The URL can be used to link to this page

Home My WebLink AboutMFP19001595.pdfDEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Franchise Permit: MFP19001595 IVR Number: 19001595 Permit Informaon Permit Name:Comcast Cable Franchise Permit Address/Locaon :03/28/2019Application Date:0418000305Parcel Number:3304 NE 6TH ST Permit Type:04/23/2019Issue Date:Franchise Permit Work Class:04/22/2020Expiration Date:Major Utility Job Number:310850Franchise Type:Cable Description:Comcast proposes to overlash 4,045' of 144ct fiber and push small section in occupied conduit. Restoration per City of Renton standards. CONDITIONS OF OVERHEAD APPROVAL:1.Any existing height violations within the Project Reach must be resolved at the time of construction. New aerial lines within the Project Reach must have a minimum vertical clearance of 15’ 6”. 2. Any abandoned or unused lines within the Project Reach must be removed at the time that construction is taking place. 3. A traffic control plan must be separately submitted to the City, and no construction may take place until the City has approved a traffic control plan. 4. The new aerial fiber lines within the Project Reach must be converted to underground facilities in the future, at Comcast’s cost, when any one of the following events occurs: (1) any other utilities are undergrounded within the Project Reach, (2) a joint use trench is proposed by a franchisee within the Project Reach, in which case Comcast shall participate in the joint use trench installation for the purpose of undergrounding its aerial lines, or (3) a conduit is made available within the Project Reach that will accommodate the aerial lines. The new aerial lines must be undergrounded within one year, or approved otherwise by the City of Renton Community and Economic Development Administrator or designee, from the first event triggering the requirement to underground the aerial lines. Contacts Name Address PhoneTypeBilling Comcast Cable Communication Management & Comcast Cable Holding B: (215) 665-1700Applicant Tom Donnelly Comcast Business Communications 1701 Jfk Blvd, 32nd Floor Philadelphia, PA 19103 B: (215) 286-7347 C: (215) 286-7557 Contact Scott Nall SEFNCO Communications Inc 2904 4th Ave NE Puyallup, WA 98372 B: (877) 385-2903 C: (253) 444-9057 Contractor Business License Number: 41108Construction Contractor: SEFNCCI850QD CITY OF RENTON ROW 1055 S Grady Way Renton, WA 98057-3232 Owner Laurie Dietz Comcast - Billing 1701 John F. Kennedy Blvd. Philadelphia, PA 19103 H: (425) 741-5733Specialized Billing X General Condions & Signature Permission is hereby given for the work described on this permit according to the conditions hereon and according to the approved plans and specifications pertaining thereto, subject to compliance with the Ordinance of the City of Renton. This permit and plans must be posted at the job site at all times. I hereby certify that no work is to be done except as described above and in approved plans, and that work is to conform to Renton Trench Restoration and Street Overlay Requirements. Call 425.430.7203 or go to: www.MyBuildingPermit.com one working day in advance to schedule an inspections and for ANY work in the Right of Way. Call 8 1 1 to locate underground utilities at least two full business days prior to any excavation. In accordance with RCW 19.122.033(4) the permit holder is required to contact (Williams Northwest Pipeline at 425.868.1010) (Olympic Pipeline at 206.510.0575) (Puget Sound Energy at 425.375.3397) to request a consultation with the transmission pipeline company prior to performing any construction or excavation activities. This requirement to consult with the transmission pipeline company is in addition to the requirement to Call before You Dig as required in RCW 19.122. Page 1 of 2THIS PERMIT AND PLANS MUST BE POSTED AT THE