistingConditionpresentation(Task11).Task9.HydraulicModelingAHEC-RAShydraulicmodelofthestreamnetworkwillbedevelopedandusedtoevaluateexistingconditionsandproposedalternativesolutions.ThecomplexitiesofthelowerportionsoftheconveyancesystemwithintheCedarRiverfloodplainarebestcharacterizedusingaone-dimensional(1D)split-flowHEC-RASmodelbecauseitcansimulatenaturalaswellasconstructedchannelsalongwithmultiplehydraulicstructures(culverts,weirs,etc.),junctionsandflowsplits.Severalculvertcrossingsarechokedwithsediment,leadingtolimitedconveyancecapacityandfrequentlysurchargedconditions,whichwillberepresentedinthemodel.Weirswillbeaddedtorepresentanyleveeorbankovertoppinglocations,alongwiththeflowsplitatthe149thAveSEcrossingwherehighflowsaredivertednorthalongtheroadwayditch(formermainchannel).ThedetailedtopographicandstructuralsurveyfromTask4willbeusedtodevelopthegeometricinputstothehydraulicmodelandthemodelwillberunwithunsteadyflowassumptions,usingupstreamaswellaslateralinflowhydrographs(largelyfromthelocalstormwaterdrainagesystem)providedbytheHSPFmodelingfromTask8.HEC-RASincludesadvancedcapabilitiestosimulatetwo-dimensional(2D)flow.Ifbeneficialtotheproject,a2DmodelwillbedevelopedforthelowerreachofthenaturalMadsenCreekchannelasitpassesthroughRonRegisParktobettercharacterizetheflowpatternsandpossiblefloodriskwithintheparkandtoneighboringprivateproperty.A2DmodelmayalsobedevelopedfurtherupstreamtocoverthenaturalchannelreachandadjacentfloodplainalongNewLifeChurch;however,itislikelythisreachcanbereasonablyandaccuratelyrepresentedusing1Dcrosssections.WSEwillobtaintheCity’sapprovalbeforeperformingany20modeling.TheHEC-RASmodelwillbeutilizedtoevaluatetheperformanceofproposedactionsduringthedesignphaseoftheproject.Themodelwillberuntoevaluatesystemperformanceoverarangeofdischarges,includingthe100-yeareventwhichwillbethedesignflood.12PageAGENDA ITEM #6. i) TheassumptionsandresultsoftheinvestigationwillbesummarizedandincludedintheExistingConditionsReportandpresentedduringtheExistingConditionpresentation(Task11).Assumptions:>Ifobservedhighwatermarksfrompreviousfloodscanbeidentifiedandsurveyed,WSEwillattempttocalibrationtheHEC-RASmodel.Ifhighwatermarksdonotexist,WSEwillsetmodelparametersbaseduponjudgementandexperience.Deliverables:1DunsteadybranchflowHEC-RASmodelcoveringentiresystem,withpotential2DcomponentsifcreatedHydraulicresultsforkeyeventstoassessexistinghydrauliccharacteristicsWrittensummarytobeincludedintheExistingConditionReport(Task11)ResultswillbepresentedduringthepresentationoftheExistingConditionAssessment(Task11)Task10.SedimentTransportandDepositionTaskLead:WSESedimenttransportanddepositionwillbeevaluatedtounderstandthephysicalprocessesthathavecausedsedimenttodepositwithinvariouspartsofthesystem.Thisknowledgeiscriticalfordevelopingenduringsolutionsthatwillrequireminimalshortandlong-termmaintenance.ThesystemispronetosedimentdepositionbecausethechannelslopeflattenssignificantlyintheteachbetweenthesedimentbasintotheCedarRiver.WSEwillevaluateexistingconditionsedimenttransportanddepositionprocesses/characteristicsbycompletingthreetasks:1)identifyinghistoricalsedimentdepositionlocations,quantities,andmaterialgradation;2)fieldsamplingandlabanalysistodetetminesedimentgrainsizedistributionandcharacteristics;and3)sedimentttansportanddepositionanalysesutilizingobservedsedimentdepositionquantities,grainsizedata,andthehydraulicmodel.Documentationofhistoricalsedimentdepositionlocationsandquantitieswillincludecomparisonofcurrentandpastchannelbedelevationdata(assumingpastchannelsurveysand/orchannelprofilesweresurveyedorrecorded),reviewofsedimentbasinandchannelsedimentremovalrecords,anddiscussionswithCityandCountypersonnelinvolvedinchannelmaintenance.Figureswillbecreatedtoidentifysediment13IPgeAGENDA ITEM #6. i) depositionlocationsandcalculationsperformedtoestimatesedimentdepositionquantities.FieldactivitieswillinvolvetheidentificationandclassificationofsedimentgrainsizesbaseduponWolmanPebblecountsandlaboratorygrain-sizesieveanalyses.WSEanticipatesperformingSto8WollmanPebblecountsandcollectingupto10bulksedimentsamplesforlaboratorysieveanalyses.Samplelocationswillbedeterminedbaseduponfieldobservations.Sedimenttransportanddepositioncharacteristicswithinthesedimentbasinandchannelnetworkwillbeanalyzedutilizingtheobservedsedimentdata,supportedbyhydraulicmodeling.Thegoalistoidentifyandunderstandhowsedimentmovesthroughthesystemandtoidentifywhatiscausingittodepositatvariouslocations.TheresultsoftheinvestigationwillbesummarizedandincludedintheExistingConditionReportandpresentedduringtheExistingConditionpresentation.Assumptions:CitywillprovidesedimentremovaldatesandquantitiesifitexistsAnticipatedResults:>Figuresshowingsedimentdepositionareasandbedlevelchanges>Sedimentgrainsizedistributioncurves>WrittensummarytobeincludedintheTask11ExistingConditionReport>ResultswillbepresentedduringtheTask11ExistingConditionpresentationTask11.ExistingConditionReportandPresentationTaskIead:WSEMethodsandresultsofTasks1through10willbedocumentedinanExistingConditionsummaryreport.KeyfindingswillbepresentedtotheCityinameetingheldatCityHall.Theconsultantteamwillalsopresentarangeofpotentialactionstoimprovethesystem,actionsthatwillbeidentifiedinTask12.Assumptions:Themeetingwilllastupto2hoursandwillbeheldatCityHall.>TheconsultantteamwillcompletePhase2,Task12,priortothemeetingsothatalistofpossibleactionscanbepresentedanddiscussed.Theseactionswillnot14IPageAGENDA ITEM #6. i) beincludedintheExistingConditionreport,butratherinthePreliminaryDesignandAnalysisReport(Task16).Deliverables:>WSEwillprovidethedraftreporttotheCityasadigitalPDEdocument.Ifdesired,thetextwillalsobeprovidedasWordfilesothattheCitycanprovidecommentsusingtheWordtrackchangesfeature.Uponreceiptofcomments,theconsultantwillmodifythereportandsubmitthefinalreportasdigitalPDFfilealongwithonehardcopy.15PgeAGENDA ITEM #6. i) Part2.AlternativesAnalysisandPreliminaryDesignTask12.IdentificationofPotentialActionsTaskLead:WSEUsingtheknowledgegainedduringtheExistingConditionAssessment,theconsultantteamwillidentifypotentialsolutionstoreducefloodingandpreserveorenhancehabitat.Becausethesystemissocomplexandincludesmanydifferentfeatures,thepreferredalternativewilllikelyconsistofmultipleindividualsolutions(“actions”)thateachaddressaspecificproblem,yetcollectivelyachievethebestproject.Apreliminarylistofpotentialactionswillbecreatedincludingsimplesketchestoillustrateconceptsasneeded.ThesewillbepresentedtoanddiscussedwiththeCityduringthemeetinginTask11.ThegoalinthemeetingwillbetoseektheCity’sdirectionastowhichactionsappearfeasibleandthereforeshouldbecarriedforwardtothenexttask(Task13).TheactionspresentedtotheCityshallbedividedinto2categories:Improvementsthatcanbeimplementedintheshortormediumtermwhileprovidingsomefloodingreductionbenefits>Improvementstobeimplementedinthelongtermthatwouldsubstantiallyreduceoreliminatetheriskofflooding,butthatwouldrequirepermitting,fundingandcoordinationwithKingCountyandstateagencies.Assumptions:Thepreliminarylistofactionswillbepresentedintheformofsimplesketchesordescriptions.NodetaileddesignworkortechnicalanalyseswilloccuraspartofthistaskDeliverables:ListofpotentialactionsandasneededsimplesketchestobepresentedattheTask11meetingTask13.AssessmentandScreeningofIndividualActionsTaskLead:WSEBasedupontheoutcometheTask11meeting,theconsultantteamwilldevelopconceptlevelpreliminarydesignsfor8to10actions.Theteamwillevaluatetheirlikelyperformancebasedonthefollowingcriteria:16IPageAGENDA ITEM #6. i) >FloodhazardreductionbenefitsEcologicalimpactsandbenefits>PermitacquisitionsuccesspotentialMitigationrequirementsandcostsCapitalcostMaintenancerequirementsandcostsTheconsultantteamwilldevelopabriefwrittensummaryforeachactionthatcomparesrelativeperformancebasedonthesixcriterialistedaboveandwillusethisinformationtodevelopascreeningmatrixtocompareactions.Eachactionwillreceiveanumericalscoreforeachevaluationcriteriabaseduponthecriteria’sperceivedimportance.Thescoresforeachactionwillthenbesummedtoidentifytheactionsthathavethegreatestpotentialforsuccess.Baseduponthescreeningscores,theconsultantteamwillgroupthemostpromisingactionsintotwoalternativestopresenttotheCityinTask14.Assumptions:ThenumberofactionstobeevaluatedwillbeagreedtobytheconsultantandCityduringthemeetinginTask11.Forbudgetingpurposes,itisassumedthat8to10actionswillbedevelopedandevaluated.Deliverables:Onetotwo-pagesummarydescribingtheperformanceofeachactionrelativetothesixscreeningcriteriaScreeningmatrixshowingthenumericalscoreforeachactionIdentificationoftwoalternativestoinitiatediscussionsinthenexttaskTask14.MeetingwithCitytoIdentifyaPreferredAlternativeTaskLead:WSEAtwo-hourworkshopwillbeheldatCityofficestoreviewanddiscusstheactions,thescreeningmatrix,andthetwoalternatives.ThegoalwillbetoidentifyapreferredalternativethatincludesactionstheCityfeelsarebestsuitedtomeettheprojectgoalsandobjectives.Thepreferredalternativewillthenbecarriedforwardtothesecondstageofpreliminarydesign(Task15).Assumptions:Two-hourworkshoptobeheldatCityHall17IPgeAGENDA ITEM #6. i) Deliverables:PresentationmaterialsTask15.PreliminaryDesignofPreferredAlternativeTaskLead:WSETheconsultantteamwilldevelopapreliminarydesignforthepreferredalternative.Theteamwillconducttechnicalanalysesneededtoevaluateandrefinethedesignto:ImprovehydraulicandsedimenttransportperformanceMinimizeimpactstoand/orimprovehabitat>Minimizeneedforoff-sitehabitatmitigationSimplifypermitacquisitionrequirementsReducecapitalcosts>Reduce/minimizemaintenancerequirementsAplanninglevelpreliminarydesignsetwillbepreparedwithsufficientdetailtoallowtheconsultantteamtoprepareaconstructioncostestimatethattheCitycanusetoseekgrantfundingandinitiatethepermittingprocess.Itispossiblethatelementsofthepreferredalternativewillbeconstructedatdifferenttimes.TheconsultantteamwilldeveloptheplansetandcostestimateinamannerthatwillallowtheCitytoseekfundingandimplementdifferentelementsoftheprojectatdifferenttimes.TheconsultantteamwillmeetwithCitystaffinatwo-hourmeetingtoreviewthedesign,theperformanceresults,andtoidentify/discussanyrefinementsthatmaybeneeded.Followingthismeetingtheconsultantteamwillfinalizethepreliminarydesignplansetandcostestimate.Assumptions:Two-hourmeetingwillbeheldatCityHallDeliverables:>Planning-levelpreliminaryCADdesignplansetFinalplanning-levelpreliminarydesignplansetItemizedcostestimateforthepreliminarydesign18PageAGENDA ITEM #6. i) Task16.PreliminaryDesignSummaryReportTaskLead:WSEApproach:WSEteammemberswillprepareareportthatdocumentsmethodsandresultsofthePhase2investigationandpresentsthepreferredalternative.Assumptions:NoneDeliverables:FinalCADfilesforthepreferredalternative>Two-hardcopiesoftheplansetItemizedcostestimatespreadsheetFinalhydrologicandhydraulicmodels>WSEwillprovidethedraftreporttotheCityasadigitalPDFdocument.Ifdesired,thetextwillalsobeprovidedasWordfilesothattheCitycanprovidecommentsusingtheWordtrackchangesfeature.Uponreceiptofcomments,theconsultantwillmodifythereportandsubmitthefinalreportasdigitalPDFfilealongwithonehardcopy.AnyotherdatageneratedduringtheprojectthattheCitywouldliketohavefortheirrecords(e.g.GISfiles/layers,surveydata,etc.)19IPageAGENDA ITEM #6. i) ExhibitB-EstimateofProfessionalServicesCityofRentonMadsenCreekImprovementProject--Phase1CostEstimateSummaryWATERSHEDSCIENCE&ENGINEERINGBudget(Dollars)TaskTASKDESCRIP1JONWSEHerreraPGS1Total1ProjectManagement$19,12fl$3,567$22,667Ii‘:.:.:;./.TotalPrójectManagemen$19,120$3,567$22,687Part1—DataCollectionandExistingConditionAssessment2ProjectKick-OffMeeting$3,098$1,136$4,2313DataCollectionandReview$4,100$6,693$10,7934SiteInspection$8,150$8,1505SurveyandBaseMapCreation$2,320$6,119$104,312$112,7516EnvironmentalAssessment$400$37,669$38,0697PermitIdentiticalionandStrategy$400$15,644$16,0448Hydrology$28,800$28,8009HydraulicModeling$33,500$33,50010SedimentTransportendDeposition$25,000$25,00011Phase1--ExistingConditionReportandPresentation$18,200$5,695$23,896)Total—ExistingCondttionAssessment$123,96$72,956$104,312$301,233rir‘i—AlternativesAnalysisandPreliminaryDesign12tdentiticationotPotentialActions$9,300$3,717$13,01713aseaamentandScreeningofIndividualActions$31,800$13,901$45,70114MeetingwithCitytoIdentityaPreferredAlternative$6,595$1,894$8,48915PreliminaryDesignofPraterredAlternative$14,500$17,344$31,84416PreliminaryDesignSummaryReport$17,000$6,734$23,734jTotal—PreliminaryDesignandAnalysin$79,195$43,590$0$122,785ManagementReserve/Contingency$10,000TOTALLABORCOST$222,280$120,113$104,312!$456,7051PGSprojectmanagementcastsarecontainedwithinTask5SurveyandBaseMapCreation.DirectExnenseSummaryWSE$2,773Herrera$4,876PGS$1,744TotalI$9,393CostSummaryTotalLabor..$456,705TotalDirectExpenses$9,393Total$466,098AGENDA ITEM #6. i) WATERSHEDSCIENCE&ENGINEERING110PrefontainePlaceSouth,Suite508Seattle,WA98104Tel.