Loading...
HomeMy WebLinkAboutAgenda AGENDA Utilities Committee Regular Meeting 4:00 PM - Thursday, August 23, 2018 Council Conference Room, 7th Floor, City Hall – 1055 S. Grady Way 1. Varma and Ram Latecomer's Agreement a) AB - 2178 City Clerk recommends granting a 20-year latecomer agreement, File No. LA-17- 001, in the amount of $188,408, to Kushal Varma and Kajal Ram for sewer main extension on SE 132nd St., and authorize staff to finalize the latecomer agreement per City Code, including directing the City Clerk to notify affected property owners. 2. Annual Cedar River Sediment Survey and Analysis Agreement a) AB - 2196 Utility Systems Division recommends approval of an agreement with Northwest Hydraulic Consultants, Inc., in the amount of $132,377, for the Annual Cedar River Sediment Survey and Analysis project. 3. Heather Downs Detention Pond Water Quality Retrofit Project Grant Agreement a) AB - 2197 Utility Systems Division recommends approval of the Water Quality Grant Agreement WQC-2017-Renton-00002, with the Department of Ecology, to accept $93,000 in grant funds for the Heather Down Detention Pond Water Quality Retrofit project. A $31,000 city match is required. 4. Emerging Issues in Utilities AB - 2178 City Council Regular Meeting - 13 Aug 2018 SUBJECT/TITLE: Latecomer's Agreement Request: Final Approval for Sanitary Sewer Extension on SE 132nd St (Varma & Ram, Petitioners) File: LA-17-001 RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: City Clerk STAFF CONTACT: Jason Seth, City Clerk EXT.: 6502 FISCAL IMPACT SUMMARY: N/A SUMMARY OF ACTION: City Code allows the City to grant a latecomer agreement when sanitary sewer facilities are installed by a developer, in order to ensure that each property benefiting from the new facility be assessed its fair share of the costs. On June 5, 2017, Council granted preliminary approval of a latecomer agreement request (LA-17- 001) to Kushal Varma and Kajal Ram. Following construction and determination of actual costs, staff presents the latecomer agreement for final approval by Council. Kushal Varma and Kajal Ram have installed the agreed upon improvement and transferred title of these improvements to the City. The final authorized cost is $188,408. EXHIBITS: A. Issue Paper B. Latecomer Agreement STAFF RECOMMENDATION: Grant a final 20-year latecomer agreement (LA-17-001) to Kushal Varma and Kajal Ram for a sanitary sewer main extension on SE 132nd St., in the amount of $188,408, and authorize staff to finalize the latecomer agreement per City Code. AGENDA ITEM #1. a) DEPARTMENT OF COMMUNITY & ECONOMIC DEVELOPMENT DATE: TO: VIA: FROM: STAFF CONTACT: SUBJECT: M E M O R A N D U M August 13, 2018 Ed Prince, Council President Members of Renton City Council Denis Law, Mayor Chip Vincent, CED Administrator Rohini Nair, Plan Review (x-7298) Varma/Ram, Latecomer Agreement LA-17-001 Sanitary Sewer Extension SE 132nd Street ISSUE: Does Council wish to grant final approval for a 20-year latecomer agreement (LA-17-001) Kushal Varma and Kajal Ram, for the installation of 538 lineal feet of sewer main along SE 132nd Street west of 156th Ave SE? RECOMMENDATION: Grant Kushal Varma and Kajal Ram request for a latecomer agreement and give final approval for a latecomer agreement to extend the sanitary sewer main along SE 132nd Street west of 156th Ave SE. BACKGROUND SUMMARY: On May 4, 2017, Kushal Varma and Kajal Ram submitted an application for a latecomer agreement. This latecomer agreement would allow the applicants, Kushal Varma and Kajal Ram, to recover a portion of the costs associated with extending sewer main along SE 132nd Street west of 156th Ave SE. On June 5, 2017, Council granted preliminary approval of the Varma/Ram latecomer request. At that time, the estimated cost of the proposed sewer was $188,408.00. Latecomer agreements are contracts between the City and a developer for construction of public works facilities and authorize reimbursement of a developer by other property owners who did not contribute to the origin a I cost of the facilities and who subsequently tap into or use the facilities. The proposed latecomer agreement would AGENDA ITEM #1. a) Varma/RamLatecomerAgreement LA-17-001 Page 2 of 2 AUgust 13, 2018 require the owners of benefiting properties to pay an equitable share of the cost of these facilities if they decide to use these facilities. The propeties to be included in the proposed latecomer agreement did not previously have sewer service available. The facility installed is a local service facility, and as such, will only benefit the properties directly adjacent to the new main. Because the only benefiting parcels are those that front the facility, we have established a direct benefit charge only. For this area, we chose to calculate the benefited area utilizing a per unit connection method. This method takes the number of expected connections (fourteen) and divides the cost of the sewer improvements equally to determine an assessment amount. As allowed by City code, developers may ask for reimbursement of a per unit portion of the original costs for public works facilities they install and turn over to the City. Kushal Varma and Kajal Ram have extended sewer to serve properties that did not have sewer service available. Thus, having installed all of the agreed upon improvements, and having transferred title to all of the improvements to the City, the developer has completed all of the actions required of him to finalize this latecomer agreement. The final cost of the installed sewer is $188,408.00 which is the same amount as the preliminary estimate. The number of expected connections is 14. Therefore, the assessment, based upon the final cost, is $13,457.71 per unit connection. CONCLUSION: City code allows that when sanitary sewer facilities are installed by a developer that the City grant a latecomer agreement in order to ensure that each property that benefits from the new facility be assessed its fair share of the costs. Following construction and the determination of actual costs, staff presents the latecomer agreement for final approval by Council. Therefore, we recommend that Council approve staf's request to grant a final 20-year latecomer agreement (LA-17-001} to Kushal Varma and Kajal Ram for the installation of 538 lineal feet of sewer main along SE 132nd Street. Attachments cc: Denis Law, Mayor Jennifer T. Henning, Planning Director Lys Hornsby, Utility Systems Director David Christensen, Wastewater Utility Manager Brianne Bannwarth, Development Engineering Manager File AGENDA ITEM #1. a) Page 1 Return Address:  City Clerk’s Office  City of Renton  1055 South Grady Way  Renton, WA 98057          Title:  LATECOMER’S AGREEMENT Property Tax Parcel Numbers:    142305‐9092; 144260‐0100; 144260‐0110;   144260‐0120; 144260‐0130; 142305‐9100;  142305‐9093; 142305‐9116; 142305‐9115;   142305‐9114; 142305‐9079  Project File #:  PRM27‐00049, LA‐17‐001  Grantor(s): Grantee(s):  1. City of Renton, a Municipal Corporation 1.  Kushal S. Varma; and   2.  Kajal A. Ram  Complete legal description is in Exhibit “B”of this document.  ABBREVIATED LEGAL DESCRIPTION:   A portion of the Northwest Quarter of Section 14, Township 23 North, Range 5 East, Willamette  Meridian, King County, Washington, as described in Exhibit “B”.    THIS LATECOMER’S AGREEMENT (“Agreement”) made and entered into this    day of   ______,  20 , by and between the CITY OF RENTON, hereinafter referred to as the “Grantor” or “City,” and  KUSHAL S. VARMA and KAJAL A. RAM, husband and wife, hereinafter collectively referred to as the  “Grantee” or “Developer.” The City and Developer are collectively referred to herein as the “Parties”; and    WHEREAS, on August 24, 2017 the Developer sold the property to the current owner Sierra Homes, Inc.,  however the Developer retained the rights to enter into this Agreement with the City and to collect the  latecomer  fees collected by the City pursuant to this Agreement; and  WHEREAS, the Developer has installed certain utility systems and appurtenances thereto at, near, or  within the described property and has connected same to the City’s utility system so that such  improvements now are an integral part thereof; and  WHEREAS, no other property owners or users have shared in the cost and expense of construction of such  improvements, and the Parties hereto having in mind the provisions and terms of Chapter 35.91 RCW (the  Municipal Water and Sewer Facilities Act), specifically RCW 35.91.020 (Contracts with owners of real  estate for water or sewer facilities—Requirements—Financing—Reimbursement of costs); and  WHEREAS, the Developer has paid all the costs and expenses for the installation of said improvements;  and  AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 2   WHEREAS, the owners of record of the benefited properties listed in Exhibit ”D” received the following  notices:  A. A Notice of Potential Assessment on June 8, 2017; and no appeal was filed within twenty (20)  days of the notice mailing; and   B. A Notice of Potential Final Assessment on ________, 2018; and no appeal was filed within  twenty (20) days.    NOW, THEREFORE, IT IS HEREBY AGREED AND COVENANTED BY AND BETWEEN THE PARTIES AS  FOLLOWS:  1. The Developer hereby acknowledges and covenants that at the time of preliminary approval  of this Agreement by the Renton City Council it was the owner of the property described in Exhibit “A”  and the Developer further agrees and covenants that it has not assigned any rights to collect the  latecomer’s fees described herein to any other party.  Developer hereby acknowledges and covenants that on August 24, 2017, the Developer sold the property  to the current owner Sierra Homes, Inc., however the Developer retained the rights to enter into this  Agreement with the City and to collect the latecomer fees collected by the City pursuant to this  Agreement.  2. The Developer has installed the following described improvements (hereinafter  “improvements”), to wit:   A. 538 Linear Feet of 8” PVC Sewer Main; and    B. 2 – 48” Diameter Manholes.     and such installation made according to plans and specifications approved by the City, made in full  compliance with the Developer’s obligations under this Agreement, and all applicable codes and  regulations of the City. Developer acknowledges all improvements are subject to inspection and approval  of the City.    Developer covenants that said improvements are fit for the use for which they are intended. Developer  guarantees the workmanship and materials in said improvements for a period of two (2) years after the  date of acceptance by the City.  3. The Developer further covenants and warrants that all expenses and claims in connection  with the construction and installation of the improvements, whether for labor or materials or both, have  been or will be paid in full, all at the Developer’s expense, and the Developer covenants and agrees to  hold the City harmless from any liability in connection therewith.  AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 3   4. The Developer further certifies that the total cost of said construction as herein above  specified is $188,408.00.  The legal descriptions of the benefitted properties which comprise the  latecomer boundary are attached hereto as Exhibit “B”. The map of the latecomer’s boundary is attached  hereto as Exhibit “C”. The Final Assessment Roll detailing the benefited properties’ legal descriptions and  the amount of the assessment for each property is attached hereto as Exhibit “D”.   5. The total amount of the cost of said improvement shall be employed to determine the pro  rata reimbursement to the Developer by any owner of real estate who did not contribute to the original  cost of such improvement, and who subsequently taps into, or hooks up to, or benefits from said facilities,  which tap or hookup shall include connections to lateral or branches connecting thereto, all subject to the  laws and ordinances of the City and the provisions of this Agreement.  Total Cost associated with latecomer work:  $188,408.00  The method of assessment to be used:    Per Unit Connection  Number of Units (including developer share):  14  The pro rata cost is:      $13,457.71 per Unit  The portion of the cost Developer responsible for: $13,457.71  The portion of total cost that may be reimbursed: $174,950.29  6. Criteria for Triggering of Latecomer Assessment: The assessment from this Agreement will  be triggered when a property within the latecomer boundary area benefits from the facility either through  connecting to the sewer main or by utilizing the sewer main to fulfill a condition of further developing  their property.  7. It is hereby found and determined that the construction and installation of said improvements  is in the public interest.  8. The Developer hereby agrees and covenants that the City shall verify and approve all contracts  and costs related to the improvements.  9. The Developer hereby agrees and covenants, at its sole cost, to convey, transfer, and assign  unto the City all rights, interest and title in and to said improvements and all appurtenances and  accessories thereto, free from any claim and encumbrance of any party whomsoever; City agrees to  accept and maintain said improvement as part of its present system upon approval thereof by the  Administrator of the Public Works Department or his/her authorized representative and after inspection  of said construction. The Developer further agrees and covenants to execute and to deliver unto the City  any and all documents including Quitclaim Deeds and Bills of Sale that may reasonably be necessary to  fully vest title to the City and to effectuate this conveyance and transfer, at its sole cost.  10. The Developer agrees and covenants to pay unto the City such service charges or other  charges as may be imposed by the City for use of the improvements for which this agreement is granted.   AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 4   11. The City reserves the right, without affecting the validity or terms of this Agreement, to make  or cause to be made extensions to or additions of the above improvements and to allow service  connections to be made to said extensions or additions, without liability on the part of the City.   12. No person, firm, or corporation shall be granted a permit to use or be authorized to tap into  the facility during the period of twenty (20) years (unless extended by the City Council) from the date  hereof, without first paying unto the City, in addition to any and all other costs, fees, and charges made  or assessed for each tap, or for the main facilities constructed in connection therewith, the amount  required by the provisions of this Agreement except such charges shall not apply to any extension of the  main facility. Furthermore, in case any tap, hookup, or connection is made into any such contracted facility  without such payment having been first made, the legislative body of the City may cause to have removed  such unauthorized tap, hookup, or connection, and all connections or related accessories located in the  facility or right‐of‐way, and dispose of such unauthorized material so removed, without any liability on  the part of the City whatsoever. It is further agreed, and covenanted that upon expiration of the terms of  this Agreement; to wit: twenty (20) years (unless extended by the City Council) from date hereof, the City  shall be under no further obligation to collect or make any further sums unto the Developer.  13. The decision of the Administrator of the Public Works Department or his/her authorized  representative in determining or computing the amount due from any benefited owner who wishes to  hookup to such improvement shall be final and conclusive in all respects.  14. It is further agreed and understood that the improvements constructed and paid for by the  Developer have been connected to the utilities system of the City, and upon acceptance by the City  through its legislative body, said extension and/or improvements shall be and become a part of the  municipal utilities system.  15. This Agreement shall be placed for record with the King County Recorder’s Office within thirty  (30) days of final execution of the Agreement, at Developer’s sole cost.  16. Before the City will collect any latecomer’s fee, the Developer will, at its sole cost, transfer  title to all of the improvements under this Agreement to the City.    17. The Developer covenants and agrees to be responsible for notifying the City if the rights  hereunder are sold or transferred, and to whom the latecomer’s fee should be paid. The Developer further  covenants and agrees to be responsible for keeping the City informed of its correct mailing address.   A. Pursuant to RCW 35.91.020(6) and RMC 9‐5‐11 The Developer agrees and covenants that it  shall every two (2) years from the date this Agreement is executed provide the City with  information regarding the current name, address and telephone number of the Developer.   B If Developer fails to comply with the notification requirements herein stated within sixty (60)  days of the specified time, the Developer hereby assigns to the City the benefit and right to  the latecomer’s fees and the City may collect latecomer’s fees owed to the Developer, which  shall be deposited in the City’s capital fund.  AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 5   C. Pursuant to RMC 9‐5‐11 should the City be unable to locate the holder of this Agreement in  order to deliver a latecomer fee, the City shall undertake an independent investigation to  determine the location of the Developer. Should the City after a good faith attempt to locate  the Developer be unable to do so, then the latecomer’s fee shall be placed in the Special  Deposit Fund held by the City for two (2) years. At any time within the two‐year period the  Developer may receive the latecomer’s fee, without interest, by applying to the City for that  latecomer’s fee.  After the expiration of the two‐year period, all rights of the Developer to  that fee shall expire, and the City shall be deemed to be the owner of those funds.  D. Pursuant to RMC 9‐5‐10 when the City has received the funds for a latecomer’s fee, it will  forward that fee, less an administration and collection fee as described in Section 18 below,  to the Developer within thirty (30) days of receipt of the funds. Funds received by negotiable  instrument, such as a check, will be deemed received ten (10) days after delivery to the City.  Should the City fail to forward the latecomer’s fee to the Developer through the City’s sole  negligence, then the City shall pay the Developer interest on those monies at the rate of  twelve (12%) percent per annum. However, should the Developer not keep the City informed  of its current correct mailing address, or should the Developer otherwise be negligent and  thus contribute to the failure of the City to pay over the latecomer’s fee, then no interest shall  accrue on late payment of the latecomer’s fee.  E. Notices: All notices pursuant to this Agreement shall be sent to the following addresses:     City of Renton:    City Clerk  City of Renton  1055 South Grady Way  Renton, WA 98057    Developer:    Kushal S Varma & Kajal A Ram  2609 NE 5th CT  Renton, WA 98056  Receipt of any notice shall be deemed effective three (3) days after deposit of written notice in  the U.S. mail with proper postage and address.    18. The City shall collect an administration and collection fee at the time funds are collected under  this Agreement.  The amount of the fee retained by the City when funds are collected will be a percentage  based upon the following:  A. If the portion of total cost that may be reimbursed is $20,000 or less, the City will retain a fee  equal to fifteen percent (15%) of each amount collected under this Agreement.  AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 6   B. If the portion of total cost that may be reimbursed is more than $20,000 but not more than  $100,000, the City will retain a fee equal to ten percent (10%) of each amount collected under  this Agreement.  C. If the portion of total cost that may be reimbursed is more than $100,000, the City will retain  a fee equal to five percent (5%) of each amount collected under this Agreement.  19. This Agreement is granted for a period of up to but not to exceed twenty (20) years. This  Agreement will expire at the end of the period of time established by the City Council unless the City  Council agrees to extend it in accordance with RCW 35.91.020(4) as it exists or is hereinafter amended.  20. By instituting this Agreement, the City does not agree to assume any responsibility to enforce  this Agreement. The recorded Agreement will be a matter of public record and will serve as a notice to  the owners of the benefited properties should connection to the improvements be made.  The assessment  roll listing the benefited properties and the pro rata potential latecomer charge for each will be on file  with the City.  The Developer has responsibility to monitor those parties connecting to the improvement.   Should the City become aware of such a connection it will use its best efforts to collect the latecomer’s  fee, but shall not incur any liability should it inadvertently fail to collect the latecomer’s fee.  21. Indemnification: The Developer agrees to indemnify, defend and hold the City harmless from  any and all liability resulting from:  A. Any claims asserted by any third party:   1.  To said improvements and all appurtenances and accessories thereto, which  improvements are to be free from any claim and encumbrance of any party  whomsoever; and   2. To the right to receive the latecomer fees collected pursuant to this Agreement.  B. Regarding the accuracy of the legal descriptions contained herein. The City is relieved of all  responsibility under this Agreement for collecting from properties not properly included in  the descriptions set forth in this Agreement.   22.  Laws, Venue, Jurisdiction, Severability: This Agreement is entered into under the laws of the  State of Washington, and Washington law shall apply to the interpretation thereof.  Venue and Jurisdiction to enforce all obligations under this Agreement shall lie in King County  Superior Court.  In the event a court of competent jurisdiction declares any material provision of Agreement  invalid, unconstitutional, or otherwise unenforceable, any Party may elect to terminate the remainder of  this Agreement. In the event a non‐material provision of this Agreement is declared invalid,  AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 7   unconstitutional or otherwise unenforceable, such provisions hereof as are not affected by such  declaration shall remain in full force and effect.   22. This Agreement contains the entire agreement between the Parties and may only be modified  by the written agreement of the Parties.     