JOB SITE AT ALL TIMES DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Franchise Permit: MFP19001595 (Date)(Signature) Page 2 of 2THIS PERMIT AND PLANS MUST BE POSTED AT THE JOB SITE AT ALL TIMES DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Page 1 | Published: 3/30/2017 Planning Division | 1055 South Grady Way, 6th Floor | Renton, WA 98057 | 425-430-7200 Email: franchisepermits@rentonwa.gov Website: rentonwa.gov FRANCHISE PERMIT APPLICATION Published: 3/30/2017 TO THE APPLICANT: Submit an electronic copy of the plans with the Franchise Permit Application and the Traffic Control Application to franchisepermits@rentonwa.gov. Permit cost is $360.50. Inspection fee for trenching more than 60 lineal feet or installation of 6 or more poles will be billed at $60.00 per hour. Franchise Agency: Franchise Job Number: Phone: Contact Name: Email: Job Site Address: Project Name: Description of Work: Please check all that apply: ☐ New Construction ☐ Repair/Relocate ☐ Underground ☐ Overhead ☐ Sidewalk ☐ Street ☐ Open Trench ☐ Bore # of feet: Contractor Name: Phone: State Contractors License #: City of Renton Business License #: “I certify that I am the owner or applicant’s authorized agent and do hereby agree to abide to the terms and conditions set forth under this permit and shall comply with the City of Renton’s Trench Restoration and Street Overlay Requirements. ” Signature Date INSPECTIONS SHALL BE REQUESTED 24 HOURS PRIOR TO COMMENCEMENT OF ALL WORK BY CALLING THE INSPECTION LINE AT 425-430-7203 OR BY GOING TO MYBUILDINGPERMIT.COM Jobs are required to be called in for job start, re-inspection and project final. Re-inspection fees are billed at $75/hour. All Pre-Construction meetings shall be scheduled at a maximum of 14 days prior to the job start date. Plan Review/Development Engineering Date Approved as submitted Pre-Construction Meeting required Site Construction Inspector Date Approved with comments or redlines Camera inspection of utilities required Development Engineering Manager Date Comcast Cable Communications Management, LLC 310850 Cody Shackett 253 235-7406 owen_shackett@comcast.com 3304 NE 6th Street RN31A NEW NODE RN63 Comcast proposes to overlash 4,045' of 144ct fiber and push small section in occupied conduit. 200 SEFNCO Communications, Inc.253 299-8587 SEFNCC1850QD BLO-29666 3-11-2019 4 MFP19001595 Scott Warlick 3/28/2019 Justin Johnson 4-19-2019 MFP19001595Justin Johnson4-19-2019Monday through Friday POLE-27POLE-26 POLE-25 POLE-24 POLE-23 POLE-22 POLE-21 POLE-20 POLE-19 POLE-18POLE-17POLE-16POLE-15POLE-14POLE-13POLE-12POLE-11POLE-10POLE-9POLE-8POLE-7POLE-6POLE-5POLE-4POLE-3POLE-2POLE-1 SCOPE OF WORK: SHEET INDEX: 1 - COVER SHEET 2 - NOTES & LEGEND SHEET 3-12 - DESIGN BILL OF MATERIALS*: CONTACTS: RN31A NEW NODE RN63 THIS IS PROPRITORY INFORMATION AND NOT MEANT FOR GENERAL PUBLICATION. ALL RIGHTS RESERVED SEFNCO COMMUNICATIONS PROJECT MAP: COVER 4045 FT 578 FT FT PROJECT DESCRIPTION* 3304 NE 6TH ST KENT, WA SEFNCO:BRANDON MORRIS 253-299-4973 COMCAST:JERRY STEELE *ALL FOOTAGES AND MATERIALS ARE ESTIMATED "DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT1 123/20/2019PERMITMDB***COMCAST COMCAST JT#: 310850 TOTAL FOOTAGE 4623FT = = = = NEW 144CT FIBER OVERLASH 144CT FIBER PROOF/PULL 144CT FIBER WORK AREA OVERLASH 4,045' 144CT FIBER. AND PUSH 578' THRU OCCUPIED CONDUIT. MFP19001595 NOTES & LEGEND "DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT2 123/20/2019PERMITMDBCOMCAST FIBER PLACEMENT NOTES: GENERAL NOTES: DISCLAIMER: 1.IT IS THE RESPONSIBILITY OF THE CONSTRUCTION CONTRACTOR TO VERIFY ALL RIGHT OF WAY BEFORE CONSTRUCTION IS TO BEGIN. NO UNDERGROUND INSTALLATION REPRESENTED WITHIN THESE PLAN SHEETS IS PROPOSED OUTSIDE OF THE RIGHT OF WAY. 2.THE UNDERGROUND ROUTE DEPICTED IS PRELIMINARY AND WILL/MAY VARY ONCE UTILITIES HAVE BEEN FIELD LOCATED. 