(206)521-3000EstimateofProfessionalServicesPreparedfor:CityofRentonProject:MadsenCreekFloodReductionDate:Mayl,2018PreparedBy:JeffJohnsonDirectExpenseDetailMileage500$0545$273LaboratorySeiveAnalysis10250$2,500Total$2,773CostSummaryTotalLaborTotalDirectExpensesTotal$225,053HoursTASKDESCRIPTIONPrincipalIPrincipal2Sr.EngISr.EngIIEng.Jr.Eng.ContractAdm.Totals1ProjectManagement808816$19,120PartI—ExistingConditionAssessment2PrejectKick-OttMeeting7336$3,0953DataCollectionandReviewII20$4,1004SiteInspection206620$8,1505SurveyandeaseMapCreation416$2,3206EnvironmentalAssessment2S4007PermitIdentiticationandStrategy2$4008Hydrotogy860160$28,8009flydrautlcModelIng2060200$33,50010SedimentTransportandDeposition80880$25,00011ExIstingConditionReportandPresentation406880$18,200Pjrt2—AtternetivesAnslysieendPreliminaryDesign12ldentifcationofPotentialActions204440$9,30013AssessmentandScreeningoftndividuatActions80816120$31,80014MeetingwithCitytoIdentityaPreterredAlternative165516$6,59515PreliminaryDesignotPreterredAlternative241280$14,50016PreliminaryDesignSummaryReport40880$17,000TotalHsursandDirectLubsrCsst(DL)454.092.0138.00.00.0926.016.0LaborRule($/hr)I$200.00I$200.00I$175.00I$145.00I$115.00I$95.00$60.00ITOTALLABORCOST$90,800$18,400$24,150$0$0$87,970$9601$222,280AGENDA ITEM #6. i) Pacific Geomatic Services,Inc. CLIENT:City of Renton I Watershed Science and Engineering Estimate of Professional Services PROJECT:2018 Madsen Creek Basemap Surveys Date:03/27/2018 2 3 4 5 6 7 PM/Admin/QAQC di,,,,,,c Sd R.ShV and Topo ligh Flow Bvass Channel Low Flow Channel Misc.Topographic Tasks Idetland and Piezometer Surveys Basemap and LiDAR Merger ‘rolect Kick-Off Meeting 16 3 3 4 2 4 4 5 6 8 4 2 10 20 20 40 16 8 30 30 24 66 40 10 20 50 50 130 52 40 50 18 50 130 52 40 8 24 158 153 375 166 101 82 $2,880 $15,950 514.772 $35,964 $15,936 $9,468 $8782 $560 Pacific Geomatic Services,Inc. Ron Hilliard K!mberly Bourns Casey Hilliard Kael Martin James Martin lake Reeder Nick Short Robert Paeseler Crystal Hilliard Open Open Principal .t’rotect . .St,ComplScanner Semior Field Party Sr.Survey Tech .Director of St. TaskS -Survey Protect Surveyor Surveyor/Technicia .Chief/Scanner Survey Tech 2 Admin Manager Comp/Scanner Totals Total LaborSurveyornTechSupervisorTechSurvyingTech TOTALHOURS 37 35 134 190 50 272 68 272 8 0 0 0 1,062 $104,312 DIRECTIOB WAGES (01W)$140.00 $134.00 $105.00 $100.00 $100.00 $94.00 $80.00 $80.00 LABOR $5,180 $4,690 $14,070 $19,380 $5,000 $27,200 $6,392 $21,760 $640 $0 $0 $0 $104,312 EXPENSES Travel &Per Diem ($0545 x 3200)I $t’’ TOTAL COMPENSATION:I $106,056 AGENDA ITEM #6. i) Herrera--MadsenCreekImprovementProjectPhase1Task2Task3Task5Task6Task7Task11Task12Task13Task14Task15Task16Task1TOTALNumberofTasks:16ProjectKickoffDataCollectionandSurveyandBaseEnvironmentalPermitIdentificationExistingConditionIdentificationofPreliminaryDesign,MeetingwithCitytoPreliminanjDesignofPreliminanjDesignProjectManagementReviewMapCreationAssessmentandStrategyReportandPotentialActionsAssessment,andIdentifyPreferredPreferredAlternativeSummaryReportPresentationScreeningofAlternativeIndividualActionsCOSTSUMMARYLabor$1,136$6,672$6,119$37,669$15,644$5,696$3,717$13,901$1,894$17,344$6,734$3,567$120,091Travelandperdiem$22$22$0$218$22$22$0$0$22$0SO$0S327Otherdirectcosts(ODCs)$0$0$0$4,549$0$0$0$0$0$0SO$0$4,549GRANDTOTAL$1,158$6,693$6,779$42,436$75,665$5,717$3,717$13,907$7,915$17,344$6,734$3,567$124,968COSTITEMIZATIONLabor(2018rates)PersonnelRate/HourHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostHoursCostEwbank,MarkPrincipal$240.573$7221$2411$2414$9623$7224$9622$4814$9625$1,2038$1,9254$9620$031$7,458Ahearn,DylanScientistV$225.700$00$00$00SO0$00$00SO0$00$00$00$00$00SORitchotte,GeorgeScientistIV$178.910$08$1,4310$030$5,3678$1,4314$7160$04$7160$00$00$00$046$8,230Avolio,ChristinaEngineerIV$177.280$00$00$00500$00$04$70924$4,2550$040$7,09110$1,7730$05459,573Scott,BrianEngineerIV$175.470$00$00$00500$00$00500$00$04$7020500$04$702Schmidt,JenniferGISAnalystIVSi56.910$06$94120$3,1388$1,2550$08$1,2550SO0500$00SO0$00$03455,335Gitford,KristinaPlannerIVSi55.740$00$00SO6$9346$9340SO0SO0500$0oso6$9340$018$2,803Petro,ShelbyScientistIV$138.143S4148$1,1050SO30$4,14430$4,1448$1,105455534$5535$6916$82910$1,38118$2,487114$15,748Prescott,ToddCADTechnicianIll$137.000$00$020$2,7400$00$00$08S1,0968$1,09605020$2,7400$00504856,576Svendsen,AlexScientistIII$136.900$00$00$070$9,5830$04$5480$00$00$00$00$00$070$9,583Blaud,BriannaScientistIll$127.510$016$2,0400$050$6,37630$3,8254$5100$08$1,0200$00$04$5100$0100$12,751Munger,JuliaScientistIII$127.510$00$00$020$2,5500$00$O0$00$00$00$04$5100$024$3,060Hoenig,AnnsmarieScientistII$118.440$04$4740$040$4,73830$3,5532$2370$00$00$00$00$00$074$8,765Wu,ValerieEngineerII$109.800$04$4390$00$00$00$08$87832$3,5140$032$3,5144$4390$048$5,270Geigel,JosephGISAnalystI$90.680$00$00$012$1,0884$3634$3630$016$1,4510$06$5440$00$022$1,995Saavedra,RobinAccountingAdministral$108.310$00$00$00$00$00$00$00$0osoosoo$08$8668$866Rudnick,TracyAccountingAdministrat$107.150$00$00$00$00$00$00$00$0osoosoo$02$2142$214Jackowich,PamAdministrativeCoordin.$111.790$00$00$06$6716$6710$00$03$3350$00$02$2240$014$1,565SUBTOTALLABOR(BurdenedLabor)6$7,73647$6,67241$6,719276$37,669117$15,64438$5,69626$3,717103$13,90110$1,894116$77,34444$6,73428$3,567711$100,495TRAVELANDPERDIEMCOSTSUnitCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostAutoUseMile$054540$21.8040$21.800$0.00400$218.0040$21.8040$21.800$0.000$0.0040$21.800$0.000$0.000$0.00560$305SUBTOTALTRAVELANDPERDIEM$22$22$0$218$22$22$0$0$22$0$0$0$305OTHERDIRECTCOSTS(ODCs)UnitCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostUnitsCostFieldEquipmentandSuppliesCamera,digitalDay$100$0.000$0.000$0.005$50.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.005$50Computer,laptopDay$500$0.000$0.000$0.003$150.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.003$150HandsoilaugerDay$100$0.000$0.000$0.003$30.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.003$30WaterlevelindicatorDay$200$0.000$0.000$0.003$60.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.003$60Misc.piezometer/gsgingsuppliesEach$1000$0.000$0.000$0.006$600.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.006$600In-SituRuggedTroll100(0-30teet)Each$4200$0.000$0.000$0.006$2,520.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.006$2,520In-SituRuggedBaroTrollEach$4200$0.000$0.000$0.001$420.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.001$420In-Situ2-inchwelldockEach$210$0.000$0.000$0.006$126.000$0.000$0.000$0.000$0.000$0.000$0.000$0.000$0.006$126FeeonODC5@x%15.00%$0$0$0$593$0$0$0$0$0$0$0$0$593SUBTOTALODCs$0$0$0$4,549SOSO$0$0$0$0$0$0$4,549AGENDA ITEM #6. i) II a.00CDC)0CD3DCCDCDCDCl)33DCCD0 -tDCDC-tDCDC-ICD0DCCDDCCDDCDCDCDCDCa.