CITY OF RENTON      By:           Denis Law, Mayor  ATTEST:    By:          Jason A. Seth, City Clerk        STATE OF WASHINGTON ) SS  COUNTY OF KING  )    I certify that I know or have satisfactory evidence that Denis Law is the person who appeared before me, and who  signed this instrument, on oath stated that he was authorized to execute the instrument and acknowledged as the  Mayor of the City of Renton to be to be the free and voluntary act of such party for the uses and purposes  mentioned in the instrument.      _______________________________________________  Notary Public in and for the State of Washington   Notary (Print) ____________________________________  My appointment expires:___________________________  Dated: __________________________________________                      AGENDA ITEM #1. a) PRM27‐0049: SEWER MAIN EXTENSION ON SE 132ND ST   (VARMA & RAM PETITIONERS) LATECOMER AGREEMENT (LA‐17‐001)  Page 8    DEVELOPER             By:     _____  Kushal S. Varma    By:     _____  Kajal A. Ram      STATE OF WASHINGTON ) SS  COUNTY OF KING  )    I certify that I know or have satisfactory evidence that Kushal S. Varma signed this instrument and acknowledged it  to be his/her free and voluntary act for the uses and purposes mentioned in the instrument.       _______________________________________________  Notary Public in and for the State of Washington   Notary (Print) ____________________________________  My appointment expires:___________________________  Dated: __________________________________________        STATE OF WASHINGTON ) SS  COUNTY OF KING  )    I certify that I know or have satisfactory evidence that Kajal A. Ram signed this instrument and acknowledged it to  be his/her free and voluntary act for the uses and purposes mentioned in the instrument.       _______________________________________________  Notary Public in and for the State of Washington   Notary (Print) ____________________________________  My appointment expires:___________________________   Dated: __________________________________________        Exhibits:    Exhibit “A” –Legal Description of Developer’s Property  Exhibit “B” –Legal Descriptions of Benefited Properties Which Comprise the Latecomer Boundary   Exhibit “C” – Map of Latecomer’s Boundary  Exhibit “D” –Final Assessment Roll  AGENDA ITEM #1. a) Exhibit "A" Legal Description of Developer's Property PARCEL 7 TL# 142305-9092 Current owner : Sierra Homes Inc. ( previous owner at time of preliminary latecomer: Kushal Varma & Kajal Ram) That portion of the South Quarter of the South Half of the Northeast Quarter of the Northwest quarter of Section 14, Township 23 North, Range 5 East, W.M., in King County, Washington, described as follows; Beginning at the North quarter corner of said section; Thence along the centerline of said section South 0°28’50” West, 1133.20 feet; thence North 88°11’32” West, 30 feet; thence South 0°28’50” west 78.77 feet to the true point of beginning for this description; thence continuing South 0°28’50” West 42.98 feet; thence along a curve to the right having a radius of 35.00 feet, an arc distance of 55.80 feet, through a central angle of 91°21’02”; thence North 88°10’08” West 89.17 feet; thence North 0°28’50” East 78.76 feet; thence South 88°11’32” East 125.00 feet to the true point of beginning. AGENDA ITEM #1. a)   LEGAL DESCRIPTIONS OF BENEFITED PARCELS WHICH  COMPRISE THE LATECOMER BOUNDARY ‐ Page 1 of 5  Exhibit “B”  Legal Descriptions of Benefited Properties Which  Comprise the Latecomer Boundary    PARCEL 1    KC Tax Act # 1442600100    15413 SE 132nd Street, Renton, WA 98059‐6719     Lot 10, Cedar Crest Estates, According to the Plat thereof Recorded in Volume 95 of Plats, page  54, Records of King County, Washington.    PARCEL 2            KC Tax Act # 1442600110    15421 SE 132nd Street, Renton, WA 98059‐6719  Lot 11, Cedar Crest Estates, According to the Plat thereof Recorded in Volume 95 of Plats, page  54, Records of King County, Washington.    PARCEL 3    KC Tax Act # 1442600120   15429 SE 132nd Street, Renton, WA 98059‐6719  Lot 12, Cedar Crest Estates, According to the Plat thereof Recorded in Volume 95 of Plats, page  54, Records of King County, Washington.    PARCEL 4  KC Tax Act #  1442600130   15437 SE 132nd Street, Renton, WA 98059‐6719   Lot 13, Cedar Crest Estates, According to the Plat thereof Recorded in Volume 95 of Plats, page  54, Records of King County, Washington.    AGENDA ITEM #1. a)   LEGAL DESCRIPTIONS OF BENEFITED PARCELS WHICH  COMPRISE THE LATECOMER BOUNDARY ‐ Page 2 of 5  PARCEL 5    KC Tax Act #  1423059100   15515 SE 132nd Street, Renton, WA 98059‐6719   The west 75 feet of the east 200 feet of the following described property:    That portion of the southeast quarter of the Northwest quarter of  Section 14, Township 23  North, Range 5 East, W.M, in King County, Washington, described as follows:    Beginning at a point North 89°55'44" West 30 feet and North 00°28'02"  West, 1,132.57 feet  from the center of said Section 14; Thence continuing parallel to the east line of said Southeast  quarter of the Northwest quarter North 00°28'02" West 157.51 feet, more or less; to an  intersection with a line 30 feet Southerly and parallel to the North line of said Southeast  quarter of the Northwest quarter; Thence along said parallel line North 89°06'36" West,  1,249.03 feet; Thence 30 feet Easterly of and parallel to the West line of said subdivision, South  00°33'02" East 157.07 feet to a point which bears North 89°05' 16" West from the point of  beginning; Thence south 89°05'16" east 1,248.79 feet to the point of beginning.    PARCEL 6    KC Tax Act #  1423059093   13203 156th Ave SE, Renton, WA 98059‐6719  The East 125 feet of the North 78 ½ feet of the East 200 feet of the following tract of land; That  portion of the Southeast quarter of the Northwest quarter of Section 14, Township 23 North,  Range 5 East, W.M., in King County, Washington, described as follows; Beginning at a point  North 88°55’44” West 30 feet and North 0°28’02” West 1132.57 feet from the center of said  section 14; Thence continuing parallel to the East line of said Southeast quarter of the  Northwest quarter. North 0°28’02” West  157.51 feet, more or less, to an intersection with a  line 30 feet Southerly and parallel to the North line of said Southeast quarter of the Northwest  quarter; Thence along said parallel line North 89°06’36” West 1249.03 feet; Thence 30 feet  Easterly  of and parallel to the West line of said subdivision South 0°33’02” East 157.07 feet to a  point which bears North 89°05’16” West from the point of beginning; Thence South 89°05’16”  East 1248.79 feet to the true point of beginning.    Parcel 7    KC Tax Act #  1423059092  15522 SE 132nd Street,  Renton, WA 98059‐6719  AGENDA ITEM #1. a)   LEGAL DESCRIPTIONS OF BENEFITED PARCELS WHICH  COMPRISE THE LATECOMER BOUNDARY ‐ Page 3 of 5  That portion of the South Quarter of the South Half of the Northeast Quarter of the Northwest  quarter of Section 14, Township 23 North, Range 5 East, W.M., in King County, Washington,  described as follows; Beginning at the North quarter corner of said section; Thence along the  centerline of said section South 0°28’50” West, 1133.20 feet; thence North 88°11’32” West, 30  feet; thence South 0°28’50” west 78.77 feet to the true point of beginning for this description;  thence continuing South 0°28’50” West 42.98 feet; thence along a curve to the right having a  radius of 35.00 feet, an arc distance of 55.80 feet, through a central angle of 91°21’02”; thence  North 88°10’08” West 89.17 feet; thence North 0°28’50” East 78.76 feet; thence South  88°11’32” East 125.00 feet to the true point of beginning.    PARCEL  8    KC Tax Act # 1423059116       15514 SE 132nd Street, Renton, WA 98059‐6719  Lot D of Lot Line Adjustment Application recorded under Auditor's File No; 8410010783, being a  portion of the following:    Lot 4 of King County Short Plat No. 484056, recorded under King County Recording No.  8409130561, being a portion of the South half of that portion of the South half of the Northeast  quarter of the Northwest quarter of Section 14, Township 23 North, Range 5 East, W.M.; In King  County, Washington, lying North of the South 30 feet of said South half,  TOGETHER WITH the South 30 feet of the Northeast quarter of the Northwest quarter of said  section  EXCEPT the West 595.72 feet;  EXCEPT that portion described as follows: Beginning at the North quarter corner of said section;  thence along the center line of said Section South 00°28'50" West, 1133.20 feet; thence North  88°11'32" West, 30.01 feet to the TRUE POINT of BEGINNING for this description; thence South  00°28'50" West, 121.75 feet; Thence along a curve to the right having a radius of 35.00 feet, an  arc distance of 55.80 feet, through a central angle of 91°21'02"; Thence North 88°10'08" West,  89.17 feet; Thence North 00°28'50” East, 157.53 feet, Thence South 88°11'32" East; 125 feet to  the TRUE POINT OF BEGINNING.    EXCEPT that portion described as follows: Beginning North 88°10'08" West, 488.91 feet and  North 01°49'52" East, 30 feet from the Southeast corner thereof; Thence North 01°49'52" East,  157.35 feet; Thence North 88°11'32" West, 83.30 feet, Thence South 01°49'52" West, 175.31  feet; Thence South 88°10'08" East, 83.30 feet to the TRUE POINT OF BEGINNING  and EXCEPT  the East 30 feet of the remainder thereof.    AGENDA ITEM #1. a)   LEGAL DESCRIPTIONS OF BENEFITED PARCELS WHICH  COMPRISE THE LATECOMER BOUNDARY ‐ Page 4 of 5    PARCEL 9    KC Tax Act # 1423059115       15430 SE 132nd Street, Renton, WA 98059‐6719  Lot C of Lot Line Adjustment Application recorded under Auditor's File No; 8410010783, being a  portion of the following:    A portion of Lot 3 of King County Short Plat No. 484056, recorded under King County Recording  No. 8409130561, being a portion of the South half of that portion of the South half of the  Northeast quarter of the Northwest quarter of Section 14, Township 23 North, Range 5 East,  W.M.; In King County, Washington, lying North of the South 30 feet of said South half,  TOGETHER WITH the South 30 feet of the Northeast quarter of the Northwest quarter of said  section  EXCEPT the West 595.72 feet;  EXCEPT that portion described as follows: Beginning at the North quarter corner of said section;  thence along the center line of said Section South 00°28'50" West, 1133.20 feet; thence North  88°11'32" West, 30.01 feet to the TRUE POINT of BEGINNING for this description; thence South  00°28'50" West, 121.75 feet; Thence along a curve to the right having a radius of 35.00 feet, an  arc distance of 55.80 feet, through a central angle of 91°21'02"; Thence North 88°10'08" West,  89.17 feet; Thence North 00°28'50” East, 157.53 feet, Thence South 88°11'32" East; 125 feet to  the TRUE POINT OF BEGINNING.    EXCEPT that portion described as follows: Beginning North 88°10'08" West, 488.91 feet and  North 01°49'52" East, 30 feet from the Southeast corner thereof; Thence North 01°49'52" East,  157.35 feet; Thence North 88°11'32" West, 83.30 feet, Thence South 01°49'52" West, 175.31  feet; Thence South 88°10'08" East, 83.30 feet to the TRUE POINT OF BEGINNING  and EXCEPT  the East 30 feet of the remainder thereof.      PARCEL 10    KC Tax Act #  1423059114       15418 SE 132nd Street, Renton, WA 98059‐6719  Lot A of Lot Line Adjustment Application recorded under Auditor's Fl1e No; 8410010783, being  a portion of the following:    AGENDA ITEM #1. a)   LEGAL DESCRIPTIONS OF BENEFITED PARCELS WHICH  COMPRISE THE LATECOMER BOUNDARY ‐ Page 5 of 5  Lot 2 and 3 of King County Short Plat No. 484056, recorded under King County Recording No.  8409130561, being a portion of the South half of that portion of the South half of the Northeast  quarter of the Northwest quarter of Section 14, Township 23 North, Range 5 East, W.M.; In King  County, Washington, lying North of the South 30 feet of said South half,  TOGETHER WITH the South 30 feet of the Northeast quarter of the Northwest quarter of said  section  EXCEPT the West 595.72 feet;  EXCEPT that portion described as follows: Beginning at the North quarter corner of said section;  thence along the center line of said Section South 00°28'50" West, 1133.20 feet; thence North  88°11'32" West, 30.01 feet to the TRUE POINT of BEGINNING for this description; thence South  00°28'50" West, 121.75 feet; Thence along a curve to the right having a radius of 35.00 feet, an  arc distance of 55.80 feet, through a central angle of 91°21'02"; Thence North 88°10'08" West,  89.17 feet; Thence North 00°28'50” East, 157.53 feet, Thence South 88°11'32" East; 125 feet to  the TRUE POINT OF BEGINNING.  EXCEPT that portion described as follows: Beginning North 88°10'08" West, 488.91 feet and  North 01°49'52" East, 30 feet from the Southeast corner thereof; Thence North 01°49'52" East,  157.35 feet; Thence North 88°11'32" West, 83.30 feet, Thence South 01°49'52" West, 175.31  feet; Thence South 88°10'08" East, 83.30 feet to the TRUE POINT OF BEGINNING  and EXCEPT  the East 30 feet of the remainder thereof.      PARCEL 11      KC Tax Act # 1423059079         15416 SE 132nd Street, Renton, WA 98059‐6719  Lot B of King County Lot Line adjustment number 984076, under King County recording number  8410010783, in King County, Washington  Situate in the County of King State of Washington.      AGENDA ITEM #1. a) Affected Parcels Varma.Ram Latecomers AgreementNOTE: Lots 1 thru 7 & 11 max 1 unitLots 8 thru 10 max 2 unitsExhibit "C"MAP OF LATECOMER BOUNDARY AGENDA ITEM #1. a) Exhibit “D”  CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Type: Sanitary Sewer Improvements Total Cost:  $188,408.00      Latecomer PRM‐27‐0049: Collection Line   Total  Cost: $188,408.00   Total Units/ Connections 14   Cost per Unit / Connection: $13,457.71    Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and   Number of Units  FINAL ASSESSMENT ROLL ‐ Page 1 of 7  Parcel # 1 LESLIE, ANNETTE MARIE  15413 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1442600100     Legal Description: LOT 10, CEDAR CREST ESTATES, ACCORDING TO THE PLAT THEREOF RECORDED IN  VOLUME 95 OF PLATS, PAGE 54, RECORDS OF KING COUNTY, WASHINGTON.  Parcel # 2 BOSSE, MITCHELL E  15421 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1442600110     Legal Description: LOT 11, CEDAR CREST ESTATES, ACCORDING TO THE PLAT THEREOF RECORDED IN  VOLUME 95 OF PLATS, PAGE 54, RECORDS OF KING COUNTY, WASHINGTON.  Parcel # 3 MILLETT, CLINTON EARL &  SANDRA  15429 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1442600120     Legal Description: LOT 12, CEDAR CREST ESTATES, ACCORDING TO THE PLAT THEREOF RECORDED IN  VOLUME 95 OF PLATS, PAGE 54, RECORDS OF KING COUNTY, WASHINGTON.  AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 2 of 7  Parcel # 4 BERAVOL, POOJITHA, &  BHATNAGAR, ANANT  15437 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1442600130     Legal Description: LOT 13, CEDAR CREST ESTATES, ACCORDING TO THE PLAT THEREOF RECORDED IN  VOLUME 95 OF PLATS, PAGE 54, RECORDS OF KING COUNTY, WASHINGTON.  Parcel # 5 ENGEL, TERRY W &  CHRISTIE A  15515 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1423059100     Legal Description: THE WEST 75 FEET OF THE EAST 200 FEET OF THE FOLLOWING DESCRIBED  PROPERTY:    THAT PORTION OF THE SOUTHEAST QUARTER OF THE NORTHWEST QUARTER OF   SECTION 14, TOWNSHIP 23 NORTH, RANGE 5 EAST, W.M, IN KING COUNTY,  WASHINGTON, DESCRIBED AS FOLLOWS:    BEGINNING AT A POINT NORTH 89°55'44" WEST 30 FEET AND NORTH 00°28'02"   WEST, 1,132.57 FEET FROM THE CENTER OF SAID SECTION 14; THENCE  CONTINUING PARALLEL TO THE EAST LINE OF SAID SOUTHEAST QUARTER OF THE  NORTHWEST QUARTER NORTH 00°28'02" WEST 157.51 FEET, MORE OR LESS; TO  AN INTERSECTION WITH A LINE 30 FEET SOUTHERLY AND PARALLEL TO THE  NORTH LINE OF SAID SOUTHEAST QUARTER OF THE NORTHWEST QUARTER;  THENCE ALONG SAID PARALLEL LINE NORTH 89°06'36" WEST, 1,249.03 FEET;  THENCE 30 FEET EASTERLY OF AND PARALLEL TO THE WEST LINE OF SAID  SUBDIVISION, SOUTH 00°33'02" EAST 157.07 FEET TO A POINT WHICH BEARS  NORTH 89°05' 16" WEST FROM THE POINT OF BEGINNING; THENCE SOUTH  89°05'16" EAST 1,248.79 FEET TO THE POINT OF BEGINNING.  AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 3 of 7  Parcel # 6 BURGESS, JULIE M  13203 156TH AVE  SE,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1423059093     Legal Description: THE EAST 125 FEET OF THE NORTH 78 ½ FEET OF THE EAST 200 FEET OF THE  FOLLOWING TRACT OF LAND; THAT PORTION OF THE SOUTHEAST QUARTER OF  THE NORTHWEST QUARTER OF SECTION 14, TOWNSHIP 23 NORTH, RANGE 5  EAST, W.M.. IN KING COUNTY, WASHINGTON, DESCRIBED AS FOLLOWS;  BEGINNING AT A POINT NORTH 88°55’44” WEST 30 FEET AND NORTH 0°28’02”  WEST 1132.57 FEET FROM THE CENTER OF SAID SECTION 14; THENCE  CONTINUING PARALLEL TO THE EAST LINE OF SAID SOUTHEAST QUARTER OF THE  NORTHWEST QUARTER.  NORTH 0°28’02” WEST 157.51 FEET, MORE OR LESS, TO  AN INTERSECTION WITH A LINE 30 FEET SOUTHERLY AND PARALLED TO THE  NORTH LINE OF SAID SOUTHEAST QUARTER OF THE NORTHWEST QUARTER;  THENCE ALONG SAID PARALLEL LINE NORTH 89°06’36” WEST 1249.03 FEET;  THENCE 30 FEET EASTERLY OF AND PARALLEL TO THE WEST LINE OF SAID  SUBDIVISION SOUTH 0°33’02” EAST 157.07 FEET TOA POINT WHICH BEARS  NORTH 89°05’16” WEST FROM THE POINT OF BEGINNING; THENCE SOUTH 89°  05’16” EAST 1248.79 FEET TO THE TRUE POINT OF BEGINNING.     Parcel # 7 SIERRA HOMES INC.  15522 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1423059092     Legal Description: THAT PORTION OF THE SOUTH QUARTER OF THE SOUTH HALF OF THE  NORTHEAST QUARTER OF THE NORTHWEST QUARTER OF SECTION 14,  TOWNSHIP 23 NORTH, RANGE 5 EAST, W.M., IN KING COUNTY, WASHINGTON,  DESCRIBED AS FOLLOWS; BEGINNING AT THE NORTH QUARTER CORNER OF SAID  SECTION; THENCE ALONG THE CENTERLINE OF SAID SECTION SOUTH 0°28’50”  WEST, 1133.20 FEET; THENCE NORTH 88°11’32” WEST, 30 FEET; THENCE SOUTH  0°28’50” WEST 78.77 FEET TO THE TRUE POINT OF BEGINNING FOR THIS  DESCRIPTION; THENCE CONTINUING SOUTH 0°28’50” WEST 42.98 FEET; THENCE  ALONG A CURVE TO THE RIGHT HAVING A RADIUS OF 35.00 FEET, AN ARC  DISTANCE OF 55.80 FEET, THROUGH A CENTRAL ANGLE OF 91°21’02”; THENCE  NORTH 88°10’08” WEST 89.17 FEET; THENCE NORTH 0°28’50” EAST 78.76 FEET;  THENCE SOUTH 88°11’32” EAST 125.00 FEET TO THE TRUE POINT OF BEGINNING.  AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 4 of 7  Parcel # 8 TACHER, MICHAEL   15514 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71  (Maximum  amount  $26,915.42)  Per unit connection  (maximum 2 units)   KC Tax Act # 1423059116           Legal Description: LOT D OF LOT LINE ADJUSTMENT APPLICATION RECORDED UNDER AUDITOR'S  FILE NO; 8410010783, BEING A PORTION OF THE FOLLOWING:    LOT 4 OF KING COUNTY SHORT PLAT NO. 484056, RECORDED UNDER KING  COUNTY RECORDING NO. 8409130561, BEING A PORTION OF THE SOUTH HALF  OF THAT PORTION OF THE SOUTH HALF OF THE NORTHEAST QUARTER OF THE  NORTHWEST QUARTER OF SECTION 14, TOWNSHIP 23 NORTH, RANGE 5 EAST,  W.M.; IN KING COUNTY, WASHINGTON, LYING NORTH OF THE SOUTH 30 FEET OF  SAID SOUTH HALF,  TOGETHER WITH THE SOUTH 30 FEET OF THE NORTHEAST QUARTER OF THE  NORTHWEST QUARTER OF SAID SECTION  EXCEPT THE WEST 595.72 FEET;  EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTH  QUARTER CORNER OF SAID SECTION; THENCE ALONG THE CENTER LINE OF SAID  SECTION SOUTH 00°28'50" WEST, 1133.20 FEET; THENCE NORTH 88°11'32" WEST,  30.01 FEET TO THE TRUE POINT OF BEGINNING FOR THIS DESCRIPTION; THENCE  SOUTH 00°28'50" WEST, 121.75 FEET; THENCE ALONG A CURVE TO THE RIGHT  HAVING A RADIUS OF 35.00 FEET, AN ARC DISTANCE OF 55.80 FEET, THROUGH A  CENTRAL ANGLE OF 91°21'02"; THENCE NORTH 88°10'08" WEST, 89.17 FEET;  THENCE NORTH 00°28'50” EAST, 157.53 FEET, THENCE SOUTH 88°11'32" EAST;  125 FEET TO THE TRUE POINT OF BEGINNING.    EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING NORTH 88°10'08"  WEST, 488.91 FEET AND NORTH 01°49'52" EAST, 30 FEET FROM THE SOUTHEAST  CORNER THEREOF; THENCE NORTH 01°49'52" EAST, 157.35 FEET; THENCE NORTH  88°11'32" WEST, 83.30 FEET, THENCE SOUTH 01°49'52" WEST, 175.31 FEET;  THENCE SOUTH 88°10'08" EAST, 83.30 FEET TO THE TRUE POINT OF BEGINNING   AND EXCEPT THE EAST 30 FEET OF THE REMAINDER THEREOF.  AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 5 of 7  Parcel # 9 TACHER, MICHAEL G. &  SHAUNNA J.   15430 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71  (Maximum  amount  $26,915.42)  Per unit connection  (maximum 2 units)   KC Tax Act # 1423059115           Legal Description: LOT C OF LOT LINE ADJUSTMENT APPLICATION RECORDED UNDER AUDITOR'S  FILE NO; 8410010783, BEING A PORTION OF THE FOLLOWING:    A PORTION OF LOT 3 OF KING COUNTY SHORT PLAT NO. 484056, RECORDED  UNDER KING COUNTY RECORDING NO. 8409130561, BEING A PORTION OF THE  SOUTH HALF OF THAT PORTION OF THE SOUTH HALF OF THE NORTHEAST  QUARTER OF THE NORTHWEST QUARTER OF SECTION 14, TOWNSHIP 23 NORTH,  RANGE 5 EAST, W.M.; IN KING COUNTY, WASHINGTON, LYING NORTH OF THE  SOUTH 30 FEET OF SAID SOUTH HALF,  TOGETHER WITH THE SOUTH 30 FEET OF THE NORTHEAST QUARTER OF THE  NORTHWEST QUARTER OF SAID SECTION  EXCEPT THE WEST 595.72 FEET;  EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTH  QUARTER CORNER OF SAID SECTION; THENCE ALONG THE CENTER LINE OF SAID  SECTION SOUTH 00°28'50" WEST, 1133.20 FEET; THENCE NORTH 88°11'32" WEST,  30.01 FEET TO THE TRUE POINT OF BEGINNING FOR THIS DESCRIPTION; THENCE  SOUTH 00°28'50" WEST, 121.75 FEET; THENCE ALONG A CURVE TO THE RIGHT  HAVING A RADIUS OF 35.00 FEET, AN ARC DISTANCE OF 55.80 FEET, THROUGH A  CENTRAL ANGLE OF 91°21'02"; THENCE NORTH 88°10'08" WEST, 89.17 FEET;  THENCE NORTH 00°28'50” EAST, 157.53 FEET, THENCE SOUTH 88°11'32" EAST;  125 FEET TO THE TRUE POINT OF BEGINNING.    EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING NORTH 88°10'08"  WEST, 488.91 FEET AND NORTH 01°49'52" EAST, 30 FEET FROM THE SOUTHEAST  CORNER THEREOF; THENCE NORTH 01°49'52" EAST, 157.35 FEET; THENCE NORTH  88°11'32" WEST, 83.30 FEET, THENCE SOUTH 01°49'52" WEST, 175.31 FEET;  THENCE SOUTH 88°10'08" EAST, 83.30 FEET TO THE TRUE POINT OF BEGINNING   AND EXCEPT THE EAST 30 FEET OF THE REMAINDER THEREOF.       AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 6 of 7  Parcel # 10 GODSOE, CARL T. &  KATHLEEN R.   15418 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71  (Maximum  amount  $26,915.42)  Per unit connection  (maximum 2 units)   KC Tax Act # 1423059114           Legal Description: LOT A OF LOT LINE ADJUSTMENT APPLICATION RECORDED UNDER AUDITOR'S  FL1E NO; 8410010783, BEING A PORTION OF THE FOLLOWING:    LOT 2 AND 3 OF KING COUNTY SHORT PLAT NO. 484056, RECORDED UNDER KING  COUNTY RECORDING NO. 8409130561, BEING A PORTION OF THE SOUTH HALF  OF THAT PORTION OF THE SOUTH HALF OF THE NORTHEAST QUARTER OF THE  NORTHWEST QUARTER OF SECTION 14, TOWNSHIP 23 NORTH, RANGE 5 EAST,  W.M.; IN KING COUNTY, WASHINGTON, LYING NORTH OF THE SOUTH 30 FEET OF  SAID SOUTH HALF,  TOGETHER WITH THE SOUTH 30 FEET OF THE NORTHEAST QUARTER OF THE  NORTHWEST QUARTER OF SAID SECTION  EXCEPT THE WEST 595.72 FEET;  EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTH  QUARTER CORNER OF SAID SECTION; THENCE ALONG THE CENTER LINE OF SAID  SECTION SOUTH 00°28'50" WEST, 1133.20 FEET; THENCE NORTH 88°11'32" WEST,  30.01 FEET TO THE TRUE POINT OF BEGINNING FOR THIS DESCRIPTION; THENCE  SOUTH 00°28'50" WEST, 121.75 FEET; THENCE ALONG A CURVE TO THE RIGHT  HAVING A RADIUS OF 35.00 FEET, AN ARC DISTANCE OF 55.80 FEET, THROUGH A  CENTRAL ANGLE OF 91°21'02"; THENCE NORTH 88°10'08" WEST, 89.17 FEET;  THENCE NORTH 00°28'50” EAST, 157.53 FEET, THENCE SOUTH 88°11'32" EAST;  125 FEET TO THE TRUE POINT OF BEGINNING.  EXCEPT THAT PORTION DESCRIBED AS FOLLOWS: BEGINNING NORTH 88°10'08"  WEST, 488.91 FEET AND NORTH 01°49'52" EAST, 30 FEET FROM THE SOUTHEAST  CORNER THEREOF; THENCE NORTH 01°49'52" EAST, 157.35 FEET; THENCE NORTH  88°11'32" WEST, 83.30 FEET, THENCE SOUTH 01°49'52" WEST, 175.31 FEET;  THENCE SOUTH 88°10'08" EAST, 83.30 FEET TO THE TRUE POINT OF BEGINNING   AND EXCEPT THE EAST 30 FEET OF THE REMAINDER THEREOF.  AGENDA ITEM #1. a) CITY OF RENTON   FINAL ASSESSMENT ROLL  VARMA / RAM SE 132ND STREET, SEWER LATECOMER  LA‐17‐001/PRM‐27‐0049  Property  Identification  Name/Address of Owner Assessment  Amount  Assessment Method and  Number of Units  FINAL ASSESSMENT ROLL ‐ Page 7 of 7  Parcel # 11 KELLONIEMI, DANIEL &  HOLLY   15416 SE 132nd Street,   Renton, WA 98059‐6719  $13,457.71 Per unit connection  (maximum 1 unit)   KC Tax Act # 1423059079               Legal Description: LOT B OF KING COUNTY LOT LINE ADJUSTMENT NUMBER 984076, UNDER KING  COUNTY RECORDING NUMBER 8410010783, IN KING COUNTY, WASHINGTON  SITUATE IN THE COUNTY OF KING STATE OF WASHINGTON.    AGENDA ITEM #1. a) AB - 2196 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Agreement with Northwest Hydraulic Consultants, Inc. for the Annual Cedar River Sediment Survey and Analysis RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: Utility Systems Division STAFF CONTACT: Joseph Farah, Surface Water Utility Engineer EXT.: 7205 FISCAL IMPACT SUMMARY: The Cedar River Gravel Removal Project and all subsequent post-dredging mitigation, monitoring and reporting work, including sediment surveying and monitoring, are entirely funded by the King County Flood Control District Capital Improvement Project budget ($13,171,131) per CAG-13-009 Addendum #1-16. The adjusted 2018 project budget is $3,197,816. There is sufficient funding in the 2018 Surface Water Utility Capital Improvement Program budget (427.475193) for the agreement. SUMMARY OF ACTION: In 2016, the Surface Water Utility completed maintenance dredging of the lower 1.25 miles of the Cedar River, from the mouth at Lake Washington to the Williams Avenue South bridge. Ongoing sediment deposition along the lower river gradually reduces conveyance capacity and reduces flood protection over time. As part of the city’s agreement with the U.S. Army Corps of Engineers (following construction of the levees and floodwalls and the initial dredging project in 1998) the city is responsible for monitoring sediment levels in order to: • Understand and characterize deposition rates throughout a dredging cycle. • Evaluate how close the river bed is getting to the “maximum bed profile,” and if reached, would require a new maintenance dredge project. • Determine the flow based upon which Boeing would need to raise the South Boeing Bridge. This flow is updated annually and a new rating curve is established and sent to Boeing. The Surface Water Utility evaluated the statements of qualifications of 10 consultant firms on the Municipal Research and Services Center (MRSC) roster that offered services in basin modeling hydrology and hydraulics, sediment investigation and analysis and stream sediment and substrate analyses. Northwest Hydraulic Consultants, Inc. scored the highest and was selected to perform the sediment survey and analysis from 2018 to 2022. EXHIBITS: A. Agreement STAFF RECOMMENDATION: Execute the agreement with Northwest Hydraulic Consultants, Inc. in the amount of $132,377 for the Annual Cedar River Sediment Survey and Analysis. AGENDA ITEM #2. a) THISAGREEMENT,datedJuly27,2018,isbyandbetweentheCityofRenton(the“City”),aWashingtonmunicipalcorporation,andNorthwestHydraulicConsultants(“Consultant”),aWashingtoncorporation.TheCityandtheConsultantarereferredtocollectivelyinthisAgreementasthe“Parties.”OncefullyexecutedbytheParties,thisAgreementiseffectiveasofthelastdatesignedbybothparties.1.ScopeofWork:Consultantagreestoprovidesurveying,hydraulicmodeling,andreportingasspecifiedinExhibitA,whichisattachedandincorporatedhereinandmayhereinafterbereferredtoasthe“Work.”2.ChangesinScopeofWork:TheCity,withoutinvalidatingthisAgreement,mayorderchangestotheWorkconsistingofadditions,deletionsormodifications.AnysuchchangestotheWorkshallbeorderedbytheCityinwritingandtheCompensationshallbeequitablyadjustedconsistentwiththeratessetforthinExhibitBorasotherwisemutuallyagreedbytheParties.3.TimeofPerformance:ConsultantshallcommenceperformanceoftheAgreementpursuanttotheschedule(s)setforthinExhibitC.AllWorkshallbeperformedbynolaterthanMarch31,2023.4.Compensation:A.Amount.TotalcompensationtoConsultantforWorkprovidedpursuanttothisAgreementshallnotexceed$132,377,plusanyapplicablestateandlocalsalestaxes.CompensationshallbepaidbaseduponWorkactuallyperformedaccordingtotherate(s)oramountsspecifiedinExhibitB.TheConsultantagreesthatanyhourlyorflatratechargedbyitforitsWorkshallremainlockedatthenegotiatedrate(s)unlessotherwiseagreedtoinwritingorprovidedinExhibitB.Exceptasspecificallyprovidedherein,theConsultantshallbesolelyresponsibleforpaymentofanytaxesimposedasaresultoftheperformanceandpaymentofthisAgreement.B.MethodofPayment.OnamonthlyornolessthanquarterlybasisduringanyquarterinwhichWorkisperformed,theConsultantshallsubmitavoucherorinvoiceinaformspecifiedbytheCity,includingadescriptionofwhatWorkhasbeenAGREEMENTFORANNUALCEDARRIVERSEDIMENTSURVEYANDANALYSISAGENDA ITEM #2. a) performed,thenameofthepersonnelperformingsuchWork,andanyhourlylaborchargerateforsuchpersonnel.TheConsultantshallalsosubmitafinalbilluponcompletionofallWork.PaymentshallbemadebytheCityforWorkperformedwithinthirty(30)calendardaysafterreceiptandapprovalbytheappropriateCityrepresentativeofthevoucherorinvoice.IftheConsultant’sperformancedoesnotmeettherequirementsofthisAgreement,theConsultantwillcorrectormodifyitsperformancetocomplywiththeAgreement.TheCitymaywithholdpaymentforworkthatdoesnotmeettherequirementsofthisAgreement.C.EffectofPayment.PaymentforanypartoftheWorkshallnotconstituteawaiverbytheCityofanyremediesitmayhaveagainsttheConsultantforfailureoftheConsultanttoperformtheWorkorforanybreachofthisAgreementbytheConsultant.D.Non-AppropriationofFunds.IfsufficientfundsarenotappropriatedorallocatedforpaymentunderthisAgreementforanyfuturefiscalperiod,theCityshallnotbeobligatedtomakepaymentsforWorkoramountsincurredaftertheendofthecurrentfiscalperiod,andthisAgreementwillterminateuponthecompletionofallremainingWorkforwhichfundsareallocated.NopenaltyorexpenseshallaccruetotheCityintheeventthisprovisionapplies.5.Termination:A.TheCityreservestherighttoterminatethisAgreementatanytime,withorwithoutcausebygivingten(10)calendardays’noticetotheConsultantinwriting.Intheeventofsuchterminationorsuspension,allfinishedorunfinisheddocuments,data,studies,worksheets,modelsandreports,orothermaterialpreparedbytheConsultantpursuanttothisAgreementshallbesubmittedtotheCity,ifanyarerequiredaspartoftheWork.B.IntheeventthisAgreementisterminatedbytheCity,theConsultantshallbeentitledtopaymentforallhoursworkedtotheeffectivedateoftermination,lessallpaymentspreviouslymade.IftheAgreementisterminatedbytheCityafterpartialperformanceofWorkforwhichtheagreedcompensationisafixedfee,theCityshallpaytheConsultantanequitableshareofthefixedfee.ThisprovisionshallnotpreventtheCityfromseekinganylegalremediesitmayhavefortheviolationornonperformanceofanyoftheprovisionsofthisAgreementandsuchchargesduetotheCityshallbedeductedfromthefinalpaymentduetheConsultant.NopaymentshallbemadebytheCityforanyexpensesincurredorworkdonefollowingtheeffectivedateofterminationunlessauthorizedinadvanceinwritingbytheCity.6.WarrantiesAndRightToUseWorkProduct:ConsultantrepresentsandwarrantsthatConsultantwillperformallWorkidentifiedinthisAgreementinaprofessionaland0PAGE2OF10AGENDA ITEM #2. a) workmanlikemannerandinaccordancewithallreasonableandprofessionalstandardsandlaws.Compliancewithprofessionalstandardsincludes,asapplicable,performingtheWorkincompliancewithapplicableCitystandardsorguidelines(e.g.designcriteriaandStandardPlansforRoad,BridgeandMunicipalConstruction).Professionalengineersshallcertifyengineeringplans,specifications,plats,andreports,asapplicable,pursuanttoRCW18.43.070.ConsultantfurtherrepresentsandwarrantsthatallfinalworkproductcreatedforanddeliveredtotheCitypursuanttothisAgreementshallbetheoriginalworkoftheConsultantandfreefromanyintellectualpropertyencumbrancewhichwouldrestricttheCityfromusingtheworkproduct.ConsultantgrantstotheCityanon-exclusive,perpetualrightandlicensetouse,reproduce,distribute,adapt,modify,anddisplayallfinalworkproductproducedpursuanttothisAgreement.TheCity’sorother’sadaptation,modificationoruseofthefinalworkproductsotherthanforthepurposesofthisAgreementshallbewithoutliabilitytotheConsultant.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.7.RecordMaintenance:TheConsultantshallmaintainaccountsandrecords,whichproperlyreflectalldirectandindirectcostsexpendedandWorkprovidedintheperformanceofthisAgreementandretainsuchrecordsforaslongasmayberequiredbyapplicableWashingtonStaterecordsretentionlaws,butinanyeventnolessthansixyearsaftertheterminationofthisAgreement.TheConsultantagreestoprovideaccesstoandcopiesofanyrecordsrelatedtothisAgreementasrequiredbytheCitytoauditexpendituresandchargesand/ortocomplywiththeWashingtonStatePublicRecordsAct(Chapter42.56RCW).TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.8.PublicRecordsCompliance:TothefullextenttheCitydeterminesnecessarytocomplywiththeWashingtonStatePublicRecordsAct,ConsultantshallmakeaduediligentsearchofallrecordsinitspossessionorcontrolrelatingtothisAgreementandtheWork,including,butnotlimitedto,e-mail,correspondence,notes,savedtelephonemessages,recordings,photos,ordrawingsandprovidethemtotheCityforproduction.IntheeventConsultantbelievessaidrecordsneedtobeprotectedfromdisclosure,itmay,atConsultant’sownexpense,seekjudicialprotection.Consultantshallindemnify,defend,andholdharmlesstheCityforallcosts,includingattorneys’fees,attendanttoanyclaimorlitigationrelatedtoaPublicRecordsActrequestforwhichConsultanthasresponsiverecordsandforwhichConsultanthaswithheldrecordsorinformationcontainedtherein,ornotprovidedthemtotheCityinatimelymanner.ConsultantshallproducefordistributionanyandallrecordsresponsivetothePublicRecordsActrequestinatimelymanner,unlessthoserecordsareprotectedbycourtorder.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.9.IndependentContractorRelationship:0PAGE3OF10AGENDA ITEM #2. a) A.TheConsultantisretainedbytheCityonlyforthepurposesandtotheextentsetforthinthisAgreement.ThenatureoftherelationshipbetweentheConsultantandtheCityduringtheperiodoftheWorkshallbethatofanindependentcontractor,notemployee.TheConsultant,nottheCity,shallhavethepowertocontrolanddirectthedetails,mannerormeansofWork.Specifically,butnotbymeansoflimitation,theConsultantshallhavenoobligationtoworkanyparticularhoursorparticularschedule,unlessotherwiseindicatedintheScopeofWorkorwhereschedulingofattendanceorperformanceismutuallyarrangedduetothenatureoftheWork.ConsultantshallretaintherighttodesignatethemeansofperformingtheWorkcoveredbythisagreement,andtheConsultantshallbeentitledtoemployotherworkersatsuchcompensationandsuchotherconditionsasitmaydeemproper,provided,however,thatanycontractsomadebytheConsultantistobepaidbyitalone,andthatemployingsuchworkers,itisactingindividuallyandnotasanagentfortheCity.B.TheCityshallnotberesponsibleforwithholdingorotherwisedeductingfederalincometaxorSocialSecurityorcontributingtotheStateIndustrialInsuranceProgram,orotherwiseassumingthedutiesofanemployerwithrespecttoConsultantoranyemployeeoftheConsultant.C.IftheConsultantisasoleproprietorshiporifthisAgreementiswithanindividual,theConsultantagreestonotifytheCityandcompleteanyrequiredformiftheConsultantretiredunderaStateofWashingtonretirementsystemandagreestoindemnifyanylossestheCitymaysustainthroughtheConsultant’sfailuretodoso.10.HoldHarmless:TheConsultantagreestorelease,indemnify,defend,andholdharmlesstheCity,electedofficials,employees,officers,representatives,andvolunteersfromanyandallclaims,demands,actions,suits,causesofaction,arbitrations,mediations,proceedings,judgments,awards,injuries,damages,liabilities,taxes,losses,fines,fees,penalties,expenses,attorney’sorattorneys’fees,costs,and/orlitigationexpensestoorbyanyandallpersonsorentities,arisingfrom,resultingfrom,orrelatedtothenegligentacts,errorsoromissionsoftheConsultantinitsperformanceofthisAgreementorabreachofthisAgreementbyConsultant,exceptforthatportionoftheclaimscausedbytheCity’ssolenegligence.ShouldacourtofcompetentjurisdictiondeterminethatthisagreementissubjecttoRCW4.24.115,(Validityofagreementtoindemnifyagainstliabilityfornegligencerelativetoconstruction,alteration,improvement,etc.,ofstructureorimprovementattachedtorealestate...)then,intheeventofliabilityfordamagesarisingoutofbodilyinjurytopersonsordamagestopropertycausedbyorresultingfromtheconcurrentnegligenceoftheConsultantandtheCity,itsofficers,officials,employeesandvolunteers,Consultant’sliabilityshallbeonlytotheextentofConsultant’snegligence.0PAGE4OF10AGENDA ITEM #2. a) ItisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedinthisAgreementconstituteConsultant’swaiverofimmunityundertheIndustrialInsuranceAct,RCWTitle51,solelyforthepurposesofthisindemnification.ThePartieshavemutuallynegotiatedandagreedtothiswaiver.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.11.GiftsandConflicts:TheCity’sCodeofEthicsandWashingtonStatelawprohibitCityemployeesfromsoliciting,accepting,orreceivinganygift,gratuityorfavorfromanyperson,firmorcorporationinvolvedinacontractortransaction.ToensurecompliancewiththeCity’sCodeofEthicsandstatelaw,theConsultantshallnotgiveagiftofanykindtoCityemployeesorofficials.ConsultantalsoconfirmsthatConsultantdoesnothaveabusinessinterestoraclosefamilyrelationshipwithanyCityofficeroremployeewhowas,is,orwillbeinvolvedinselectingtheConsultant,negotiatingoradministeringthisAgreement,orevaluatingtheConsultant’sperformanceoftheWork.12.CityofRentonBusinessLicense:TheConsultantshallobtainaCityofRentonBusinessLicensepriortoperforminganyWorkandmaintainthebusinesslicenseingoodstandingthroughoutthetermofthisagreementwiththeCity.Informationregardingacquiringacitybusinesslicensecanbefoundat:http://www.rentonwa.gov/cms/One.aspx?portalld=7922741&pageld=9824882InformationregardingStatebusinesslicensingrequirementscanbefoundat:http://dor.wa.gov/doing-business/register-my-business13.Insurance:Consultantshallsecureandmaintain:A.Commercialgeneralliabilityinsuranceintheminimumamountsof$1,000,000foreachoccurrence/$2,000,000aggregatefortheTermofthisAgreement.B.IntheeventthatWorkdeliveredpursuanttothisAgreementeitherdirectlyorindirectlyinvolveorrequireProfessionalServices,ProfessionalLiability,ErrorsandOmissionscoverageshallbeprovidedwithminimumlimitsof$1,000,000peroccurrence.“ProfessionalServices”,forthepurposeofthissection,shallmeananyWorkprovidedbyalicensedprofessionalorWorkthatrequiresaprofessionalstandardofcare.C.Workers’compensationcoverage,asrequiredbytheIndustrialInsurancelawsoftheStateofWashington,shallalsobesecured.D.CommercialAutomobileLiabilityforowned,leased,hiredornon-owned,leased,hiredornon-owned,withminimumlimitsof$1,000,000peroccurrencecombined0PAGE5OF10AGENDA ITEM #2. a) singlelimit,iftherewillbeanyuseofConsultant’svehiclesontheCity’sPremisesbyoronbehalfoftheCity,beyondnormalcommutes.E.ConsultantshallnametheCityasanAdditionalInsuredonitscommercialgeneralliabilitypolicyonanon-contributoryprimarybasis.TheCity’sinsurancepoliciesshallnotbeasourceforpaymentofanyConsultantliability,norshallthemaintenanceofanyinsurancerequiredbythisAgreementbeconstruedtolimittheliabilityofConsultanttothecoverageprovidedbysuchinsuranceorotherwiselimittheCity’srecoursetoanyremedyavailableatlaworinequity.F.SubjecttotheCity’sreviewandacceptance,acertificateofinsuranceshowingtheproperendorsements,shallbedeliveredtotheCitybeforeperformingtheWork.G.ConsultantshallprovidetheCitywithwrittennoticeofanypolicycancellation,withintwo(2)businessdaysoftheirreceiptofsuchnotice.14.Delays:ConsultantisnotresponsiblefordelayscausedbyfactorsbeyondtheConsultant’sreasonablecontrol.WhensuchdelaysbeyondtheConsultant’sreasonablecontroloccur,theCityagreestheConsultantisnotresponsiblefordamages,norshalltheConsultantbedeemedtobeindefaultoftheAgreement.15.SuccessorsandAssigns:NeithertheCitynortheConsultantshallassign,transferorencumberanyrights,dutiesorinterestsaccruingfromthisAgreementwithoutthewrittenconsentoftheother.16.Notices:AnynoticerequitedunderthisAgreementwillbeinwriting,addressedtotheappropriatepartyattheaddresswhichappearsbelow(asmodifiedinwritingfromtimetotimebysuchparty),andgivenpersonally,byregisteredorcertifiedmail,returnreceiptrequested,byfacsimileorbynationallyrecognizedovernightcourierservice.Timeperiodfornoticesshallbedeemedtohavecommenceduponthedateofreceipt,EXCEPTfacsimiledeliverywillbedeemedtohavecommencedonthefirstbusinessdayfollowingtransmission.EmailandtelephonemaybeusedforpurposesofadministeringtheAgreement,butshouldnotbeusedtogiveanyformalnoticerequiredbytheAgreement.CITYOFRENTONCONSULTANTJosephFarahErikRowland1055SouthGradyWay12787GatewayDriveSouthRenton,WA98057Seattle,WA98168Phone:(425)430-7205Phone:(206)241-6000jfarah@rentonwa.goverowland@nhcweb.comFax:(425)430-7241Fax:(425)439-24200PAGE6OF10AGENDA ITEM #2. a) 17.DiscriminationProhibited:Excepttotheextentpermittedbyabonafideoccupationalqualification,theConsultantagreesasfollows:A.Consultant,andConsultant’sagents,employees,representatives,andvolunteerswithregardtotheWorkperformedortobeperformedunderthisAgreement,shallnotdiscriminateonthebasisofrace,color,sex,religion,nationality,creed,maritalstatus,sexualorientationorpreference,age(exceptminimumageandretirementprovisions),honorablydischargedveteranormilitarystatus,orthepresenceofanysensory,mentalorphysicalhandicap,unlessbaseduponabonafideoccupationalqualificationinrelationshiptohiringandemployment,inemploymentorapplicationforemployment,theadministrationofthedeliveryofWorkoranyotherbenefitsunderthisAgreement,orprocurementofmaterialsorsupplies.B.TheConsultantwilltakeaffirmativeactiontoinsurethatapplicantsareemployedandthatemployeesaretreatedduringemploymentwithoutregardtotheirrace,creed,color,nationalorigin,sex,age,sexualorientation,physical,sensoryormentalhandicaps,ormaritalstatus.Suchactionshallinclude,butnotbelimitedtothefollowingemployment,upgrading,demotionortransfer,recruitmentorrecruitmentadvertising,layoffortermination,ratesofpayorotherformsofcompensationandselectionfortraining.C.litheConsultantfailstocomplywithanyofthisAgreement’snon-discriminationprovisions,theCityshallhavetheright,atitsoption,tocanceltheAgreementinwholeorinpart.D.TheConsultantisresponsibletobeawareofandincompliancewithallfederal,stateandlocallawsandregulationsthatmayaffectthesatisfactorycompletionoftheproject,whichincludesbutisnotlimitedtofairlaborlaws,worker’scompensation,andTitleVIoftheFederalCivilRightsActof1964,andwillcomplywithCityofRentonCouncilResolutionNumber4085.18.Miscellaneous:Thepartiesherebyacknowledge:A.TheCityisnotresponsibletotrainorprovidetrainingforConsultant.B.Consultantwillnotbereimbursedforjobrelatedexpensesexcepttotheextentspecificallyagreedwithintheattachedexhibits.C.Consultantshallfurnishalltoolsand/ormaterialsnecessarytoperformtheWorkexcepttotheextentspecificallyagreedwithintheattachedexhibits.D.Intheeventspecialtraining,licensing,orcertificationisrequiredforConsultanttoprovideWorkhe/shewillacquireormaintainsuchathis/herownexpenseand,if0PAGE70F1OAGENDA ITEM #2. a) Consultantemploys,sub-contracts,orotherwiseassignstheresponsibilitytoperformtheWork,saidemployee/sub-contractor/assigneewillacquireandormaintainsuchtraining,hcensing,orcertification.E.Thisisanon-exclusiveagreementandConsultantisfreetoprovidehis/herWorktootherentities,solongasthereisnointerruptionorinterferencewiththeprovisionofWorkcalledforinthisAgreement.F.Consultantisresponsibleforhis/herowninsurance,including,butnotlimitedtohealthinsurance.G.Consultantisresponsibleforhis/herownWorker’sCompensationcoverageaswellasthatforanypersonsemployedbytheConsultant.19.OtherProvisions:A.ApprovalAuthority.EachindividualexecutingthisAgreementonbehalfoftheCityandConsultantrepresentsandwarrantsthatsuchindividualsaredulyauthorizedtoexecuteanddeliverthisAgreementonbehalfoftheCityorConsultant.B.GeneralAdministrationandManagement.TheCity’sprojectmanagerisJosephFarah,SurfaceWaterUtilityEngineer.InprovidingWork,ConsultantshallcoordinatewiththeCity’scontractmanagerorhis/herdesignee.C.AmendmentandModification.ThisAgreementmaybeamendedonlybyaninstrumentinwriting,dulyexecutedbybothParties.D.Conflicts.IntheeventofanyinconsistenciesbetweenConsultantproposalsandthisAgreement,thetermsofthisAgreementshallprevail.Anyexhibits/attachmentstothisAgreementareincorporatedbyreferenceonlytotheextentofthepurposeforwhichtheyarereferencedwithinthisAgreement.TotheextentaConsultantpreparedexhibitconflictswiththetermsinthebodyofthisAgreementorcontainstermsthatareextraneoustothepurposeforwhichitisreferenced,thetermsinthebodyofthisAgreementshallprevailandtheextraneoustermsshallnotbeincorporatedherein.E.GoverningLaw.ThisAgreementshallbemadeinandshallbegovernedbyandinterpretedinaccordancewiththe‘awsoftheStateofWashingtonandtheCityofRenton.ConsultantandalloftheConsultant’semployeesshallperformtheWorkinaccordancewithallapplicablefederat,state,countyandcitylaws,codesandordinances.F.JointDraftingEffort.ThisAgreementshallbeconsideredforallpurposesaspreparedbythejointeffortsofthePattiesandshallnotbeconstruedagainstone0PAGE8OF10AGENDA ITEM #2. a) partyortheotherasaresultofthepreparation,substitution,submissionorothereventofnegotiation,draftingorexecution.G.JurisdictionandVenue.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.H.Severability.Acourtofcompetentjurisdiction’sdeterminationthatanyprovisionorpartofthisAgreementisillegalorunenforceableshallnotcancelorinvalidatetheremainderofthisAgreement,whichshallremaininfullforceandeffect.SoleandEntireAgreement.ThisAgreementcontainstheentireagreementofthePartiesandanyrepresentationsorunderstandings,whetheroralorwritten,notincorporatedareexcluded.J.TimeisoftheEssence.TimeisoftheessenceofthisAgreementandeachandallofitsprovisionsinwhichperformanceisafactor.AdherencetocompletiondatessetforthinthedescriptionoftheWorkisessentialtotheConsultant’sperformanceofthisAgreement.Consultant,however,willnotbeheldresponsiblefordelayscausedbyfailureoftheCityofRentonoritsagentstoprovidedirectionandinformation,orreviewofinterimproducts.K.Third-PartyBeneficiaries.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.L.BindingEffect.ThePartieseachbindthemselves,theirpartners,successors,assigns,andlegalrepresentativestotheotherpartytothisAgreement,andtothepartners,successors,assigns,andlegalrepresentativesofsuchotherpartywithrespecttoallcovenantsoftheAgreement.M.Waivers.Allwaiversshallbeinwritingandsignedbythewaivingparty.Eitherparty’sfailuretoenforceanyprovisionofthisAgreementshallnotbeawaiverandshallnotpreventeithertheCityorConsultantfromenforcingthatprovisionoranyotherprovisionofthisAgreementinthefuture.WaiverofbreachofanyprovisionofthisAgreementshallnotbedeemedtobeawaiverofanypriororsubsequentbreachunlessitisexpresslywaivedinwriting.0PAGE9OF10AGENDA ITEM #2. a) N.Counterparts.ThePartiesmayexecutethisAgreementinanynumberofcounterparts,eachofwhichshallconstituteanoriginal,andallofwhichwilltogetherconstitutethisoneAgreement.INWITNESSWHEREOF,thePartieshavevoluntarilyenteredintothisAgreementasofthedatelastsignedbythePartiesbelow.CITYOFRENTONCONSULTANTBy:______________________________By:_________________DenisLawErikRowlandMayorPrincipal-in-ChargeDateDateAttestJasonA.SethCityClerkApprovedastoLegalFormShaneMoloneyRentonCityAttorneyNon-standard08/03/18clb(473)0PAGE10OF10AGENDA ITEM #2. a) nbcnorthwesthydraulicconsultantsNHCRef.No.P02004153July25,2018CityofRentonPublicWorks—SurfaceWaterUtility1055SouthGradyWay—5thFloorRenton,WA98057Attention:JosephFarah,P.E.Viaemail:JFarah@Rentonwa.govRe:INTRODUCTION12787GatewayDriveSouthISeattle,WA9816$I206.241.6000Iwww.nhcweb.comExhibitA2018-2022CedarRiverSedimentSurveysTheCityofRentonDepartmentofPublicWorksSurfaceWaterUtility(City)hasaskedNorthwestHydraulicConsultants(NHC)toprepareascopeofworkandbudgetestimatetoprovideannualchannelsurvey,hydraulicmodeling,andsedimentationanalysisservices,relatedtothemonitoringeffortneededaspartoftheCedarRiverMaintenanceDredgingProject.ThefollowingscopeofworkandtheattachedcostestimatehavebeenpreparedinresponsetotheCity’srequest.ThepurposeofthisstudyistomonitoranddocumentsedimentaccumulationwithinthelowertwomilesoftheCedarRiverasitpassesthroughtheCityofRenton.In2016,theCitydredgedthelower1.3milesoftheCedarRiver.AspartoftheCedarRiverSection205FloodHazardReductionproject,theCityisrequiredtomonitorsedimentlevelswithinthelowerCedarRiver,inordertodeterminewhenmaintenancedredgingbecomesnecessary.ThefollowingscopeofworkoutlinesservicestobeconductedbyNHCannuallyoverthenextfiveyears(2018-2022).Task1—Cross-SectionSurveysNHCwillsurveyapproximately40channelcross-sectionsbeginningattheNorthBoeingBridge(RM0.0)andextendingupstreamtoRM2.1.Cross-sectionlocationswillbethesameasthoseestablishedduringprevioussurveys.Bothendsofeachcross-sectionwillextendtothetopoftheexistingbank,berm,orfloodwall.NHCwillpost-processthesurveypointstocreatecross-sectionviewsateachlocation.EachsectionwillbesurveyedatthelocationsmonumentedeitherbyPACEin1999orNHC(insubsequentyears)andateachbridge.SCOPEOFWORKwaterresourcespecialistsAGENDA ITEM #2. a) ExhibitAiilicNHCwillusetotalstationequipmenttosurveycross-sections.Existingverticalbenchmarkswillbereoccupiedtomaintainconsistencywithpastsurveys.Cross-sectionssurveyswillbereferencedtoknownhorizonalandverticaldatums,WAStatePlaneNorth-NAD83andNAVD1988,respectively.Itisassumedcross-sectionsatbridgefaceswillbesurveyedwithatotalstationratherthansoundingsfrombridgerails,aswasperformedpriorto2017.Task2—UpdateHEC-RASModelNHCwillupdatetheexistingHEC-RASmodelofthestudyreachusingnewlysurveyedcross-sectionsfromTask1.Themodelwillbeusedtoestimatethe2-,10-,25-,and100-yearwatersurfaceprofilesandcorrespondingleveefreeboardelevations.Beginningin2018,newlycomputedfloodfrequencydischargesandmodifiedallowableaveragebedelevationswillbeprovidedtoNHCbytheCityandusedinthehydraulicandfreeboardanalysis.Task3—SedimentAnalysisTohelptheCitymonitorsedimentaccumulationwithinthedredgedreach(downstreamofWilliamsAvenue5),NHCwillusethecurrentyear’ssurveyeddata(fromTask1),andthepreviousyear’ssurveydatato:1)estimatethechangeinsedimentvolume,2)determineaveragebedelevations,and3)calculatetheremainingstoragecapacity.RemainingstoragevolumewillbecomputedbydeterminingthedifferencebetweentheallowablebedestablishedbytheCityandmodifiedaveragebedelevationscalculatedinTask2.Task4—SouthBoeingBridgeAnalysisandMemoNHCwillusetheHEC-RASmodeltocreateastage-dischargeratingcurveattheupstreamfaceoftheSouthBoeingBridge.AsecondratingcurvewillbeplottedonthisfigurethatrepresentstheLandsburgstreamgage.Theratingcurvedatawillbepresentedinbothgraphicalandtabularformats.NHCwillusethemodelresultstoestimatethedischargesattheSouthBoeingBridgeandattheLandsburggagethatproduceawatersurfaceelevationthat:1)touchesthebridgelowchord,and2)isonefootbelowthelowchord.ThisinformationwillbesummarizedinamemorandumthattheCitycandistributetokeyfloodprotectionpartners.Task5—ChannelSurveyReportingAbriefreportwillbepreparedinwhicheachofthetaskitemsaresummarizedanddocumentedwithsupportingtablesandfigures.Keyelementsofthereportwillinclude:•Plotsofthecurrentandpreviousyear’saveragebedprofilescomparedtheestablishedallowablebedelevationprofile,andthe2016post-dredgeprofile.•Resultsanddiscussionofsedimentanalysisandaccumulationrates.•SouthBoeingBridgefloodstageanalysisandmemo.•ResultsfromtheHEC-RASmodel,includingplotsof100-yearwaterlevelsandadiscussionofremainingfreeboardalongthefloodcontrolprojectandbridges,andotherfloodingconcerns.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #2. a) nbcExhibitANHCwillelectronicallytransmitthereportandsupportingdata(e.g.HEC-RASmodel,photos,...)totheCity.UpontherequestoftheCity,one(1)hardcopywouldbeprovided.Task6—ProjectManagementNHCwillcoordinatethesurveywiththeCityandensurethattheprojectiscompletedontimeandwithinbudget.InvoiceswillbesentmonthlyandNHC’sprojectmanagerwillbeavailabletotheCityforprojectupdates.CLOSURENHCappreciatesthisopportunitytoprovidecontinuedservicetotheCityaspartoftheCedarRiverMaintenanceDredgeProject.DISCLAIMERThisdocumenthasbeenpreparedbyNorthwestHydraulicConsultantsInc.inaccordancewithgenerallyacceptedengineeringpracticesandisintendedfortheexclusiveuseandbenefitoftheCityofRentonandtheirauthorizedrepresentativesforspecificapplicationtotheCedarRiverMaintenanceDredgingProjectinRenton,Washington.Thecontentsofthisdocumentarenottoberelieduponorused,inwholeorinpart,byorforthebenefitofotherswithoutspecificwrittenauthorizationfromNorthwestHydraulicConsultantsInc.Nootherwarranty,expressedorimplied,ismade.NorthwestHydraulicConsultantsInc.anditsofficers,directors,employees,andagentsassumenoresponsibilityfortherelianceuponthisdocumentoranyofitscontentsbyanypartiesotherthantheCityofRenton.Sincerely,NorthwestHydraulicConsultantsInc.PeterBrooks,P.E.ErikRowland,P.E.Sr.EngineerPrincipalProjectManagerPrincipal-in-ChargeAttachments:ExhibitB—BudgetExhibitC—Schedule2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #2. a) ExhibitB—Budget2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018nbcNorthwestHydraulicConsultantsInc.12787GatewayDriveS.Seattle,WA98168Tel.(206)241-6000Fax(206)439-2420EstimateofProfessionalServicesPreparedfor:CityofRentonProject:2018-2022CedarRiverSedimentSurveysDate:07/2512018Project#:P02004153PreparedBy:PeterBrooks!ErikRowlandDirectExpenseDetailTflT1nierrrpPRtImrcCostSummaryeudgetestimateIoncurrentyear(2010)YearTask20182019202020212022TotalCedarRiverSedimentSurvey$24934$25,682$26,452$27,246$28,063$132,377Budgetestimatesincluding3%annualescalationafter2018.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityGISSr.Doc.contactTASKDESCRIPTIONPa.Sr.Eng.IEng.IJr.Eng.AnalystSpclst.Admin.TotalsTask1Cross-SectionSurvey1.1SL.rvey24848$11,8391.2PostProcessing2105$1,881Task2UpdateHEC-RASModel128$1.43fTask3SedimentAnatis3.1Cross-SectionCompadson/VolumeCalctiations14164$3,0143.2SedimentProBes2—42$975Task4SouthBoeingBndgeAnalysis&Memo1241$1125Task5ChannelSurveyReporting46844$3688Task6ProjectManagement221TotalHoursandDirectSalaryCost(DSC)9.022.048.098.015.05.01.0LaborRate($/hr)240.28185.24135.83103.0995.87101.81136.67TOTALLABORCOSTI$23,957UnitsMileage0545527TotalStation5150$750Reproduction540$200Rate50.!jICost.TotalLabor$2395TotalDirectEspertses..-TOTALCOrAGENDA ITEM #2. a) nbcSCHEDULEOFSTANDARDCHARGES(Effective1ian2018)LaborFeeRateCategory($US/hour)PrinUpal240.28PrindpalT3223.71Sr.ProjectEngineer/Saenfist200.00Sr.Engineer1185.24Sr.Engineer/Sdentist2156.52Engineer1135.83Scientist1121.69Engineer/Sdentist2111.66Jr.Engineer103.09GISSpedalist130.23GISAnalyst95.87Sr.EngineeringTechnician131.90Sr.LaboratoryTechnician100.00LaboratoryTechnician75.32Sr.ContractAdministrator136.67Sr.TechnicalEditor135.00Sr.DocumentProduction/flnanceSpecialist101.81DocumentProductionSpecialist80.00HandlingChargesIFeesPhotocopies$/sheetB&W81hx11$010MarkuponSubconsultants10%B&W11x17$0.15MarkuponReimbutsables10%Color81Axli$1.00MarkuponTravel/Subsistence.lO%Colorlix17$2.00Plotting$/sheetPlots,bond,lix17$2.00Plots,bond,Dsize$4.00Plots,oversize(runningfoot).$2.00LaborcostssubjecttoannualescalationadjustmentinOctobertoreflectcostoflivingandmeritsalaryincreases.Refertoseparateschedulesforfieldandlaboratoryequipmentcharges.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #2. a) nbcExhibitC—Schedule2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018NHCwillperformthecross-sectionsurveysduringlowwaterinAugustand/orSeptember.FivecopiesofthesummaryreportincludingsurveydataforthisreachalongwiththesedimentvolumeinformationwillbeprovidedtotheCitybyOctober31ofthecurrentyear.Allworkandrevisionswillbecompletedbeforethefinalprojectcloseoutdateattheendofthecurrentcalendaryear.FinalinvoicesshallbeprovidedbyorbeforeDecember31stoftheyearthattheworkwasperformed.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #2. a) AB - 2197 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Water Quality Grant Agreement WQC-2017-Renton-00002 with the Department of Ecology for the Heather Downs Detention Pond Water Quality Retrofit Project RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: Utility Systems Division STAFF CONTACT: Ron Straka, Surface Water Utility Engineering Manager EXT.: 7248 FISCAL IMPACT SUMMARY: The grant agreement provides $93,000 of grant funding into the approved 2018 Surface Water Utility Capital Improvement Program budget for the Heather Downs Detention Pond Water Quality Retrofit Project (425.475511). The grant funding for this project was included in the city’s second quarter budget adjustment. The grant requires $31,000 of matching funds for a total grant agreement amount of $124,000. There is sufficient funding in the project budget for the required matching funds. SUMMARY OF ACTION: The City of Renton has been awarded $93,000 in grant funds from the State of Washington Department of Ecology for the Heather Downs Detention Pond Water Quality Retrofit Project. This project will improve water quality in Maplewood Creek, tributary to the Cedar River, through design of a combined detention pond and wetpond at Union Avenue SE and SE 4th Street. This project will provide treatment for total suspended solid (TSS) and will reduce flows to Maplewood Creek by increasing stormwater infiltration and providing stormwater detention. The Ecology grant includes the preparation of State Environmental Policy Act (SEPA) and cultural resource review requirements, development of an Inadvertent Discovery Plan (IDP), development of a project design report and construction plans and specifications that will allow the future construction of the project to treat stormwater runoff in the Heather Downs residential neighborhood. The project design and preparation of the construction plans and specifications will be completed prior to the grant agreement expiration date of December 31, 2020. EXHIBITS: A. Agreement B. Vicinity Map STAFF RECOMMENDATION: Authorize the Mayor to execute the Water Quality Grant Agreement WQC-2017-Renton-00002 with the Department of Ecology to accept $93,000 in grant funds for the Heather Downs Detention Pond Water Quality Retrofit Project. AGENDA ITEM #3. a) Agreement No. WQC-2017-Renton-00002 WATER QUALITY COMBINED FINANCIAL ASSISTANCE AGREEMENT BETWEEN THE STATE OF WASHINGTON DEPARTMENT OF ECOLOGY AND CITY OF RENTON This is a binding Agreement entered into by and between the state of Washington, Department of Ecology, hereinafter referred to as “ECOLOGY,” and City of Renton, hereinafter referred to as the “RECIPIENT,” to carry out with the provided funds activities described herein. Heather Downs Detention Pond Water Quality Retrofit Project GENERAL INFORMATION Project Title: Total Cost: Total Eligible Cost: Ecology Share: Recipient Share: The Effective Date of this Agreement is: The Expiration Date of this Agreement is no later than: Project Type: Project Short Description: This project will improve water quality in Maplewood Creek, tributary to the Cedar River, through design of a combined detention and wetpond at Union Avenue SE and SE 4th Street in the city of Renton. This project will provide treatment for total suspended solids (TSS) and will also reduce flows to Maplewood Creek by increasing stormwater infiltration and/or providing stormwater detention. Project Long Description: Stormwater runoff from approximately 30 acres of predominately impervious area including driveways, streets, building roofs, and other impervious areas collects in catch basins and pipes and flows to Heather Downs detention pond. The pond currently provides no treatment for stormwater runoff. Stormwater runoff contains various mixtures of hydrocarbons, oils, metals and sediments and can ultimately impair downstream waterbodies. The pond discharges to Maplewood Creek, a tributary to the Cedar River, and ultimately Lake Washington. The Cedar River is a 303(d) listed water body for temperature, pH, fecal coliform and ammonia. $124,000.00 $124,000.00 $93,000.00 $31,000.00 01/01/2018 12/31/2020 Stormwater Facility AGENDA ITEM #3. a) Page 2 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton The RECIPIENT will complete the planning and design work needed to convert the existing detention pond located at Union Ave SE and SE 4th Street in the city of Renton into a combined detention and wetpond facility. The water quality retrofits will reduce water quality problems in Maplewood Creek and the Cedar River by providing basic water quality treatment prior to discharging into the river. The pond will consist of two treatment cells and will provide both water quality treatment through dead storage in the wetpool and flow control through live storage above the wetpool, which will reduce peak flows to the outfall system, and reduce erosion and gullying downstream of the pond. Overall Goal: This project will help protect and restore water quality in Washington by reducing stormwater impacts from existing infrastructure and development. Version 10/30/2015 AGENDA ITEM #3. a) Page 3 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT INFORMATION Organization Name: Federal Tax ID: DUNS Number: Mailing Address: Physical Address: Contacts Organization Email: City of Renton 91-6001271 949697221 Renton City Hall, 5th Floor, 1055 South Grady Way Renton, WA 98057-3232 Renton City Hall, 5th Floor 1055 South Grady Way Renton, Washington 98057-3232 Ken Srilofung Surface Water Utility Engineer 3 - Project Manager 1055 South Grady Way, 5th Floor Renton, Washington 98057 Email: ksrilofung@rentonwa.gov Phone: (425) 430-7247 Authorized Signatory Ken Srilofung Surface Water Utility Engineer 3 - Project Manager 1055 South Grady Way, 5th Floor Renton, Washington 98057 Email: ksrilofung@rentonwa.gov Phone: (425) 430-7247 Billing Contact Project Manager Authorized Signatory Denis W Law Mayor 1055 S. Grady Way Renton, Washington 98057 Email: dlaw@rentonwa.gov Phone: (425) 430-6500 phintz@rentonwa.gov Version 10/30/2015 AGENDA ITEM #3. a) Page 4 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Contacts Project Manager Financial Manager Technical Advisor Melisa Snoeberger 3190 - 160th Ave SE Bellevue, Washington 98008-5452 Email: msno461@ecy.wa.gov Phone: (425) 649-7047 Frances Carver PO Box 47600 Olympia, Washington 98504-7600 Email: fcar461@ecy.wa.gov Phone: (360) 407-6564 Amanda Heye PO Box 47600 Olympia, Washington 98504-7600 Email: ahey461@ecy.wa.gov Phone: (360) 407-6457 ECOLOGY INFORMATION Mailing Address: Physical Address: Department of Ecology Water Quality PO BOX 47600 Olympia, WA 98504-7600 Water Quality 300 Desmond Drive SE Lacey, WA 98503 Version 10/30/2015 AGENDA ITEM #3. a) Page 5 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton AUTHORIZING SIGNATURES RECIPIENT agrees to furnish the necessary personnel, equipment, materials, services, and otherwise do all things necessary for or incidental to the performance of work as set forth in this Agreement. RECIPIENT acknowledges that they had the opportunity to review the entire Agreement, including all the terms and conditions of this Agreement, Scope of Work, attachments, and incorporated or referenced documents, as well as all applicable laws, statutes, rules, regulations, and guidelines mentioned in this Agreement. Furthermore, the RECIPIENT has read, understood, and accepts all requirements contained within this Agreement. This Agreement contains the entire understanding between the parties, and there are no other understandings or representations other than as set forth, or incorporated by reference, herein. No subsequent modifications or amendments to this agreement will be of any force or effect unless in writing, signed by authorized representatives of the RECIPIENT and ECOLOGY and made a part of this agreement. ECOLOGY and RECIPIENT may change their respective staff contacts without the concurrence of either party. This Agreement shall be subject to the written approval of Ecology’s authorized representative and shall not be binding until so approved. The signatories to this Agreement represent that they have the authority to execute this Agreement and bind their respective organizations to this Agreement. IN WITNESS WHEREOF: the parties hereto, having read this Agreement in its entirety, including all attachments, do agree in each and every particular and have thus set their hands hereunto. Washington State Department of Ecology Water Quality Date Date City of Renton Heather R. Bartlett Mayor Denis W Law By:By: Template Approved to Form by Attorney General's Office Program Manager Version 10/30/2015 AGENDA ITEM #3. a) Page 6 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Clerk Date Jason A. Seth Attorney Date Shane Moloney Version 10/30/2015 AGENDA ITEM #3. a) Page 7 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SCOPE OF WORK Task Number:1 Task Cost: $12,400.00 Task Title:Project Administration/Management Task Description: A. The RECIPIENT shall carry out all work necessary to meet ECOLOGY grant or loan administration requirements. Responsibilities include, but are not limited to: maintenance of project records; submittal of requests for reimbursement and corresponding backup documentation; progress reports; and a recipient closeout report (including photos). B. The RECIPIENT shall maintain documentation demonstrating compliance with applicable procurement, contracting, and interlocal agreement requirements; application for, receipt of, and compliance with all required permits, licenses, easements, or property rights necessary for the project; and submittal of required performance items. C. The RECIPIENT shall manage the project. Efforts include, but are not limited to: conducting, coordinating, and scheduling project activities and assuring quality control. Every effort will be made to maintain effective communication with the RECIPIENT's designees; ECOLOGY; all affected local, state, or federal jurisdictions; and any interested individuals or groups. The RECIPIENT shall carry out this project in accordance with any completion dates outlined in this agreement. Task Goal Statement: Properly managed and fully documented project that meets ECOLOGY’s grant or loan administrative requirements. Task Expected Outcome: * Timely and complete submittal of requests for reimbursement, quarterly progress reports, and RECIPIENT closeout report. * Properly maintained project documentation Recipient Task Coordinator: Ken Srilofung Deliverables Project Administration/Management Number Description Due Date 1.1 Quarterly Progress Reports 1.2 Recipient Closeout Report 1.3 Project Outcome Summary Report Version 10/30/2015 AGENDA ITEM #3. a) Page 8 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SCOPE OF WORK Task Number:2 Task Cost: $111,600.00 Task Title:Design Plans and Specs, Environmental Review Task Description: The RECIPIENT shall ensure the following items are completed and provide the associated deliverables to ECOLOGY The RECIPIENT must approve all materials prior to submitting them to ECOLOGY for acceptance. A.The RECIPIENT will coordinate the preparation and submittal of State Environmental Policy Act (SEPA) documentation. B.The RECIPIENT is responsible for application of, receipt of, and compliance with all required local, state, tribal and federal permits, licenses, easements, or property rights necessary for the project. C.The RECIPIENT will comply with Executive Order (05-05) cultural resources review requirements. To initiate cultural resources review the RECIPIENT will: 1.Submit an ECOLOGY 05-05/106 Form, or a cultural resources survey or assessment completed by a licensed archaeologist to ECOLOGY. All submitted materials must conform to the Washington State Standards for Cultural Resource Reporting (DAHP February 2014). 2.Develop and submit an Inadvertent Discovery Plan (IDP) to ECOLOGY. The RECIPIENT will ensure that all contractors and subcontractors have a copy of the completed IDP prior to and while working on-site. An IDP template may be found on the ECOLOGY website. Ground disturbing work (including geotechnical investigations) completed prior to receiving written notice to proceed from ECOLOGY shall not be eligible for reimbursement. D.The RECIPIENT will develop a project Design Report. Projects must be designed in accordance with the Stormwater Management Manual for Eastern Washington, Stormwater Management Manual for Western Washington, or equivalent manual. Project must be reviewed and accepted in writing by ECOLOGY to be eligible for reimbursement. The RECIPIENT will upload a digital copy of the items listed below to EAGL for review. Reduce design figures to 11x17 inches in size and ensure they are legible. 1.Design Report. For a complete list of required design report elements refer to the ECOLOGY website. The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology Design Report Acceptance Letter prior to proceeding to 90 Percent design. 2.90 Percent Design Package. At a minimum, this package must include 90 percent plans, specifications, engineer’s opinion of cost which includes a schedule of eligible costs, and project construction schedule. For current bid inserts and specifications refer to the ECOLOGY website. Version 10/30/2015 AGENDA ITEM #3. a) Page 9 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology 90 Percent Design Acceptance Letter prior to proceeding Final Design. 