3.ANCHORING FOR THE AERIAL CONSTRUCTION IS TYPICALLY DETERMINED DURING CONSTRUCTION AND IS COLLECTED IN THE AS-BUILT PHASE. 1.CONTRACTOR IS RESPONSIBLE FOR LOCATING ALL UTILITIES 48 HOURS PRIOR TO CONSTRUCTION ACTIVITY SEE LOCAL DIRECTORY FOR CONTACT TELEPHONE NUMBER OF LOCAL CALL BEFORE YOU DIG AGENCY. 2.CONTRACTOR SHALL RECORD SEQUENCE # OF FIBER CABLE AT EVERY WORK POLE, MANHOLE, FIBER STORAGE LOOP AND TAIL LOCATION. CONTRACTOR TO PROVIDE PROJECT MANAGER WITH SEQUENCE NUMBERS AT PROJECT COMPLETION. 3.SLACK LOOP AND SNOWSHOE STORAGE LOCATIONS SHALL BE DETERMINED ON CONSTRUCTION DRAWINGS, HOWEVER, REEL LENGTHS OF FIVE HUNDRED FEET (500') OR LESS ON LARGE COUNT FIBER OR THREE HUNDRED FEET (300') OR LESS ON SMALL COUNT FIBER ARE DIFFICULT TO USE AND SHOULD BE PLACED AS FSL'S, NOT CUT AND RETURNED. 4.FIBER OPTIC IDENTIFICATION TAGS SHALL BE PLACED AT EVERY WORK POLE, MANHOLE, FIBER, STORAGE LOOPS, SPLICE CASES AND WHERE INDICATED BY PROJECT MANAGER. TAGS NEED TO BE PLACED SO AS TO BE READ FROM THE GROUND. 5.CABLE LUBRICATION SHALL BE USED TO REDUCE PULLING TENSION. LUBRICANTS MUST NOT CONTAIN ANY PETROLEUM PRODUCTS. 6.A 100 FOOT FIBER COIL MUST REMAIN IN ALL VAULTS UNLESS OTHERWISE NOTED. 7.ALL BURIED INFRASTRUCTURE MUST BE ACCOMPANIED WITH WARNING TAPE AND A TRACER WIRE, AT RISER POLES THE LOCATE WIRE SHALL BE ACCESSIBLE AT THE BASE OF THE RISER. 8.ALL RISERS WILL BE CAPPED AT ALL TIMES. 9.ALL FIBER SHALL BE MARKED AS TO DIRECTION IN EACH VAULT. RED-NORTH, GREEN-SOUTH,YELLOW-EAST, AND BLUE-WEST. DO NOT TAPE FIBER CABLES TOGETHER IN RISER. 1. ALL VAULTS / HANDHOLES TO BE EQUIPPED WITH SECURITY LIDS WITH LOCKING BOLTS. 2. GROUND RESTORATION/RIGHT-OF-WAY SHALL BE RESTORED TO ORIGINAL OR BETTER CONDITION. 3. ALL 90 DEGREE BENDS IN CONDUIT CONSTRUCTION WILL BE A MINIMUM OF 36" RADIUS UNLESS SPECIFIED OTHERWISE. 4. BURIED FIBER OPTIC WARNING SIGNS SHALL BE PLACED AT EACH SIDE OF ALL ROAD CROSSINGS, AT CULVERTS, DITCHES AND IN A STRAIGHT LINE OF SIGHT SPACING OF APPROXIMATELY 500 FEET. 5. DEVIATIONS FROM THE ENGINEERED ROUTE REQUIRES A PROJECT MANAGER AND RIGHT-OF-WAY OWNER OR CARETAKER APPROVAL PRIOR TO CONSTRUCTION. 6. WHERE PERMITS FROM STATE, COUNTY, CITY, RAILROAD OR GOVERNMENT AGENCIES ARE REQUIRED, ALL WORK PERFORMED WILL COMPLY WITH THESE AGENCIES STANDARD SPECIFICATIONS. 7. THE PROJECT MANAGER WILL NOTIFY BUILDING MANAGEMENT WHEN WORK WILL BEGIN ON BUILDING. CONTRACTOR TO COORDINATE ROOM ACCESS AND WORK START AND STOP TIMES WITH BUILDING MANAGEMENT. 8. THE PROJECT MANAGER IS TO BE NOTIFIED BY THE CONTRACTOR 24 HOURS PRIOR TO CONSTRUCTION. SEE COMPANY CONTACT LIST FOR CONTACT NAME(s) AND TELEPHONE NUMBER(s). 9. THE PROJECT MANAGER WILL RESERVE THE RIGHT TO INSPECT AT ANY TIME THE WORK BEING PERFORMED BY THE CONTRACTOR. IF PROJECT MANAGER DETERMINES THAT THE WORK IS NOT BEING PERFORMED TO MINIMUM QUALITY STANDARDS, THEN THE CONTRACTOR SHALL PROVIDE REWORK AT HIS OWN COST. 10. ANY CHANGE IN PROJECT SCOPE, INCLUDING BUT NOT LIMITED TO, CONDUIT LENGTH, CONDUIT PATH, AERIAL PATH ETC., MUST BE APPROVED BY THE PROJECT MANAGER. 11. ALL CORING/CONSTRUCTION THAT WILL CAUSE NOISE AND/OR VIBRATION SHALL BE DONE WITHIN ALLOWED (9AM-3PM) BUSINESS HOURS. 12. ANY AND ALL UNDERGROUND UTILITIES ENCOUNTERED ARE THE RESPONSIBILITY OF THE CONTRACTOR TO LOCATE, PROTECT, AND REPAIR, IF DAMAGED. 13. ALL FOOTAGES ARE BASED ON FIELD GATHERED MEASUREMENTS, AS SUCH SOME VARIANCE SHOULD BE ANTICIPATED. ADJUST AS NEEDED. 14. ALL BURIED CONDUIT/CABLE WILL BE PLACED AT 36" MINIMUM COVER. SITE HAS POTENTIAL FOR ROCK THAT WOULD PREVENT THE ABILITY TO PROVIDE THE MINIMUM COVER. IN CASES WHERE THE MINIMUM COVER CAN NOT BE ACHIEVED, THE CONDUIT SHALL BE PLACED IN A SCH 40 EMT SLEEVE OR APPROVED EQUIVALENT. 15. WATER, SEWER, STORM SEWER AND EASEMENT LOCATIONS ARE BASED OFF OF CITY MAPS, NOT FIELD VERIFIED. 