-oCD3DCCDDCCD 0CD ‘<0.0.3.CDDC 00.DCCD0DCzaCD00DC0zp.)a.CDzC)DC000CDDCC)0DC01-on3DCCDDC(a0•0CDCDCDaCDDCCD 01 -U —CD CDDCCDDCCD.CDDC•00CDDC0z 0DCxDCCD00a.0zDCDCCDDCCD3CDzC)m03CDDCDCDCCDDCDC3CDz-J-oCD30.CDC)DC0DC0.0DCCDCD.C.).>CD DCI3.CD CDz.-o 02.DCCD0...;0.CDa.DCCD C.)DCDC00CD00DC0.CDCD 00CDC)DCDCCDCD3CDp.,.0C)C)CDCD100DCmxDCCD00a.0CD•00DC0.CDCDCDDC0 X-..CD.-.CD-0OCD-CCD-t0CD0-U0CD-I.D-1QCD(D00013.D0D UI 0 10 CD0)I••iii• 18-Jun-lB25-Jun-i 832-Jul-iS 39-Jul-i 8 1 6-Jul-i 8 10 01 I’ll’01 01 ‘UI ---1IIII-- .iiiii ------ ---- -iPHIL 01 01 01 01 0 01a:z:_1ILII:Hizz: II 23-Jul-78 30-Jul-iB 06-Aug-i 8 13-Aug-18 20-Aug-i 8 27-Aug-i 8 03-Sep-i 8 10-Sep-18 17-Sep-i 8 24-Sep-18 01-Oct-iS 08-Oct-i 8 75-Oct-i 8 22-Oct-i 8 29-Oct-i 8 05-Nov-18 12-Nov-18 ------- I_ I_ H a -J --- 01 a 19-Nov-78 _.T 226-Nov-18 01 03-Dec-18 .1 Ci)10-Dec-18 01 03 17-Dec-18 0101 24-Dec-18 C.) °31-Dec-18 03 001 07-Jan-19 10 0 14-Jan-19 10 21-Jan-19 10 -03a 28-Jan-19 10 C,) ‘04-Feb-19 10 0101 ‘11-Feb-19 AGENDA ITEM #6. i) 1 CITY OF RENTON, WASHINGTON RESOLUTION NO. ___________ A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, DECLARING AN EMERGENCY FOR THE PURPOSES OF REPLACING/REPAIRING A TRAFFIC SIGNAL POLE. WHEREAS, the City of Renton owns, operates and maintains the traffic signal pole on NE 4th Street and Jefferson Avenue NE in the City of Renton; and WHEREAS, on or about April 28, 2018, the traffic signal pole was struck by a vehicle, and heavily damaged and in need of an immediate repair/replacement; if immediate action was not taken, it may result in further material loss or damage to property, bodily injury or loss of life ; and WHEREAS, on May 3, 2018, the Mayor declared an emergency, attached hereto as Exhibit A, pursuant to the provisions of RCW 39.04.280 and Renton Policy and Procedure Manual 250- 02, paragraph 6.10.3, to authorize Gregg Zimmerman, Public Works Administrator, to waive competitive bidding requirements and to award all necessary contracts to address the emergency for the repair/replacement of said signal pole; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO RESOLVE AS FOLLOWS: SECTION I. The above recitals are adopted as findings. SECTION II. An emergency did exist at the time of the declaration of emergency by Mayor Denis Law. By these written recitals and findings, the City Council does hereby ratify and approve the Mayor’s emergency declaration, attached hereto as Exhibit A, to waive competitive bidding AGENDA ITEM # 8. a) RESOLUTION NO. ________ 2 requirements and to award all necessary contracts to address the e mergency for the repair of the aforesaid signal pole on NE 4th Street and Jefferson Avenue NE. PASSED BY THE CITY COUNCIL this ______ day of ___________________, 2018. ______________________________ Jason A. Seth, City Clerk APPROVED BY THE MAYOR this ______ day of _____________________, 2018. ______________________________ Denis Law, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ______________ RES:1770:5/3/18:scr AGENDA ITEM # 8. a) RESOLUTION NO. ________ 3 EXHIBIT A DECLARATION OF EMERGENCY AGENDA ITEM # 8. a) RESOLUTION NO. ________ 4 AGENDA ITEM # 8. a)