3.The RECIPIENT will upload a digital copy of the Final Bid Package to EAGL for review and acceptance prior to advertising the project. The Final Bid Package includes: project plans, specifications, engineer’s opinion of cost including a schedule of eligible costs, and project construction schedule. Task Goal Statement: The RECIPIENT will complete all design, environmental review, and permitting tasks and respond to ECOLOGY comments in a timely manner. Task Expected Outcome: The project will meet the requirements set forth by the State Environmental Policy Act, cultural resource protection requirements, ECOLOGY water quality facility design standards, and all other applicable federal, state and local laws and regulations. The project will produce a bid ready set of plans and specifications that will allow the the construction of an aesthetically pleasing, low cost, and effective solution to treat stormwater in the Heather Downs residential neighborhood. Version 10/30/2015 AGENDA ITEM #3. a) Page 10 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Recipient Task Coordinator: Ken Srilofung Deliverables Design Plans and Specs, Environmental Review Number Description Due Date 2.1 Copy of SEPA determination documentation. Upload to EAGL and notify ECOLOGY when upload is complete. 2.2 Submit ECOLOGY 05-05/106 Form and any supplemental cultural resources documentation including Cultural Resource surveys directly to the Ecology Project Manager. Upload the Final Determination Letter to EAGL. 2.3 Inadvertent Discovery Plan. Upload to EAGL and notify ECOLOGY when upload is complete. 2.4 Design Report. Upload to EAGL and notify ECOLOGY when upload is complete. 2.5 Responses to ECOLOGY Design Report comments. Upload to EAGL and notify ECOLOGY when upload is complete. 2.6 Ecology Design Report Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. 2.7 90 Percent Design Package. Upload to EAGL and notify ECOLOGY when upload is complete. 2.8 Responses to ECOLOGY 90 Percent Design Plan comments. Upload to EAGL and notify ECOLOGY when upload is complete. 2.9 Ecology 90 Percent Design Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. 2.10 List of permits acquired, and environmental review documents. Upload to EAGL and notify ECOLOGY when upload is complete. 2.11 Final Bid Package. Upload to EAGL and notify ECOLOGY when upload is complete. 2.12 Ecology Final Bid Package Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. Version 10/30/2015 AGENDA ITEM #3. a) Page 11 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton BUDGET Funding Distribution EG180582 NOTE: The above funding distribution number is used to identify this specific agreement and budget on payment remittances and may be referenced on other communications from ECOLOGY. Your agreement may have multiple funding distribution numbers to identify each budget. Title: State SFAP - SFY17 100% Environmental Legacy Stewardship Account (ELSA) - State Type: Funding Source %: Description: Approved Indirect Costs Rate: Recipient Match %: InKind Interlocal Allowed: InKind Other Allowed: Is this Funding Distribution used to match a federal grant? No Approved State Indirect Rate: 0% 25% No No Funding Title: Funding Source: Funding Expiration Date: Funding Type: Funding Effective Date: SFAP 01/01/2018 12/31/2020 Grant SFAP Task Total Project Administration/Management 12,400.00$ Design Plans and Specs, Environmental Review 111,600.00$ 124,000.00$Total: Version 10/30/2015 AGENDA ITEM #3. a) Page 12 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Funding Distribution Summary Recipient / Ecology Share Recipient Share Ecology Share TotalRecipient Match %Funding Distribution Name $$$%93,000.00 124,000.0031,000.0025.00SFAP Total $$31,000.00 93,000.00 $124,000.00 AGREEMENT SPECIFIC TERMS AND CONDITIONS N/A SPECIAL TERMS AND CONDITIONS SECTION 1: DEFINITIONS Unless otherwise provided, the following terms will have the respective meanings for all purposes of this agreement: “Administration Charge” means a charge established in accordance with Chapter 90.50A RCW and Chapter 173-98 WAC, to be used to pay Ecology’s cost to administer the State Revolving Fund by placing a percentage of the interest earned in an Administrative Charge Account. “Administrative Requirements” means the effective edition of ECOLOGY's Administrative Requirements for Recipients of Ecology Grants and Loans at the signing of this agreement. “Annual Debt Service” for any calendar year means for any applicable bonds or loans including the loan, all interest plus all principal due on such bonds or loans in such year. “Average Annual Debt Service” means, at the time of calculation, the sum of the Annual Debt Service for the remaining years of the loan to the last scheduled maturity of the loan divided by the number of those years. “Centennial Clean Water Program” means the state program funded from various state sources. “Contract Documents” means the contract between the RECIPIENT and the construction contractor for construction of the project. “Cost Effective Analysis” means a comparison of the relative cost-efficiencies of two or more potential ways of solving a water quality problem as described in Chapter 173-98-730 WAC. “Defease” or “Defeasance” means the setting aside in escrow or other special fund or account of sufficient investments and money dedicated to pay all principal of and interest on all or a portion of an obligation as it comes due. “Effective Date” means the earliest date on which eligible costs may be incurred. “Effective Interest Rate” means the total interest rate established by Ecology that includes the Administrative Charge. Version 10/30/2015 AGENDA ITEM #3. a) Page 13 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Estimated Loan Amount” means the initial amount of funds loaned to the RECIPIENT. “Estimated Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the Estimated Loan Amount. “Equivalency” means projects designated by ECOLOGY to meet additional federal requirements. “Final Accrued Interest” means the interest accrued beginning with the first disbursement of funds to the RECIPIENT through such time as the loan is officially closed out and a final loan repayment schedule is issued. “Final Loan Amount” means all principal of and interest on the loan from the Project Start Date through the Project Completion Date. “Final Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the Final Loan Amount. “Forgivable Principal” means the portion of a loan that is not required to be paid back by the borrower. “General Obligation Debt” means an obligation of the RECIPIENT secured by annual ad valorem taxes levied by the RECIPIENT and by the full faith, credit, and resources of the RECIPIENT. “General Obligation Payable from Special Assessments Debt” means an obligation of the RECIPIENT secured by a valid general obligation of the Recipient payable from special assessments to be imposed within the constitutional and statutory tax limitations provided by law without a vote of the electors of the RECIPIENT on all of the taxable property within the boundaries of the RECIPIENT. “Gross Revenue” means all of the earnings and revenues received by the RECIPIENT from the maintenance and operation of the Utility and all earnings from the investment of money on deposit in the Loan Fund, except (i) Utility Local Improvement Districts (ULID) Assessments, (ii) government grants, (iii) RECIPIENT taxes, (iv) principal proceeds of bonds and other obligations, or (v) earnings or proceeds (A) from any investments in a trust, Defeasance, or escrow fund created to Defease or refund Utility obligations or (B) in an obligation redemption fund or account other than the Loan Fund until commingled with other earnings and revenues of the Utility or (C) held in a special account for the purpose of paying a rebate to the United States Government under the Internal Revenue Code. “Guidelines” means the ECOLOGY's Funding Guidelines that that correlate to the State Fiscal Year in which the project is funded. “Initiation of Operation Date” means the actual date the Water Pollution Control Facility financed with proceeds of the loan begins to operate for its intended purpose. “Loan” means the Washington State Water Pollution Control Revolving Fund Loan or Centennial Clean Water Fund (Centennial) Loan made pursuant to this loan agreement. “Loan Amount” means either an Estimated Loan Amount or a Final Loan Amount, as applicable. Version 10/30/2015 AGENDA ITEM #3. a) Page 14 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Loan Fund” means the special fund of that name created by ordinance or resolution of the RECIPIENT for the repayment of the principal of and interest on the loan. “Loan Security” means the mechanism by which the RECIPIENT pledges to repay the loan. “Loan Term” means the repayment period of the loan. “Maintenance and Operation Expense” means all reasonable expenses incurred by the RECIPIENT in causing the Utility to be operated and maintained in good repair, working order, and condition including payments to other parties, but will not include any depreciation or RECIPIENT levied taxes or payments to the RECIPIENT in lieu of taxes. “Net Revenue” means the Gross Revenue less the Maintenance and Operation Expense. “Original Engineer’s Estimate” means the engineer’s estimate of construction costs included with bid documents. “Principal and Interest Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name created in the loan fund to be first used to repay the principal of and interest on the loan. “Project” means the project described in this agreement. “Project Completion Date” means the date specified in the agreement on which the Scope of Work will be fully completed. “Project Schedule” means that schedule for the project specified in the agreement. “Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name created in the loan fund to secure the payment of the principal of and interest on the loan. “Revenue-Secured Debt” means an obligation of the RECIPIENT secured by a pledge of the revenue of a utility and one not a general obligation of the RECIPIENT. “Risk-Based Determination” means an approach to sub-recipient monitoring and oversight based on risk factors associated to a RECIPIENT or project. “Scope of Work” means the tasks and activities constituting the project. “Section 319” means the section of the Clean Water Act that provides funding to address nonpoint sources of water pollution. “Senior Lien Obligations” means all revenue bonds and other obligations of the RECIPIENT outstanding on the date of execution of this loan agreement (or subsequently issued on a parity therewith, including refunding obligations) or issued after the date of execution of this loan agreement having a claim or lien on the Gross Revenue of the Utility prior and superior to the claim or lien of the loan, subject only to Maintenance and Operation Expense. “State Water Pollution Control Revolving Fund (Revolving Fund)” means the water pollution control revolving fund established by Chapter 90.50A.020 RCW. Version 10/30/2015 AGENDA ITEM #3. a) Page 15 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Termination Date” means the effective date of ECOLOGY’s termination of the agreement. “Termination Payment Date” means the date on which the RECIPIENT is required to repay to ECOLOGY any outstanding balance of the loan and all accrued interest. “Total Eligible Project Cost” means the sum of all costs associated with a water quality project that have been determined to be eligible for ECOLOGY grant or loan funding. “Total Project Cost” means the sum of all costs associated with a water quality project, including costs that are not eligible for ECOLOGY grant or loan funding. “ULID” means any utility local improvement district of the RECIPIENT created for the acquisition or construction of additions to and extensions and betterments of the Utility. “ULID Assessments” means all assessments levied and collected in any ULID. Such assessments are pledged to be paid into the Loan Fund (less any prepaid assessments permitted by law to be paid into a construction fund or account). ULID Assessments will include principal installments and any interest or penalties which may be due. “Utility” means the sewer system, stormwater system, or the combined water and sewer system of the RECIPIENT, the Net Revenue of which is pledged to pay and secure the loan. SECTION 2: THE FOLLOWING CONDITIONS APPLY TO ALL RECIPIENTS OF WATER QUALITY COMBINED FINANCIAL ASSISTANCE FUNDING. The Water Quality Financial Assistance Funding Guidelines are included in this agreement by reference and are available on ECOLOGY’s Water Quality Program website. A. Architectural and Engineering Services: The RECIPIENT certifies by signing this agreement that the requirements of Chapter 39.80 RCW, “Contracts for Architectural and Engineering Services,” have been, or shall be, met in procuring qualified architectural/engineering services. The RECIPIENT shall identify and separate eligible and ineligible costs in the final architectural/engineering services contract and submit a copy of the contract to ECOLOGY. B. Best Management Practices (BMP) Implementation: If the RECIPIENT installs BMPs that are not approved by ECOLOGY prior to installation, the RECIPIENT assumes the risk that part or all of the reimbursement for that activity may be delayed or ineligible. For more details regarding BMP Implementation, please reference the Water Quality Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website. C. Cultural Resources: The RECIPIENT shall: 1) The RECIPIENT shall comply with all applicable federal, state and local environmental laws, statutes, regulations, executive orders, and permits. 2) The RECIPIENT shall comply with Ecology’s Archaeological Resource and Historic Property review process. The RECIPIENT agrees that in no case shall construction activities, ground disturbance, or excavation of any kind, begin until provisions of this process are complied with. The RECIPIENT is responsible for developing a complete Inadvertent Discovery Plan (IDP). The IDP must be immediately available upon request by any party. The IDP must be readily available and be implemented to address any discovery. The RECIPIENT shall implement the procedures in Version 10/30/2015 AGENDA ITEM #3. a) Page 16 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton the IDP, and immediately notify ECOLOGY, the Department of Archeology and Historic Preservation (DAHP), and tribal representatives, if human remains, cultural, or archeological resources are discovered in the course of ground disturbing activities. For more details regarding requirements under this provision, please reference the Water Quality Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website. D. Electronic Fund Transfers: The RECIPIENT must register as a statewide vendor in order to receive payment reimbursement. Washington State’s Department of Enterprise Services (DES) issues all payments. DES maintains a central vendor file for Washington State agency use to process vendor payments. The RECIPIENT can complete the registration process online at: http://des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. This registration process allows the RECIPIENT to sign up for direct deposit payments, also known as electronic fund transfers (EFT). If the RECIPIENT has questions about the vendor registration process or setting up direct deposit payments contact DES Payee Help Desk at (360) 664-7779 or payeehelpdesk@des.wa.gov. E. Equipment Purchase: Equipment not included in the scope of work or the Ecology approved construction plans and specifications, must be pre-approved by ECOLOGY’s project manager before purchase. F. Funding Recognition: The RECIPIENT must inform the public about ECOLOGY or any EPA (see Section 3.B for Section 319 funded or Section 5.E for SRF funded projects) funding participation in this project through the use of project signs, acknowledgement in published materials, reports, the news media, websites, or other public announcements. Projects addressing site-specific locations must utilize appropriately sized and weather-resistant signs. Sign logos are available from ECOLOGY’s Financial Manager upon request. G. Growth Management Planning: The RECIPIENT certifies by signing this agreement that it is in compliance with the requirements of Chapter 36.70A RCW, “Growth Management Planning by Selected Counties and Cities.” If the status of compliance changes, either through RECIPIENT or legislative action, the RECIPIENT shall notify ECOLOGY in writing of this change within 30 days. H. Interlocal: The RECIPIENT certifies by signing this agreement that all negotiated interlocal agreements necessary for the project are, or shall be, consistent with the terms of this agreement and Chapter 39.34 RCW, “Interlocal Cooperation Act.” The RECIPIENT shall submit a copy of each interlocal agreement necessary for the project to ECOLOGY upon request. I. Lobbying and Litigation: Costs incurred for the purposes of lobbying or litigation are not eligible for funding under this agreement. J. Post Project Assessment Survey: The RECIPIENT agrees to participate in a brief survey regarding the key project results or water quality project outcomes and the status of long-term environmental results or goals from the project approximately three years after project completion. A representative from ECOLOGY’s Water Quality Program may contact the RECIPIENT to request this data. ECOLOGY may also conduct site interviews and inspections, and may otherwise evaluate the project, as part of this assessment. K. Project Status Evaluation: ECOLOGY may evaluate the status of this project 18 months from the effective date of this agreement. ECOLOGY’s Project Manager and Financial Manager will meet with the RECIPIENT to review spending trends, completion of outcome measures, and overall project administration and performance. If the RECIPIENT fails to make satisfactory progress toward achieving project outcomes, ECOLOGY may change the scope of work, reduce grant funds, or increase oversight measures. Version 10/30/2015 AGENDA ITEM #3. a) Page 17 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton L. Technical Assistance: Technical assistance for agriculture activities provided under the terms of this agreement shall be consistent with the current U.S. Natural Resource Conservation Service (“NRCS”) Field Office Technical Guide for Washington State. However, ECOLOGY may accept as eligible technical assistance, proposed practices, or project designs that do not meet these standards if approved in writing by the NRCS and ECOLOGY. SECTION 3: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND ONLY CENTENNIAL CLEAN WATER FUNDED PROJECTS BEING USED TO MATCH SECTION 319 FUNDS. The RECIPIENT must submit the following documents to ECOLOGY before this agreement is signed by ECOLOGY: 1. Federal Funding Accountability and Transparency Act (FFATA) Form, available on the Water Quality Program website. 2. Clean Water Act Section 319 Initial Data Reporting Sheet or the “Section 319 Initial Data Reporting” form in EAGL. A. Data Reporting: The RECIPIENT must complete the “Section 319 Initial Data Reporting” form in EAGL before this agreement can be signed by Ecology. This form is used to gather general information about the project. B. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the RECIPIENT shall provide signage that informs the public that the project is funded by EPA. The signage shall contain the EPA logo and follow usage requirements available at http://www2.epa.gov/stylebook/using-epa-seal-and-logo. To obtain the appropriate EPA logo or seal graphic file, the RECIPIENT may sent a request to their Ecology’s Financial Manager. To increase public awareness of projects serving communities where English is not the predominant language, RECIPIENTS are encouraged to provide their outreach strategies communication in non-English languages. Translation costs for this purpose are allowable, provided the costs are reasonable. The RECIPIENT shall use the following paragraph in all reports, documents, and signage developed under this agreement: “This project has been funded wholly or in part by the United States Environmental Protection Agency under an assistance agreement to the Washington State Department of Ecology. The contents of this document do not necessarily reflect the views and policies of the Environmental Protection Agency, nor does the mention of trade names or commercial products constitute endorsement or recommendation for use.” C. Load Reduction Reporting: The RECIPIENT shall complete the “Section 319 Annual Load Reduction Reporting” form in EAGL by January 15 of each year and at project close-out. ECOLOGY may hold reimbursements until the RECIPIENT has completed the form. This form is used to gather information on pollutant load reductions for each best management practice (BMP) installed as a part of this project. D. Time Extension: The RECIPIENT may request a one-time extension for up to 12 months. However, the time extension cannot exceed the time limitation established in EPA’s assistance agreement. In the event a time extension is requested and approved by ECOLOGY, the RECIPIENT must complete all eligible work performed under this agreement by the expiration date. Version 10/30/2015 AGENDA ITEM #3. a) Page 18 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SECTION 4: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND STATE REVOLVING FUND (SRF) LOAN FUNDED PROJECTS ONLY. A. Accounting Standards: The RECIPIENT shall maintain accurate records and accounts for the project (PROJECT Records) in accordance with Generally Accepted Accounting Principles (GAAP) as issued by the Governmental Accounting Standards Board (GASB), including standards related to the reporting of infrastructure assets or in accordance with the standards in Chapter 43.09.200 RCW “Local Government Accounting – Uniform System of Accounting”. B. Audit Requirements: In accordance with 2 CFR 200.501(a), the RECIPIENT agrees to obtain a single audit from an independent auditor, if their organization expends $750,000 or more in total Federal funds in their fiscal year. The RECIPIENT must submit the form SF-SAC and a Single Audit Report Package within 9 months of the end of the fiscal year or 30 days after receiving the report from an independent auditor. The SF-SAC and a Single Audit Report Package MUST be submitted using the Federal Audit Clearinghouse’s Internet Data Entry System available at: https://harvester.census.gov/fac/collect/ddeindex.html. For complete information on how to accomplish the single audit submissions, go to the Federal Audit Clearinghouse Web site: http://harvester.census.gov/fac/. C. Archaeological Resources and Historic Properties (Section 106): See Section 2.C of the terms and conditions of this agreement, the RECIPIENT shall comply with the additional requirements under section 106 of the National Historic Preservation Act (NHPA, 36 CFR 800). D. Consultant Cap: The RECIPIENT shall ensure that loan or grant funds provided under this agreement to reimburse for costs incurred by individual consultants (excluding overhead) is limited to the maximum daily rate for Level IV of the Executive Schedule (formerly GS-18), to be adjusted annually. The Executive Schedule can be found at: https://www.opm.gov/policy-data-oversight/pay-leave/salaries-wages/. This limit applies to consultation services of designated individuals with specialized skills who are paid at a daily or hourly rate. This rate does not include transportation and subsistence costs for travel performed. Contracts for services awarded using the procurement requirements in Subpart D of 2 CFR 200 are not affected by this limitation unless the terms of the contract provide the RECIPIENT with responsibility for the selection, direction, and control of the individuals who shall be providing services under the contract at an hourly or daily rate of compensation. See 2 CFR 1500.9 for additional information. E. Data Universal Numbering System (DUNS) and Central Contractor Registration (CCR) Requirements: RECIPIENTs shall have a DUNS number. Unless exempted from this requirement under 2 CFR 25.110, the RECIPIENT must ensure that the organization’s information in the System for Award Management (SAM), https://www.sam.gov, is kept current through project closeout. This requires that the RECIPIENT reviews and updates the information at least annually after the initial registration, and more frequently if information changes. F. Disadvantaged Business Enterprise (DBE): General Compliance, 40 CFR, Part 33. The RECIPIENT agrees to comply with the requirements of the Environmental Protection Agency’s Program for Utilization of Small, Minority, and Women’s Business Enterprises (MBE/WBE) 40CFR, Part 33 in procurement under this agreement. Six Good Faith Efforts, 40 CFR, Part 33, Subpart C. The RECIPIENT agrees to make the following good faith efforts whenever procuring construction, equipment, services and supplies under this agreement. Records documenting compliance with the following six good faith efforts shall be retained: 1) Ensure Disadvantaged Business Enterprises are made aware of contracting opportunities to the fullest extent practicable through outreach and recruitment activities. For Indian Tribal, State and Local and Government Version 10/30/2015 AGENDA ITEM #3. a) Page 19 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENTs, this shall include placing Disadvantaged Business Enterprises on solicitation lists and soliciting them whenever they are potential sources. 