16. BORING OF AC PAVING IS REQUIRED AT ALL LOCATIONS AS INDICATED ON PLANS. 17. AT NO TIME SHALL CURBS, GUTTERS OR HANDICAP BE DISTURBED. 18.DOOR HANGERS ARE TO BE PLACED A MINIMUM OF 72 HOURS PRIOR TO START OF CONSTRUCTION. 19. PRIOR TO START OF CONSTRUCTION, CONTRACTOR SHALL PLACE MESSAGE BOARDS STATING LANE CLOSURES, AND DELAYS A WEEK IN ADVANCE. LOCATION OF THE MASSAGE BOARD SHALL BE COORDINATED WITH THE CITY INSPECTOR AT THE PRE-CONSTRUCTION MEETING. 20. LANE CLOSURES CANNOT EXCEED MORE THAN 300 FT. AT A TIME. FOR SAFETY PURPOSES THERE SHALL BE ONLY ONE CLOSURE AT A TIME ALONG INTERNATIONAL BLVD. MORE FLAGGERS WILL BE NECESSARY TO HELP VEHICLES AND PEDESTRIANS IN THE WORK ZONES DURING THE LANE CLOSURES. STORM DRAIN MANHOLE COMMUNICATIONS WATER SEWER POWER GAS 6 ROW PROPOSED VAULT PROPOSED BORE PIT STREET/SIGNAL/TRAFFIC LIGHT CONSTRUCTION NOTE CATCH BASIN FIRE HYDRANT EXISTING POLE W/ NEW RISER BUILDING OUTLINE TRAFFIC FLOW POTHOLE LOCATION CHANNELIZATION (xxx') OPEN TRENCH EXISTING PULL THRU PROPOSED BORE PROPOSED OPEN TRENCH (xxx') EXISTING PULL THRU (xxx') BORERIGHT-OF-WAY CENTERLINE TRAFFIC LANE FENCE D CB S C GAURD RAIL AERIAL STRAND LEGEND: U U U U U U S S W W P P C C G G D D EOP EDGE OF PAVEMENT POLE MFP19001595 EOPEOP EOP NE 6TH ST NE 6TH ST POLE-3 POLE-2POLE-1 EOPEOPEOPEOPEOP165'152'MONROE AVE NEMONROE AVE NEMONROE AVE NENEWPORT AVE NEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYEOPEOPEOPEOPEOPDRIVEWAYSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAY"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT3 123/20/2019PERMITMDBCOMCAST MID-SHEATH HERE AND TIE IN USING SLACK LOOP. OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 EOP EOPNE 6TH ST POLE-6POLE-5POLE-4155'112'153'101'OLYMPIA AVE NEOLYMPIA AVE NEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYEOP EOP EOP EOPEOPEOPEOPEOPEOP"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT4 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 NE 6TH STNE 6TH ST POLE-10 POLE-9POLE-8POLE-7 149'161'111'DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPSIDEWALK SIDEWALKDRIVEWAY "DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT5 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 NE 6TH STNE 6TH STNE 6TH ST POLE-12POLE-11POLE-10 176'167'202'QUEEN ANNE AVE NEQUEEN ANNE AVE NEQUEEN ANNE AVE NEQUEEN ANNE AVE NEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYEOPEOP EOP EOP EOP EOP EOPEOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALK "DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT6 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 FLFL NE 6TH STNE 6TH ST NE 6TH ST POLE-15POLE-14POLE-13 149'127'109'SHELTON PL NESHELTON AVE NEDRIVEWAYDRIVEWAYDRIVEWAYEOP EOP EOP EOP FL FL FL FL FL FL FLEOPEOPEOPEOPEOPEOP SIDEWALKSIDEWALKSIDEWALK "DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT7 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 NE 6TH ST NE 6TH STNE 6TH ST POLE-19 POLE-18 CROSS OVERPOLE-17 POLE-16 122'152'122'69'144'TACOMA AVE NETACOMA AVE NEUNION AVE NEUNION AVE NEDRIVEWAYDRIVEWAYDRIVEWAYEOP EOP EOP EOP EOP EOPEOPEOPEOPEOPEOPDRIVEWAY FL FL FL FL FL FL FL FL FL FL FL FL EOP EOP EOPEOPEOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKSIDEWALK"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT8 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND.OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 POLE-21 POLE-20 210'110'UNION AVE NEUNION AVE NEDRIVEWAY NE 5TH CT NE 5TH CT NE 5TH CT NE 5TH ST NE 5TH STEOPEOPEOP NE 5TH PL EOP EOPEOPEOPEOPEOP EOP EOP EOP SIDEWALK SIDEWALK SIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALK SIDEWALKSIDEWALK"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT9 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND. OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 POLE-23 POLE-22 173'57'44'UNION AVE NEUNION AVE NEUNION AVE NEUNION AVE NEDRIVEWAY D R I V E W A Y DRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY PRIVATE DRIVE EOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKEOP"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT10 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND. OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 POLE-25 POLE-24 76'138'176'UNION AVE NEUNION AVE NEUNION AVE NEDRIVEWAYDRIVEWAY NE 4TH PLNE 4TH PL EOPEOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKEOP EOPEOP EOP"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT11 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND. OVERLASH 144CT FIBER TO EXISTING STRAND. MFP19001595 POLE-27 POLE-26 53'UNION AVE NEDRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY NE 4TH PL NE 4TH PLNE 4TH PLNE 4TH PL EOPEOPEOPEOPEOPEOPEOPEOPDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALK SIDEWALK SIDEWALK SIDEWALKSIDEWALK SIDEWALK SIDEWALK SIDEWALKSIDEWALKEOPEOPEOP37 8 'UNION AVE NE"DELIVERING EXCELLENCE" SEFNCO COMMUNICATIONS OFDATEISSUE FOR:BYQCDATEREVISIONBYQC3304 NE 6TH STRENTON, WA310850PERMIT12 123/20/2019PERMITMDBCOMCAST OVERLASH 144CT FIBER TO EXISTING STRAND. END OF ROW DESIGN RISER DN ADD 200' SLACK PROOF/PULL THRU EXISTING CONDUIT. EXISTING VAULT MFP19001595 MFP19001595 MFP19001595 MFP19001595 April 23, 2019 Cody Shackett Comcast Cable Communications, LLC 410 Valley Ave NW Puyallup, WA 98371 Via Email: owen_shackett@comcast.com SUBJECT: Request for Undergrounding Exemption (JT#310850, MFP19001595, 3304 NE 6th Street) Dear Mr. Shackett: The City of Renton has reviewed your request to grant Comcast an exemption from Renton Municipal Code (RMC) 4-6-090(C) which states that all new electrical or communication facilities shall be required to be installed underground, pursuant to the standards of the section of RMC. Comcast proposes to have SEFNCO Communications overlash approximately 4,045 lineal feet of new 144- count aerial fiber to existing Puget Sound Energy (PSE) poles beginning at the northwest corner of Monroe Avenue NE and NE 6th Street intersection. The new fiber line will extend east along the north side of NE 6th Street, then south along the west side of Union Avenue NE to a location approximately 110 lineal feet north of NE 4th Street, and end at an existing pole located on the east side of Union Avenue NE approximately 85 lineal feet north of NE 4th Street. ANALYSIS: The City has considered the request for an exemption from RMC 4-6-090(D)(1)(h) ii. Ordinance 5720 grants Comcast, the right to install fiber optic cable and related appurtenances under, along, over, below, through and across the streets, avenues and alleys of City of Renton within the right-of-way of Renton. Section 3.4 of the franchise ordinance states that if all of the distribution lines all the wireline service providers, such as telecommunications service providers, as defined in RCW 35.99.010, a utility service provider or a Cable Operator (collectively “Service Providers”) in any portion of the Franchise Area are underground, Grantee shall place its Cable System’s distribution cables underground within that area; provided that such underground locations are actually capable of accommodating Grantee’s cable and other equipment without technical degradation of the Cable Systems’ signal quality. The proposal would utilize existing poles with other attached franchisee communication facilities and overlash to the existing Comcast aerial path. As minimum vertical height clearance of 15’-6” would need to be provided for, any existing obsolete cable will need to be removed; staff recommends these as conditions of approval. Therefore, the City is granting an exemption with conditions, per the Comcast franchise agreement which allows new overhead facilities to be placed overhead provided