2) Make information on forthcoming opportunities available to Disadvantaged Business Enterprises and arrange time frames for contracts and establish delivery schedules, where the requirements permit, in a way that encourages and facilitates participation by Disadvantaged Business Enterprises in the competitive process. This includes, whenever possible, posting solicitations for bids or proposals for a minimum of thirty (30) calendar days before the bid or proposal closing date. 3) Consider in the contracting process whether firms competing for large contracts could subcontract with Disadvantaged Business Enterprises. For Indian Tribal, and State and Local Government RECIPIENTs, this shall include dividing total requirements when economically feasible into smaller tasks or quantities to permit maximum participation by Disadvantaged Business Enterprises in the competitive process. 4) Encourage contracting with a consortium of Disadvantaged Business Enterprises when a contract is too large for one of these firms to handle individually. 5) Use services and assistance of the Small Business Administration and the Minority Business Development Agency of the Department of Commerce. 6) If the prime contractor awards subcontracts, require the prime contractor to take the five good faith efforts steps in paragraphs 1 through 5 above. The RECIPIENT agrees to submit ECOLOGY’s Contractor Participation Report Form D with each payment request. Contract Administration Provisions, 40 CFR, Section 33.302. The RECIPIENT agrees to comply with the contract administration provisions of 40 CFR, Section 33.302. Non-discrimination Provision. The RECIPIENT shall not discriminate on the basis of race, color, national origin or sex in the performance of this agreement. The RECIPIENT shall carry out applicable requirements of 40 CFR Part 33 in the award and administration of contracts awarded under EPA financial assistance agreements. Failure by the RECIPIENT to carry out these requirements is a material breach of this agreement which may result in the termination of this contract or other legally available remedies. This does not preclude the RECIPIENT from enacting broader nondiscrimination protections. The RECIPIENT shall comply with all federal and state nondiscrimination laws, including, but not limited to Title VI and VII of the Civil Rights Act of 1964, Section 504 of the Rehabilitation Act of 1973, Title IX of the Education Amendments of 1972, the Age Discrimination Act of 1975, and Chapter 49.60 RCW, Washington’s Law Against Discrimination, and 42 U.S.C. 12101 et seq, the Americans with Disabilities Act (ADA). In the event of the RECIPIENT’s noncompliance or refusal to comply with any applicable nondiscrimination law, regulation, or policy, this agreement may be rescinded, canceled, or terminated in whole or in part, and the RECIPIENT may be declared ineligible for further funding from ECOLOGY. The RECIPIENT shall, however, be given a reasonable time in which to cure this noncompliance. The RECIPIENT shall include the following terms and conditions in contracts with all contractors, subcontractors, Version 10/30/2015 AGENDA ITEM #3. a) Page 20 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton engineers, vendors, and any other entity for work or services pertaining to this agreement. “The Contractor will not discriminate on the basis of race, color, national origin or sex in the performance of this Contract. The Contractor will carry out applicable requirements of 40 CFR Part 33 in the award and administration of contracts awarded under Environmental Protection Agency financial agreements. Failure by the Contractor to carry out these requirements is a material breach of this Contract which may result in termination of this Contract or other legally available remedies.” Bidder List, 40 CFR, Section 33.501(b) and (c). The RECIPIENT agrees to create and maintain a bidders list. The bidders list shall include the following information for all firms that bid or quote on prime contracts, or bid or quote subcontracts, including both MBE/WBEs and non-MBE/WBEs. 1. Entity's name with point of contact 2. Entity's mailing address, telephone number, and e-mail address 3. The procurement on which the entity bid or quoted, and when 4. Entity's status as an MBE/WBE or non-MBE/WBE G. Electronic and information Technology (EIT) Accessibility: RECIPIENTs shall ensure that loan funds provided under this agreement for costs in the development or purchase of EIT systems or products provide individuals with disabilities reasonable accommodations and an equal and effective opportunity to benefit from or participate in a program, including those offered through electronic and information technology as per Section 504 of the Rehabilitation Act, codified in 40 CFR Part 7. Systems or products funded under this agreement must be designed to meet the diverse needs of users without barriers or diminished function or quality. Systems shall include usability features or functions that accommodate the needs of persons with disabilities, including those who use assistive technology. H. Hotel-Motel Fire Safety Act: The RECIPIENT shall ensure that all space for conferences, meetings, conventions or training seminars funded in whole or in part with federal funds complies with the protection and control guidelines of the Hotel and Motel Fire Safety Act (15 USC 2225a, PL 101-391, as amended). Recipients may search the Hotel-Motel National Master List at http://www.usfa.dhs.gov/applications/hotel/ to see if a property is in compliance, or to find other information about the Act. Pursuant to 15 USC 2225a. I. Trafficking In Persons: The RECIPIENT and RECIPIENT employees that are private entities shall not engage in forms of trafficking in persons during the period of time this agreement is effective. This includes, but is not limited to the procurement of a commercial sex act or forced labor. The RECIPIENT shall notify ECOLOGY immediately of any information received from any source alleging a violation under this provision. SECTION 5: THE FOLLOWING CONDITIONS APPLY TO STATE REVOLVING FUND (SRF) LOAN FUNDED PROJECTS ONLY. The RECIPIENT must submit the following documents/forms to ECOLOGY before this agreement is signed by ECOLOGY: 1. Opinion of RECIPIENT’s Legal Council 2. Authorizing Ordinance or Resolution 3. Federal Funding Accountability and Transparency Act (FFATA) Form 4. CWSRF Federal Reporting Information form available in EAGL Version 10/30/2015 AGENDA ITEM #3. a) Page 21 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton 5. Fiscal Sustainability Plan Certification (only required if the project includes construction of a wastewater or stormwater facility construction) A. Alteration and Eligibility of Project: During the term of this agreement, the RECIPIENT (1) shall not materially alter the design or structural character of the project without the prior written approval of ECOLOGY and (2) shall take no action which would adversely affect the eligibility of the project as defined by applicable funding program rules and state statutes, or which would cause a violation of any covenant, condition, or provision herein. B. American Iron and Steel (Buy American): This loan provision applies to projects for the construction, alteration, maintenance, or repair of a “treatment works” as defined in the Federal Water Pollution Control Act (33 USC 1381 et seq.) The RECIPIENT shall ensure that all iron and steel products used in the project are produced in the United States. Iron and Steel products means the following products made primarily of iron or steel: lined or unlined pipes and fittings, manhole covers and other municipal castings, hydrants, tanks, flanges, pipe clamps and restraints, valves, structural steel, reinforced precast concrete, and construction materials. The RECIPIENT may request waiver from this requirement from the Administrator of the Environmental Protection Agency. The RECIPIENT must coordinate all waiver requests through ECOLOGY. This provision does not apply if the engineering plans and specifications for the project were approved by ECOLOGY prior to January 17, 2014. ECOLOGY reserves the right to request documentation of RECIPIENT’S compliance with this provision. C. Authority of RECIPIENT: This agreement is authorized by the Constitution and laws of the state of Washington, including the RECIPIENT’s authority, and by the RECIPIENT pursuant to the authorizing ordinance or resolution. The RECIPIENT shall submit a copy of the authorizing ordinance or resolution to the ECOLOGY Financial Manager before this agreement shall be signed by ECOLOGY. D. Fiscal Sustainability Plan Certification: The RECIPIENT shall submit a completed Fiscal Sustainability Plan Certification before this agreement is signed by ECOLOGY. The Fiscal Sustainability Plan Certification is available from the ECOLOGY Financial Manager or on the Water Quality Program website. E. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the RECIPIENT agrees to comply with the EPA SRF Signage Guidance in order to enhance public awareness of EPA assistance agreements nationwide. The signage guidance can be found at: http://www.ecy.wa.gov/programs/wq/funding/FundPrgms/CWSRF/SignageGuidanceJune2015.pdf. F. Free Service: The RECIPIENT shall not furnish utility service to any customer free of charge if providing that free service affects the RECIPIENT's ability to meet the obligations of this agreement. G. Insurance: The RECIPIENT shall at all times carry fire and extended coverage, public liability, and property damage, and such other forms of insurance with responsible insurers and with policies payable to the RECIPIENT on such of the buildings, equipment, works, plants, facilities, and properties of the Utility as are ordinarily carried by municipal or privately-owned utilities engaged in the operation of like systems, and against such claims for damages as are ordinarily carried by municipal or privately-owned utilities engaged in the operation of like systems, or it shall self-insure or participate in an insurance pool or pools with reserves adequate, in the reasonable judgment of the RECIPIENT, to protect it against loss. H. Loan Interest Rate and Terms: This loan agreement shall remain in effect until the date of final repayment of the loan, unless terminated earlier according to the provisions herein. Version 10/30/2015 AGENDA ITEM #3. a) Page 22 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton When the Project Completion Date has occurred, ECOLOGY and the RECIPIENT shall execute an amendment to this loan agreement which details the final loan amount (Final Loan Amount), and ECOLOGY shall prepare a final loan repayment schedule. The Final Loan Amount shall be the combined total of actual disbursements made on the loan and all accrued interest to the computation date. The Estimated Loan Amount and the Final Loan Amount (in either case, as applicable, a “Loan Amount”) shall bear interest based on the interest rate identified in this agreement as the “Effective Interest Rate,” per annum, calculated on the basis of a 365 day year. Interest on the Estimated Loan Amount shall accrue from and be compounded monthly based on the date that each payment is mailed to the RECIPIENT. The Final Loan Amount shall be repaid in equal installments semiannually over the term of this loan “Loan Term” as outlined in this agreement. I. Loan Repayment: Sources of Loan Repayment 1. Nature of RECIPIENT's Obligation. The obligation of the RECIPIENT to repay the loan from the sources identified below and to perform and observe all of the other agreements and obligations on its part contained herein shall be absolute and unconditional, and shall not be subject to diminution by setoff, counterclaim, or abatement of any kind. To secure the repayment of the loan from ECOLOGY, the RECIPIENT agrees to comply with all of the covenants, agreements, and attachments contained herein. 2. For General Obligation. This loan is a General Obligation Debt of the RECIPIENT. 3. For General Obligation Payable from Special Assessments. This loan is a General Obligation Debt of the RECIPIENT payable from special assessments to be imposed within the constitutional and statutory tax limitations provided by law without a vote of the electors of the RECIPIENT on all of the taxable property within the boundaries of the RECIPIENT. 4. For Revenue-Secured: Lien Position. This loan is a Revenue-Secured Debt of the RECIPIENT’s Utility. This loan shall constitute a lien and charge upon the Net Revenue junior and subordinate to the lien and charge upon such Net Revenue of any Senior Lien Obligations. In addition, if this loan is also secured by Utility Local Improvement Districts (ULID) Assessments, this loan shall constitute a lien upon ULID Assessments in the ULID prior and superior to any other charges whatsoever. 5. Other Sources of Repayment. The RECIPIENT may repay any portion of the loan from any funds legally available to it. 6. Defeasance of the Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT shall not be entitled to, and shall not affect, an economic Defeasance of the loan. The RECIPIENT shall not advance refund the loan. If the RECIPIENT defeases or advance refunds the loan, it shall be required to use the proceeds thereof immediately upon their receipt, together with other available RECIPIENT funds, to repay both of the following: (i) The Loan Amount with interest (ii) Any other obligations of the RECIPIENT to ECOLOGY under this agreement, unless in its sole discretion ECOLOGY finds that repayment from those additional sources would not be in the public interest. Version 10/30/2015 AGENDA ITEM #3. a) Page 23 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Failure to repay the Loan Amount plus interest within the time specified in ECOLOGY’s notice to make such repayment shall incur Late Charges and shall be treated as a Loan Default. 7. Refinancing or Early Repayment of the Project. So long as ECOLOGY shall hold this loan, the RECIPIENT shall give ECOLOGY thirty days written notice if the RECIPIENT intends to refinance or make early repayment of the loan. Method and Conditions on Repayments 1. Semiannual Payments. Notwithstanding any other provision of this agreement, the first semiannual payment of principal and interest on this loan shall be due and payable no later than one year after the project completion date or initiation of operation date, whichever comes first. Thereafter, equal payments shall be due every six months. If the due date for any semiannual payment falls on a Saturday, Sunday, or designated holiday for Washington State agencies, the payment shall be due on the next business day for Washington State agencies. Payments shall be mailed to: Department of Ecology Cashiering Unit P.O. Box 47611 Olympia WA 98504-7611 In lieu of mailing payments, electronic fund transfers can be arranged by working with ECOLOGY’s Financial Manager. No change to the amount of the semiannual principal and interest payments shall be made without a formal amendment to this agreement. The RECIPIENT shall continue to make semiannual payments based on this agreement until the amendment is effective, at which time the RECIPIENT’s payments shall be made pursuant to the amended agreement. 2. Late Charges. If any amount of the Final Loan Amount or any other amount owed to ECOLOGY pursuant to this agreement remains unpaid after it becomes due and payable, ECOLOGY may assess a late charge. The late charge shall be one percent per month on the past due amount starting on the date the debt becomes past due and until it is paid in full. 3. Repayment Limitations. Repayment of the loan is subject to the following additional limitations, among others: those on defeasance, refinancing and advance refunding, termination, and default and recovery of payments. 4. Prepayment of Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT may prepay the entire unpaid principal balance of and accrued interest on the loan or any portion of the remaining unpaid principal balance of the Loan Amount. Any prepayments on the loan shall be applied first to any accrued interest due and then to the outstanding principal balance of the Loan Amount. If the RECIPIENT elects to prepay the entire remaining unpaid balance and accrued interest, the RECIPIENT shall first contact ECOLOGY’s Revenue/Receivable Manager of the Fiscal Office. Version 10/30/2015 AGENDA ITEM #3. a) Page 24 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton J. Loan Security Due Regard: For loans secured with a Revenue Obligation: The RECIPIENT shall exercise due regard for Maintenance and Operation Expense and the debt service requirements of the Senior Lien Obligations and any other outstanding obligations pledging the Gross Revenue of the Utility, and it has not obligated itself to set aside and pay into the loan Fund a greater amount of the Gross Revenue of the Utility than, in its judgment, shall be available over and above such Maintenance and Operation Expense and those debt service requirements. Where collecting adequate gross utility revenue requires connecting additional users, the RECIPIENT shall require the sewer system connections necessary to meet debt obligations and expected operation and maintenance expenses. Levy and Collection of Taxes (if used to secure the repayment of the loan): For so long as the loan is outstanding, the RECIPIENT irrevocably pledges to include in its budget and levy taxes annually within the constitutional and statutory tax limitations provided by law without a vote of its electors on all of the taxable property within the boundaries of the RECIPIENT in an amount sufficient, together with other money legally available and to be used therefore, to pay when due the principal of and interest on the loan, and the full faith, credit and resources of the RECIPIENT are pledged irrevocably for the annual levy and collection of those taxes and the prompt payment of that principal and interest. Not an Excess Indebtedness: For loans secured with a general obligation pledge or a general obligation pledge on special assessments: The RECIPIENT agrees that this agreement and the loan to be made do not create an indebtedness of the RECIPIENT in excess of any constitutional or statutory limitations. Pledge of Net Revenue and ULID Assessments in the ULID (if used to secure the repayment of this loan): For so long as the loan is outstanding, the RECIPIENT irrevocably pledges the Net Revenue of the Utility, including applicable ULID Assessments in the ULID, to pay when due the principal of and interest on the loan. Reserve Requirement: For loans that are Revenue-Secured Debt with terms greater than five years, the RECIPIENT must accumulate a reserve for the loan equivalent to at least the Average Annual Debt Service on the loan during the first five years of the repayment period of the loan. This amount shall be deposited in a Reserve Account in the Loan Fund in approximately equal annual payments commencing within one year after the initiation of operation or the project completion date, whichever comes first. “Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, an account of that name created in the Loan Fund to secure the payment of the principal and interest on the loan. The amount on deposit in the Reserve Account may be applied by the RECIPIENT (1) to make, in part or in full, the final repayment to ECOLOGY of the loan amount or, (2) if not so applied, for any other lawful purpose of the RECIPIENT once the Loan Amount, plus interest and any other amounts owing to ECOLOGY, have been paid in full. Utility Local Improvement District (ULID) Assessment Collection (if used to secure the repayment of the loan): All ULID Assessments in the ULID shall be paid into the loan Fund and used to pay the principal of and interest on the loan. The ULID Assessments in the ULID may be deposited into the Reserve Account to satisfy a Reserve Requirement if a Reserve Requirement is applicable. K. Maintenance and Operation of a Funded Utility: The RECIPIENT shall at all times maintain and keep a funded Utility in good repair, working order and condition and also shall at all times operate the Utility and the business in an efficient manner and at a reasonable cost. L. Opinion of RECIPIENT’s Legal Counsel: The RECIPIENT must submit an “Opinion of Legal Counsel to the Version 10/30/2015 AGENDA ITEM #3. a) Page 25 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT” to ECOLOGY before this agreement shall be signed. ECOLOGY will provide the form. M. Prevailing Wage (Davis-Bacon Act): The RECIPIENT agrees, by signing this agreement, to comply with the Davis-Bacon Act prevailing wage requirements. This applies to the construction, alteration, and repair of treatment works carried out in whole or in part with assistance made available by the State Revolving Fund as authorized by Section 513, title VI of the Federal Water Pollution Control Act (33 U.S.C. 1372). Laborers and mechanics employed by contractors and subcontractors shall be paid wages not less often than once a week and at rates not less than those prevailing on projects of a character similar in the locality as determined by the Secretary of Labor. The RECIPIENT shall obtain the wage determination for the area in which the project is located prior to issuing requests for bids, proposals, quotes or other methods for soliciting contracts (solicitation). These wage determinations shall be incorporated into solicitations and any subsequent contracts. The RECIPIENT shall ensure that the required EPA contract language regarding Davis-Bacon Wages is in all contracts and sub contracts in excess of $2,000. The RECIPIENT shall maintain records sufficient to document compliance with the Davis-Bacon Act, and make such records available for review upon request. The RECIPIENT also agrees, by signing this agreement, to comply with State Prevailing Wages on Public Works, Chapter 39.12 RCW, as applicable. Compliance may include the determination whether the project involves “public work” and inclusion of the applicable prevailing wage rates in the bid specifications and contracts. The RECIPIENT agrees to maintain records sufficient to evidence compliance with Chapter 39.12 RCW, and make such records available for review upon request. N. Litigation; Authority: No litigation is now pending, or to the RECIPIENT’s knowledge, threatened, seeking to restrain, or enjoin: (i) the execution of this agreement; or (ii) the fixing or collection of the revenues, rates, and charges or the formation of the ULID and the levy and collection of ULID Assessments therein pledged to pay the principal of and interest on the loan (for revenue secured lien obligations); or (iii) the levy and collection of the taxes pledged to pay the principal of and interest on the loan (for general obligation-secured loans and general obligation payable from special-assessment-secured loans); or (iv) in any manner questioning the proceedings and authority under which the agreement, the loan, or the project are authorized. Neither the corporate existence or boundaries of the RECIPIENT nor the title of its present officers to their respective offices is being contested. No authority or proceeding for the execution of this agreement has been repealed, revoked, or rescinded. O. Representations and Warranties: The RECIPIENT represents and warrants to ECOLOGY as follows: Application: Material Information. All information and materials submitted by the RECIPIENT to ECOLOGY in connection with its loan application were, when made, and are, as of the date the RECIPIENT signs this agreement, true and correct. There is no material adverse information relating to the RECIPIENT, the project, the loan, or this agreement known to the RECIPIENT which has not been disclosed in writing to ECOLOGY. Existence; Authority. It is a duly formed and legally existing municipal corporation or political subdivision of the Version 10/30/2015 AGENDA ITEM #3. a) Page 26 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton state of Washington or a federally recognized Indian Tribe. It has full corporate power and authority to execute, deliver, and perform all of its obligations under this agreement and to undertake the project identified herein. Certification. Each payment request shall constitute a certification by the RECIPIENT to the effect that all representations and warranties made in this loan agreement remain true as of the date of the request and that no adverse developments, affecting the financial condition of the RECIPIENT or its ability to complete the project or to repay the principal of or interest on the loan, have occurred since the date of this loan agreement. Any changes in the RECIPIENT’s financial condition shall be disclosed in writing to ECOLOGY by the RECIPIENT in its request for payment. P. Sale or Disposition of Utility: The RECIPIENT shall not sell, transfer, or otherwise dispose of any of the works, plant, properties, facilities, or other part of the Utility or any real or personal property comprising a part of the Utility unless: 1. The facilities or property transferred are not material to the operation of the Utility, or have become unserviceable, inadequate, obsolete, or unfit to be used in the operation of the Utility or are no longer necessary, material, or useful to the operation of the Utility; or 2. The aggregate depreciated cost value of the facilities or property being transferred in any fiscal year comprises no more than three percent of the total assets of the Utility; or 3. The RECIPIENT receives from the transferee an amount equal to an amount which will be in the same proportion to the net amount of Senior Lien Obligations and this LOAN then outstanding (defined as the total amount outstanding less the amount of cash and investments in the bond and loan funds securing such debt) as the Gross Revenue of the Utility from the portion of the Utility sold or disposed of for the preceding year bears to the total Gross Revenue for that period. 4. Expressed written agreement by the DEPARTMENT. The proceeds of any transfer under this paragraph must be used (1) to redeem promptly, or irrevocably set aside for the redemption of, Senior Lien Obligations and to redeem promptly the loan, and (2) to provide for part of the cost of additions to and betterments and extensions of the Utility. Q. Sewer-Use Ordinance or Resolution: If not already in existence, the RECIPIENT shall adopt and shall enforce a sewer-use ordinance or resolution. Such ordinance or resolution shall be submitted to ECOLOGY upon request. The sewer use ordinance must include provisions to: 1) Prohibit the introduction of toxic or hazardous wastes into the RECIPIENT’s sewer system. 2) Prohibit inflow of stormwater. 3) Require that new sewers and connections be properly designed and constructed. R. Termination and Default: Termination and Default Events 1. For Insufficient ECOLOGY or RECIPIENT Funds. ECOLOGY may terminate this loan agreement for insufficient ECOLOGY or RECIPIENT funds. Version 10/30/2015 AGENDA ITEM #3. a) Page 27 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton 2. For Failure to Commence Work. ECOLOGY may terminate this loan agreement for failure of the RECIPIENT to commence project work. 3. Past Due Payments. The RECIPIENT shall be in default of its obligations under this loan agreement when any loan repayment becomes 60 days past due. 4. Other Cause. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance in full by the RECIPIENT of all of its obligations under this loan agreement. The RECIPIENT shall be in default of its obligations under this loan agreement if, in the opinion of ECOLOGY, the RECIPIENT has unjustifiably failed to perform any obligation required of it by this loan agreement. Procedures for Termination. If this loan agreement is terminated prior to project completion, ECOLOGY shall provide to the RECIPIENT a written notice of termination at least five working days prior to the effective date of termination (the “Termination Date”). The written notice of termination by the ECOLOGY shall specify the Termination Date and, when applicable, the date by which the RECIPIENT must repay any outstanding balance of the loan and all accrued interest (the “Termination Payment Date”). Termination and Default Remedies No Further Payments. On and after the Termination Date, or in the event of a default event, ECOLOGY may, at its sole discretion, withdraw the loan and make no further payments under this agreement. Repayment Demand. In response to an ECOLOGY initiated termination event, or in response to a loan default event, ECOLOGY may at its sole discretion demand that the RECIPIENT repay the outstanding balance of the Loan Amount and all accrued interest. Interest after Repayment Demand. From the time that ECOLOGY demands repayment of funds, amounts owed by the RECIPIENT to ECOLOGY shall accrue additional interest at the rate of one percent per month, or fraction thereof. Accelerate Repayments. In the event of a default, ECOLOGY may, in its sole discretion, declare the principal of and interest on the loan immediately due and payable, subject to the prior lien and charge of any outstanding Senior Lien Obligation upon the Net Revenue. That is, the loan is not subject to acceleration so long as any Senior Lien Obligations are outstanding. Repayments not made immediately upon such acceleration will incur Late Charges. Late Charges. All amounts due to ECOLOGY and not paid by the RECIPIENT by the Termination Payment Date or after acceleration following a default event, as applicable, shall incur late charges. Intercept State Funds. In the event of a default event and in accordance with Chapter 90.50A.060 RCW, “Defaults,” any state funds otherwise due to the RECIPIENT may, at ECOLOGY’s sole discretion, be withheld and applied to the repayment of the loan. Property to ECOLOGY. In the event of a default event and at the option of ECOLOGY, any personal property (equipment) acquired under this agreement may, in ECOLOGY’s sole discretion, become ECOLOGY’s property. In that circumstance, ECOLOGY shall reduce the RECIPIENT’s liability to repay money by an amount reflecting the fair value of such property. Version 10/30/2015 AGENDA ITEM #3. a) Page 28 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Documents and Materials. If this agreement is terminated, all finished or unfinished documents, data studies, surveys, drawings, maps, models, photographs, and reports or other materials prepared by the RECIPIENT shall, at the option of ECOLOGY, become ECOLOGY property. The RECIPIENT shall be entitled to receive just and equitable compensation for any satisfactory work completed on such documents and other materials. Collection and Enforcement Actions. In the event of a default event, the state of Washington reserves the right to take any actions it deems necessary to collect the amounts due, or to become due, or to enforce the performance and observance of any obligation by the RECIPIENT, under this agreement. Fees and Expenses. In any action to enforce the provisions of this agreement, reasonable fees and expenses of attorneys and other reasonable expenses (including, without limitation, the reasonably allocated costs of legal staff) shall be awarded to the prevailing party as that term is defined in Chapter 4.84.330 RCW. Damages. Notwithstanding ECOLOGY’s exercise of any or all of the termination or default remedies provided in this agreement, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by ECOLOGY and/or the state of Washington because of any breach of this agreement by the RECIPIENT. ECOLOGY may withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from the RECIPIENT is determined. S. User-Charge System: The RECIPIENT certifies that it has the legal authority to establish and implement a user-charge system and shall adopt a system of user-charges to assure that each user of the utility shall pay its proportionate share of the cost of operation and maintenance, including replacement during the design life of the project. In addition, the RECIPIENT shall regularly evaluate the user-charge system, at least annually, to ensure the system provides adequate revenues necessary to operate and maintain the utility, to establish a reserve to pay for replacement, to establish the required Loan Reserve Account, and to repay the loan. WATER QUALITY COMBINED FINANCIAL ASSISTANCE TERMS AND CONDITIONS LAST UPDATED ON 10/04/2016 GENERAL FEDERAL CONDITIONS If a portion or all of the funds for this agreement are provided through federal funding sources or this agreement is used to match a federal grant award, the following terms and conditions apply to you. A. CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY EXCLUSION: 1.The RECIPIENT/CONTRACTOR, by signing this agreement, certifies that it is not suspended, debarred, proposed for debarment, declared ineligible or otherwise excluded from contracting with the federal government, or from receiving contracts paid for with federal funds. If the RECIPIENT/CONTRACTOR is unable to certify to the statements contained in the certification, they must provide an explanation as to why they cannot. 2.The RECIPIENT/CONTRACTOR shall provide immediate written notice to ECOLOGY if at any time the RECIPIENT/CONTRACTOR learns that its certification was erroneous when submitted or had become erroneous by reason of changed circumstances. 3.The terms covered transaction, debarred, suspended, ineligible, lower tier covered transaction, participant, Version 10/30/2015 AGENDA ITEM #3. a) Page 29 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton person, primary covered transaction, principal, proposal, and voluntarily excluded, as used in this clause, have the meaning set out in the Definitions and Coverage sections of rules implementing Executive Order 12549. You may contact ECOLOGY for assistance in obtaining a copy of those regulations. 4.The RECIPIENT/CONTRACTOR agrees it shall not knowingly enter into any lower tier covered transaction with a person who is proposed for debarment under the applicable Code of Federal Regulations, debarred, suspended, declared ineligible, or voluntarily excluded from participation in this covered transaction. 5.The RECIPIENT/CONTRACTOR further agrees by signing this agreement, that it will include this clause titled “CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY EXCLUSION” without modification in all lower tier covered transactions and in all solicitations for lower tier covered transactions. 6.Pursuant to 2CFR180.330, the RECIPIENT/CONTRACTOR is responsible for ensuring that any lower tier covered transaction complies with certification of suspension and debarment requirements. 7.RECIPIENT/CONTRACTOR acknowledges that failing to disclose the information required in the Code of Federal Regulations may result in the delay or negation of this funding agreement, or pursuance of legal remedies, including suspension and debarment. 8.RECIPIENT/CONTRACTOR agrees to keep proof in its agreement file, that it, and all lower tier recipients or contractors, are not suspended or debarred, and will make this proof available to ECOLOGY before requests for reimbursements will be approved for payment. RECIPIENT/CONTRACTOR must run a search in <http://www.sam.gov> and print a copy of completed searches to document proof of compliance. B. FEDERAL FUNDING ACCOUNTABILITY AND TRANSPARENCY ACT (FFATA) REPORTING REQUIREMENTS: CONTRACTOR/RECIPIENT must complete the FFATA Data Collection Form (ECY 070-395) and return it with the signed agreement to ECOLOGY. Any CONTRACTOR/RECIPIENT that meets each of the criteria below must report compensation for its five top executives using the FFATA Data Collection Form. ·Receives more than $25,000 in federal funds under this award. ·Receives more than 80 percent of its annual gross revenues from federal funds. ·Receives more than $25,000,000 in annual federal funds. Ecology will not pay any invoices until it has received a completed and signed FFATA Data Collection Form. Ecology is required to report the FFATA information for federally funded agreements, including the required DUNS number, at www.fsrs.gov <http://www.fsrs.gov/> within 30 days of agreement signature. The FFATA information will be available to the public at www.usaspending.gov <http://www.usaspending.gov/>. For more details on FFATA requirements, see www.fsrs.gov <http://www.fsrs.gov/>. Version 10/30/2015 AGENDA ITEM #3. a) Page 30 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton GENERAL TERMS AND CONDITIONS Pertaining to Grant and Loan Agreements With the state of Washington, Department of Ecology GENERAL TERMS AND CONDITIONS AS OF LAST UPDATED 1/22/2018 VERSION 1.ADMINISTRATIVE REQUIREMENTS a)RECIPIENT shall follow the "Administrative Requirements for Recipients of Ecology Grants and Loans – EAGL Edition." (https://fortress.wa.gov/ecy/publications/SummaryPages/1701004.html) b)RECIPIENT shall complete all activities funded by this Agreement and be fully responsible for the proper management of all funds and resources made available under this Agreement. c)RECIPIENT agrees to take complete responsibility for all actions taken under this Agreement, including ensuring all subgrantees and contractors comply with the terms and conditions of this Agreement. ECOLOGY reserves the right to request proof of compliance by subgrantees and contractors. d)RECIPIENT’s activities under this Agreement shall be subject to the review and approval by ECOLOGY for the extent and character of all work and services. 2.AMENDMENTS AND MODIFICATIONS This Agreement may be altered, amended, or waived only by a written amendment executed by both parties. No subsequent modification(s) or amendment(s) of this Agreement will be of any force or effect unless in writing and signed by authorized representatives of both parties. ECOLOGY and the RECIPIENT may change their respective staff contacts and administrative information without the concurrence of either party. 3.ARCHAEOLOGICAL AND CULTURAL RESOURCES RECIPIENT shall take reasonable action to avoid, minimize, or mitigate adverse effects to archeological and historic resources. The RECIPIENT must agree to hold harmless the State of Washington in relation to any claim related to historical or cultural artifacts discovered, disturbed, or damaged due to the RECIPIENT’s project funded under this Agreement. RECIPIENT shall: a)Contact the ECOLOGY Program issuing the grant or loan to discuss any Cultural Resources requirements for their project: •For capital construction projects or land acquisitions for capital construction projects, if required, comply with Governor Executive Order 05-05, Archaeology and Cultural Resources. •For projects with any federal involvement, if required, comply with the National Historic Preservation Act. •Any cultural resources federal or state requirements must be completed prior to the start of any work on the project site. b)If required by the ECOLOGY Program, submit an Inadvertent Discovery Plan (IDP) to ECOLOGY prior to implementing any project that involves ground disturbing activities. ECOLOGY will provide the IDP form. RECIPIENT shall: •Keep the IDP at the project site. •Make the IDP readily available to anyone working at the project site. •Discuss the IDP with staff and contractors working at the project site. •Implement the IDP when cultural resources or human remains are found at the project site. c)If any archeological or historic resources are found while conducting work under this Agreement: •Immediately stop work and notify the ECOLOGY Program, the Department of Archaeology and Historic Preservation at (360) 586-3064, any affected Tribe, and the local government. d)If any human remains are found while conducting work under this Agreement: Version 10/30/2015 AGENDA ITEM #3. a) Page 31 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton •Immediately stop work and notify the local Law Enforcement Agency or Medical Examiner/Coroner’s Office, and then the ECOLOGY Program. e)Comply with RCW 27.53, RCW 27.44.055, and RCW 68.50.645, and all other applicable local, state, and federal laws protecting cultural resources and human remains. 4.ASSIGNMENT No right or claim of the RECIPIENT arising under this Agreement shall be transferred or assigned by the RECIPIENT. 5.COMMUNICATION RECIPIENT shall make every effort to maintain effective communications with the RECIPIENT's designees, ECOLOGY, all affected local, state, or federal jurisdictions, and any interested individuals or groups. 6.COMPENSATION a)Any work performed prior to effective date of this Agreement will be at the sole expense and risk of the RECIPIENT. ECOLOGY must sign the Agreement before any payment requests can be submitted. b)Payments will be made on a reimbursable basis for approved and completed work as specified in this Agreement. c)RECIPIENT is responsible to determine if costs are eligible. Any questions regarding eligibility should be clarified with ECOLOGY prior to incurring costs. Costs that are conditionally eligible require approval by ECOLOGY prior to expenditure. d)RECIPIENT shall not invoice more than once per month unless agreed on by ECOLOGY. e)ECOLOGY will not process payment requests without the proper reimbursement forms, Progress Report and supporting documentation. ECOLOGY will provide instructions for submitting payment requests. f)ECOLOGY will pay the RECIPIENT thirty (30) days after receipt of a properly completed request for payment. g)RECIPIENT will receive payment through Washington State Department of Enterprise Services’ Statewide Payee Desk. RECIPIENT must register as a payee by submitting a Statewide Payee Registration form and an IRS W-9 form at the website, http://www.des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. For any questions about the vendor registration process contact the Statewide Payee Help Desk at (360) 407-8180 or email payeehelpdesk@watech.wa.gov. h)ECOLOGY may, at its sole discretion, withhold payments claimed by the RECIPIENT if the RECIPIENT fails to satisfactorily comply with any term or condition of this Agreement. i)Monies withheld by ECOLOGY may be paid to the RECIPIENT when the work described herein, or a portion thereof, has been completed if, at ECOLOGY's sole discretion, such payment is reasonable and approved according to this Agreement, as appropriate, or upon completion of an audit as specified herein. j)RECIPIENT must submit within thirty (30) days after the expiration date of this Agreement, all financial, performance, and other reports required by this agreement. Failure to comply may result in delayed reimbursement. 7.COMPLIANCE WITH ALL LAWS RECIPIENT agrees to comply fully with all applicable federal, state and local laws, orders, regulations, and permits related to this Agreement, including but not limited to: a)RECIPIENT agrees to comply with all applicable laws, regulations, and policies of the United States and the State of Washington which affect wages and job safety. b)RECIPIENT agrees to be bound by all applicable federal and state laws, regulations, and policies against discrimination. c)RECIPIENT certifies full compliance with all applicable state industrial insurance requirements. d)RECIPIENT agrees to secure and provide assurance to ECOLOGY that all the necessary approvals and permits required by authorities having jurisdiction over the project are obtained. RECIPIENT must include time in their project timeline for the permit and approval processes. Version 10/30/2015 AGENDA ITEM #3. a) Page 32 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton ECOLOGY shall have the right to immediately terminate for cause this Agreement as provided herein if the RECIPIENT fails to comply with above requirements. If any provision of this Agreement violates any statute or rule of law of the state of Washington, it is considered modified to conform to that statute or rule of law. 8.CONFLICT OF INTEREST RECIPIENT and ECOLOGY agree that any officer, member, agent, or employee, who exercises any function or responsibility in the review, approval, or carrying out of this Agreement, shall not have any personal or financial interest, direct or indirect, nor affect the interest of any corporation, partnership, or association in which he/she is a part, in this Agreement or the proceeds thereof. 9.CONTRACTING FOR GOODS AND SERVICES RECIPIENT may contract to buy goods or services related to its performance under this Agreement. RECIPIENT shall award all contracts for construction, purchase of goods, equipment, services, and professional architectural and engineering services through a competitive process, if required by State law. RECIPIENT is required to follow procurement procedures that ensure legal, fair, and open competition. RECIPIENT must have a standard procurement process or follow current state procurement procedures. RECIPIENT may be required to provide written certification that they have followed their standard procurement procedures and applicable state law in awarding contracts under this Agreement. ECOLOGY reserves the right to inspect and request copies of all procurement documentation, and review procurement practices related to this Agreement. Any costs incurred as a result of procurement practices not in compliance with state procurement law or the RECIPIENT's normal procedures may be disallowed at ECOLOGY’s sole discretion. 10.DISPUTES When there is a dispute with regard to the extent and character of the work, or any other matter related to this Agreement the determination of ECOLOGY will govern, although the RECIPIENT shall have the right to appeal decisions as provided for below: a)RECIPIENT notifies the funding program of an appeal request. b)Appeal request must be in writing and state the disputed issue(s). c)RECIPIENT has the opportunity to be heard and offer evidence in support of its appeal. d)ECOLOGY reviews the RECIPIENT’s appeal. e)ECOLOGY sends a written answer within ten (10) business days, unless more time is needed, after concluding the review. The decision of ECOLOGY from an appeal will be final and conclusive, unless within thirty (30) days from the date of such decision, the RECIPIENT furnishes to the Director of ECOLOGY a written appeal. The decision of the Director or duly authorized representative will be final and conclusive. The parties agree that this dispute process will precede any action in a judicial or quasi-judicial tribunal. Appeals of the Director's decision will be brought in the Superior Court of Thurston County. Review of the Director’s decision will not be taken to Environmental and Land Use Hearings Office. Pending final decision of a dispute, the RECIPIENT agrees to proceed diligently with the performance of this Agreement and in accordance with the decision rendered. Nothing in this Agreement will be construed to limit the parties’ choice of another mutually acceptable method, in addition to the dispute resolution procedure outlined above. 11.ENVIRONMENTAL DATA STANDARDS a)RECIPIENT shall prepare a Quality Assurance Project Plan (QAPP) for a project that collects or uses environmental measurement data. RECIPIENTS unsure about whether a QAPP is required for their project shall contact Version 10/30/2015 AGENDA ITEM #3. a) Page 33 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton the ECOLOGY Program issuing the grant or loan. If a QAPP is required, the RECIPIENT shall: •Use ECOLOGY’s QAPP Template/Checklist provided by the ECOLOGY, unless ECOLOGY Quality Assurance (QA) officer or the Program QA coordinator instructs otherwise. •Follow ECOLOGY’s Guidelines for Preparing Quality Assurance Project Plans for Environmental Studies, July 2004 (Ecology Publication No. 04-03-030). •Submit the QAPP to ECOLOGY for review and approval before the start of the work. b)RECIPIENT shall submit environmental data that was collected on a project to ECOLOGY using the Environmental Information Management system (EIM), unless the ECOLOGY Program instructs otherwise. The RECIPIENT must confirm with ECOLOGY that complete and correct data was successfully loaded into EIM, find instructions at: http://www.ecy.wa.gov/eim. c)RECIPIENT shall follow ECOLOGY’s data standards when Geographic Information System (GIS) data is collected and processed. Guidelines for Creating and Accessing GIS Data are available at: https://ecology.wa.gov/Research-Data/Data-resources/Geographic-Information-Systems-GIS/Standards. RECIPIENT, when requested by ECOLOGY, shall provide copies to ECOLOGY of all final GIS data layers, imagery, related tables, raw data collection files, map products, and all metadata and project documentation. 12.GOVERNING LAW This Agreement will be governed by the laws of the State of Washington, and the venue of any action brought hereunder will be in the Superior Court of Thurston County. 13.INDEMNIFICATION ECOLOGY will in no way be held responsible for payment of salaries, consultant's fees, and other costs related to the project described herein, except as provided in the Scope of Work. To the extent that the Constitution and laws of the State of Washington permit, each party will indemnify and hold the other harmless from and against any liability for any or all injuries to persons or property arising from the negligent act or omission of that party or that party's agents or employees arising out of this Agreement. 14.INDEPENDENT STATUS The employees, volunteers, or agents of each party who are engaged in the performance of this Agreement will continue to be employees, volunteers, or agents of that party and will not for any purpose be employees, volunteers, or agents of the other party. 15.KICKBACKS RECIPIENT is prohibited from inducing by any means any person employed or otherwise involved in this Agreement to give up any part of the compensation to which he/she is otherwise entitled to or receive any fee, commission, or gift in return for award of a subcontract hereunder. 16.MINORITY AND WOMEN’S BUSINESS ENTERPRISES (MWBE) RECIPIENT is encouraged to solicit and recruit, to the extent possible, certified minority-owned (MBE) and women-owned (WBE) businesses in purchases and contracts initiated under this Agreement. Contract awards or rejections cannot be made based on MWBE participation; however, the RECIPIENT is encouraged to take the following actions, when possible, in any procurement under this Agreement: a)Include qualified minority and women's businesses on solicitation lists whenever they are potential sources of goods or services. b)Divide the total requirements, when economically feasible, into smaller tasks or quantities, to permit maximum participation by qualified minority and women's businesses. c)Establish delivery schedules, where work requirements permit, which will encourage participation of qualified Version 10/30/2015 AGENDA ITEM #3. a) Page 34 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton minority and women's businesses. d)Use the services and assistance of the Washington State Office of Minority and Women's Business Enterprises (OMWBE) (866-208-1064) and the Office of Minority Business Enterprises of the U.S. Department of Commerce, as appropriate. 17.ORDER OF PRECEDENCE In the event of inconsistency in this Agreement, unless otherwise provided herein, the inconsistency shall be resolved by giving precedence in the following order: (a) applicable federal and state statutes and regulations; (b) The Agreement; (c) Scope of Work; (d) Special Terms and Conditions; (e) Any provisions or terms incorporated herein by reference, including the "Administrative Requirements for Recipients of Ecology Grants and Loans"; and (f) the General Terms and Conditions. 18.PRESENTATION AND PROMOTIONAL MATERIALS ECOLOGY reserves the right to approve RECIPIENT’s communication documents and materials related to the fulfillment of this Agreement: a)If requested, RECIPIENT shall provide a draft copy to ECOLOGY for review and approval ten (10) business days prior to production and distribution. b)RECIPIENT shall include time for ECOLOGY’s review and approval process in their project timeline. c)If requested, RECIPIENT shall provide ECOLOGY two (2) final copies and an electronic copy of any tangible products developed. Copies include any printed materials, and all tangible products developed such as brochures, manuals, pamphlets, videos, audio tapes, CDs, curriculum, posters, media announcements, or gadgets with a message, such as a refrigerator magnet, and any online communications, such as web pages, blogs, and twitter campaigns. If it is not practical to provide a copy, then the RECIPIENT shall provide a description (photographs, drawings, printouts, etc.) that best represents the item. Any communications intended for public distribution that uses ECOLOGY’s logo shall comply with ECOLOGY’s graphic requirements and any additional requirements specified in this Agreement. Before the use of ECOLOGY’s logo contact ECOLOGY for guidelines. RECIPIENT shall acknowledge in the communications that funding was provided by ECOLOGY. 19.PROGRESS REPORTING a)RECIPIENT must satisfactorily demonstrate the timely use of funds by submitting payment requests and progress reports to ECOLOGY. ECOLOGY reserves the right to amend or terminate this Agreement if the RECIPIENT does not document timely use of funds. b)RECIPIENT must submit a progress report with each payment request. Payment requests will not be processed without a progress report. ECOLOGY will define the elements and frequency of progress reports. c)RECIPIENT shall use ECOLOGY’s provided progress report format. d)Quarterly progress reports will cover the periods from January 1 through March 31, April 1 through June 30, July 1 through September 30, and October 1 through December 31. Reports shall be submitted within thirty (30) days after the end of the quarter being reported. e)RECIPIENT must submit within thirty (30) days of the expiration date of the project, unless an extension has been approved by ECOLOGY, all financial, performance, and other reports required by the agreement and funding program guidelines. RECIPIENT shall use the ECOLOGY provided closeout report format. 20.PROPERTY RIGHTS a)Copyrights and Patents. When the RECIPIENT creates any copyrightable materials or invents any patentable property under this Agreement, the RECIPIENT may copyright or patent the same but ECOLOGY retains a royalty free, nonexclusive, and irrevocable license to reproduce, publish, recover, or otherwise use the material(s) or property, and to Version 10/30/2015 AGENDA ITEM #3. a) Page 35 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton authorize others to use the same for federal, state, or local government purposes. b)Publications. When the RECIPIENT or persons employed by the RECIPIENT use or publish ECOLOGY information; present papers, lectures, or seminars involving information supplied by ECOLOGY; or use logos, reports, maps, or other data in printed reports, signs, brochures, pamphlets, etc., appropriate credit shall be given to ECOLOGY. c)Presentation and Promotional Materials. ECOLOGY shall have the right to use or reproduce any printed or graphic materials produced in fulfillment of this Agreement, in any manner ECOLOGY deems appropriate. ECOLOGY shall acknowledge the RECIPIENT as the sole copyright owner in every use or reproduction of the materials. d)Tangible Property Rights. ECOLOGY's current edition of "Administrative Requirements for Recipients of Ecology Grants and Loans," shall control the use and disposition of all real and personal property purchased wholly or in part with funds furnished by ECOLOGY in the absence of state and federal statutes, regulations, or policies to the contrary, or upon specific instructions with respect thereto in this Agreement. e)Personal Property Furnished by ECOLOGY. When ECOLOGY provides personal property directly to the RECIPIENT for use in performance of the project, it shall be returned to ECOLOGY prior to final payment by ECOLOGY. If said property is lost, stolen, or damaged while in the RECIPIENT's possession, then ECOLOGY shall be reimbursed in cash or by setoff by the RECIPIENT for the fair market value of such property. f)Acquisition Projects. The following provisions shall apply if the project covered by this Agreement includes funds for the acquisition of land or facilities: 1.RECIPIENT shall establish that the cost is fair value and reasonable prior to disbursement of funds provided for in this Agreement. 2.RECIPIENT shall provide satisfactory evidence of title or ability to acquire title for each parcel prior to disbursement of funds provided by this Agreement. Such evidence may include title insurance policies, Torrens certificates, or abstracts, and attorney's opinions establishing that the land is free from any impediment, lien, or claim which would impair the uses intended by this Agreement. g)Conversions. Regardless of the Agreement expiration date, the RECIPIENT shall not at any time convert any equipment, property, or facility acquired or developed under this Agreement to uses other than those for which assistance was originally approved without prior written approval of ECOLOGY. Such approval may be conditioned upon payment to ECOLOGY of that portion of the proceeds of the sale, lease, or other conversion or encumbrance which monies granted pursuant to this Agreement bear to the total acquisition, purchase, or construction costs of such property. 21.RECORDS, AUDITS, AND INSPECTIONS RECIPIENT shall maintain complete program and financial records relating to this Agreement, including any engineering documentation and field inspection reports of all construction work accomplished. All records shall: a)Be kept in a manner which provides an audit trail for all expenditures. b)Be kept in a common file to facilitate audits and inspections. c)Clearly indicate total receipts and expenditures related to this Agreement. d)Be open for audit or inspection by ECOLOGY, or by any duly authorized audit representative of the State of Washington, for a period of at least three (3) years after the final grant payment or loan repayment, or any dispute resolution hereunder. RECIPIENT shall provide clarification and make necessary adjustments if any audits or inspections identify discrepancies in the records. ECOLOGY reserves the right to audit, or have a designated third party audit, applicable records to ensure that the state has been properly invoiced. Any remedies and penalties allowed by law to recover monies determined owed will be enforced. Repetitive instances of incorrect invoicing or inadequate records may be considered cause for termination. All work performed under this Agreement and any property and equipment purchased shall be made available to ECOLOGY and to any authorized state, federal or local representative for inspection at any time during the course of Version 10/30/2015 AGENDA ITEM #3. a) Page 36 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton this Agreement and for at least three (3) years following grant or loan termination or dispute resolution hereunder. RECIPIENT shall provide right of access to ECOLOGY, or any other authorized representative, at all reasonable times, in order to monitor and evaluate performance, compliance, and any other conditions under this Agreement. 22.RECOVERY OF FUNDS The right of the RECIPIENT to retain monies received as reimbursement payments is contingent upon satisfactory performance of this Agreement and completion of the work described in the Scope of Work. All payments to the RECIPIENT are subject to approval and audit by ECOLOGY, and any unauthorized expenditure(s) or unallowable cost charged to this Agreement shall be refunded to ECOLOGY by the RECIPIENT. RECIPIENT shall refund to ECOLOGY the full amount of any erroneous payment or overpayment under this Agreement. RECIPIENT shall refund by check payable to ECOLOGY the amount of any such reduction of payments or repayments within thirty (30) days of a written notice. Interest will accrue at the rate of twelve percent (12%) per year from the time ECOLOGY demands repayment of funds. Any property acquired under this Agreement, at the option of ECOLOGY, may become ECOLOGY's property and the RECIPIENT's liability to repay monies will be reduced by an amount reflecting the fair value of such property. 23.SEVERABILITY If any provision of this Agreement or any provision of any document incorporated by reference shall be held invalid, such invalidity shall not affect the other provisions of this Agreement which can be given effect without the invalid provision, and to this end the provisions of this Agreement are declared to be severable. 24.STATE ENVIRONMENTAL POLICY ACT (SEPA) RECIPIENT must demonstrate to ECOLOGY’s satisfaction that compliance with the requirements of the State Environmental Policy Act (Chapter 43.21C RCW and Chapter 197-11 WAC) have been or will be met. Any reimbursements are subject to this provision. 25.SUSPENSION When in the best interest of ECOLOGY, ECOLOGY may at any time, and without cause, suspend this Agreement or any portion thereof for a temporary period by written notice from ECOLOGY to the RECIPIENT. RECIPIENT shall resume performance on the next business day following the suspension period unless another day is specified by ECOLOGY. 26.SUSTAINABLE PRACTICES In order to sustain Washington’s natural resources and ecosystems, the RECIPIENT is fully encouraged to implement sustainable practices and to purchase environmentally preferable products under this Agreement. a)Sustainable practices may include such activities as: use of clean energy, use of double-sided printing, hosting low impact meetings, and setting up recycling and composting programs. b)Purchasing may include such items as: sustainably produced products and services, EPEAT registered computers and imaging equipment, independently certified green cleaning products, remanufactured toner cartridges, products with reduced packaging, office products that are refillable, rechargeable, and recyclable, and 100% post-consumer recycled paper. For more suggestions visit ECOLOGY’s web page: Green Purchasing, , https://ecology.wa.gov/Regulations-Permits/Guidance-technical-assistance/Sustainable-purchasing. 27.TERMINATION a)For Cause ECOLOGY may terminate for cause this Agreement with a seven (7) calendar days prior written notification to the Version 10/30/2015 AGENDA ITEM #3. a) Page 37 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT, at the sole discretion of ECOLOGY, for failing to perform an Agreement requirement or for a material breach of any term or condition. If this Agreement is so terminated, the parties shall be liable only for performance rendered or costs incurred in accordance with the terms of this Agreement prior to the effective date of termination. Failure to Commence Work. ECOLOGY reserves the right to terminate this Agreement if RECIPIENT fails to commence work on the project funded within four (4) months after the effective date of this Agreement, or by any date mutually agreed upon in writing for commencement of work, or the time period defined within the Scope of Work. Non-Performance. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance by the RECIPIENT of all of its obligations under this Agreement. In the event the RECIPIENT unjustifiably fails, in the opinion of ECOLOGY, to perform any obligation required of it by this Agreement, ECOLOGY may refuse to pay any further funds, terminate in whole or in part this Agreement, and exercise any other rights under this Agreement. Despite the above, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by ECOLOGY and the State of Washington because of any breach of this Agreement by the RECIPIENT. ECOLOGY may withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from the RECIPIENT is determined. b)For Convenience ECOLOGY may terminate for convenience this Agreement, in whole or in part, for any reason when it is the best interest of ECOLOGY, with a thirty (30) calendar days prior written notification to the RECIPIENT, except as noted below. If this Agreement is so terminated, the parties shall be liable only for performance rendered or costs incurred in accordance with the terms of this Agreement prior to the effective date of termination. Non-Allocation of Funds. ECOLOGY’s ability to make payments is contingent on availability of funding. In the event funding from state, federal or other sources is withdrawn, reduced, or limited in any way after the effective date and prior to the completion or expiration date of this Agreement, ECOLOGY, at its sole discretion, may elect to terminate the Agreement, in whole or part, or renegotiate the Agreement, subject to new funding limitations or conditions. ECOLOGY may also elect to suspend performance of the Agreement until ECOLOGY determines the funding insufficiency is resolved. ECOLOGY may exercise any of these options with no notification or restrictions, although ECOLOGY will make a reasonable attempt to provide notice. In the event of termination or suspension, ECOLOGY will reimburse eligible costs incurred by the recipient/contractor through the effective date of termination or suspension. Reimbursed costs must be agreed to by ECOLOGY and the recipient/contractor. In no event shall ECOLOGY’s reimbursement exceed ECOLOGY’s total responsibility under the agreement and any amendments. If payments have been discontinued by ECOLOGY due to unavailable funds, the RECIPIENT shall not be obligated to repay monies which had been paid to the RECIPIENT prior to such termination. RECIPIENT’s obligation to continue or complete the work described in this Agreement shall be contingent upon availability of funds by the RECIPIENT's governing body. c)By Mutual Agreement ECOLOGY and the RECIPIENT may terminate this Agreement, in whole or in part, at any time, by mutual written agreement. d)In Event of Termination All finished or unfinished documents, data studies, surveys, drawings, maps, models, photographs, reports or other materials prepared by the RECIPIENT under this Agreement, at the option of ECOLOGY, will become property of ECOLOGY and the RECIPIENT shall be entitled to receive just and equitable compensation for any satisfactory work Version 10/30/2015 AGENDA ITEM #3. a) Page 38 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton completed on such documents and other materials. Nothing contained herein shall preclude ECOLOGY from demanding repayment of all funds paid to the RECIPIENT in accordance with Recovery of Funds, identified herein. 28.THIRD PARTY BENEFICIARY RECIPIENT shall ensure that in all subcontracts entered into by the RECIPIENT pursuant to this Agreement, the state of Washington is named as an express third party beneficiary of such subcontracts with full rights as such. 29.WAIVER Waiver of a default or breach of any provision of this Agreement is not a waiver of any subsequent default or breach, and will not be construed as a modification of the terms of this Agreement unless stated as such in writing by the authorized representative of ECOLOGY. Version 10/30/2015 AGENDA ITEM #3. a) AGENDA ITEM #3. a)