at there are other similar providers overhead as well. Comcast Job JT#310850 Page 2 of 2 April 23, 2019 DECISION: The requested exemption from underground utility installation requirements (RMC4-6-090 (C) as requested by the applicant is approved with conditions subject to the conditions below as the request complies with exemption criteria of RMC 4-6-090(D)(1)(h) ii, and the Comcast Franchise Agreement. Conditions of Approval: 1. Any existing height violations within the Project Reach must be resolved at the time of construction. New aerial lines within the Project Reach must have a minimum vertical clearance of 15’-6”. 2. Any abandoned or unused lines within the Project Reach must be removed at the time that construction is taking place. 3. A traffic control plan must be separately submitted to the City, and no construction may take place until the City has approved a traffic control plan. 4. The new aerial fiber lines within the Project Reach must be converted to underground facilities in the future, at Comcast’s cost, when any one of the following events occurs: (1) any other utilities are undergrounded within the Project Reach, (2) a joint use trench is proposed by a franchisee within the Project Reach, in which case Comcast shall participate in the joint use trench installation for the purpose of undergrounding its aerial lines, or (3) a conduit is made available within the Project Reach that will accommodate the aerial lines. The new aerial lines must be undergrounded within one year, or approved otherwise by the City of Renton Community and Economic Development Administrator or designee, from the first event triggering the requirement to underground the aerial lines. This decision to approve the exemption with conditions is subject to a fourteen (14) day appeal period from the date of this letter per RMC 4-8-110. Any appeals of the administrative decision must be filed with the City Clerk, along with the required appeal fee, by 5:00 pm, May 7, 2019. Sincerely, Brianne Bannwarth, PE Development Engineering Manager cc: C.E. “Chip” Vincent, CED Administrator Gregg Zimmerman, PW Administrator Jennifer Henning, Planning Director Justin Johnson, Civil Engineer III Scott Warlick, Engineering Specialist II Holly Powers, Permit Technician Pat Miller, Construction Inspection Supervisor Franchise Permits DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Conditions for Permit MFP19001595 Engineering 1 Engineering General Conditions A traffic control plan must be separately submitted to the City, and no construction may take place until the City has approved a traffic control plan. 2 Engineering General Conditions The new aerial fiber lines within the Project Reach must be converted to underground facilities in the future, at Comcast’s cost, when any one of the following events occurs: (1) any other utilities are undergrounded within the Project Reach, (2) a joint use trench is proposed by a franchisee within the Project Reach, in which case Comcast shall participate in the joint use trench installation for the purpose of undergrounding its aerial lines, or (3) a conduit is made available within the Project Reach that will accommodate the aerial lines. The new aerial lines must be undergrounded within one year, or approved otherwise by the City of Renton Community and Economic Development Administrator or designee, from the first event triggering the requirement to underground the aerial lines. 3 Engineering General Conditions Any abandoned or unused lines within the Project Reach must be removed at the time that construction is taking place. 4 Engineering General Conditions Any existing height violations within the Project Reach must be resolved at the time of construction. New aerial lines within the Project Reach must have a minimum vertical clearance of 15’-6”. Page 1 of 1