Press Alt + R to read the document text or Alt + P to download or print.

No preview available

The URL can be used to link to this page

Home My WebLink AboutCouncil 04/14/2008 AGENDA RENTON CITY COUNCIL • REGULAR MEETING April 14, 2008 Monday, 7 p.m. • 1. CALL TO ORDER AND PLEDGE OF ALLEGIANCE 2. ROLL CALL 3. PROCLAMATIONS: a. National Crime Victims' Rights Week- April 13 to 19, 2008 b. Equal Pay Day - April 22, 2008 4. SPECIAL PRESENTATION: Washington State Department of Transportation HOT Lanes 5. ADMINISTRATIVE REPORT 6. AUDIENCE COMMENT (Speakers must sign up prior to the Council meeting. Each speaker is allowed five minutes. The comment period will be limited to one-half hour. The second audience comment period later on in the agenda is unlimited in duration.) When you are recognized by the Presiding Officer, please walk to the podium and state your name and city of residence for the record, SPELLING YOUR LAST NAME. 7. CONSENT AGENDA The following items are distributed to Councilmembers in advance for study and review, and the • recommended actions will be accepted in a single motion. Any item may be removed for further discussion if requested by a Councilmember. a. Approval of Council meeting minutes of 4/7/2008. Council concur. b. Mayor Law reappoints Larry Reymann and Troy Wigestrand to the Parks Commission, each for a four-year term expiring 6/1/2012. Council concur. c. City Clerk submits quarterly contract list for period of 1/1/2008 to 3/31/2008, and expiration report for contracts expiring between 4/1/2008 and 9/30/2008. Information. d. City Clerk recommends adoption of an ordinance finalizing the vacation of a portion of alley located south of S. Tobin St. between Burnett and Williams Avenues S., as all conditions of the vacation approval have been satisfied (VAC-04-004; petitioner Friedman Development, LLC). Council concur. (See 9.a. for ordinance.) e. Community and Economic Development Department recommends approval to rename 1,900 feet of roadway, between Lake Washington Blvd. N. and the Seahawks' Headquarters and Training Facility northern property line, to Seahawks Way. Refer to Transportation (Aviation) Committee; set public hearing on 5/5/2008. f. Development Services Division recommends acceptance of a deed of dedication for additional right-of-way at NE 4th St. to fulfill a requirement of the Ribera-Balko Short Plat (SHP-02-129). Council concur. g. Development Services recommends approval to release restrictive covenants placed by King County on older plats restricting lot size and width to standards different than current City zoning standards for the property. Refer to Planning and Development Committee. h. Transportation Systems Division requests approval of the Transit Now transit service direct financial partnership agreement with King County and the City of Kent to enhance bus service on Metro Route 153. City's 2008 cost share is $72,310. Refer to Transportation (Aviation) Committee. • i. Transportation Systems Division recommends approval of an amendment to CAG-07-068, memorandum of understanding with the City of Mercer Island, regarding interests related to the Renton Municipal Airport. Council concur. (See 9.a. for resolution.) (CONTINUED ON REVERSE SIDE) r j. Transportation Systems Division recommends approval of a letter of agreement with The Boeing Company in the amount of$300,000 regarding the Logan Ave. N. Bicycle Lane. Approval is also sought to amend the 2008 Budget by transferring $111,875 from the 303 to the 316 account • to increase funding for the project. Council concur. (See 9.b. for ordinance.) k. Utility Systems Division recommends approval of an agreement in the amount of$80,928 with HDR Engineering, Inc. for evaluation of an automatic meter reading system. Council concur. 1. Utility Systems Division requests approval of an agreement with Football Northwest, LLC that will reduce by $149,550 Renton's System Development Charge fee for the Seahawks' Headquarters and Training Facility site, transfer ownership of the constructed Gypsy Sub-Basin conveyance structures to the City, and establish easement and maintenance responsibilities. Council concur. m. Utility Systems Division recommends approval of Addendum No. 1 to CAG-07-065, contract with Whitworth Pest Solutions, Inc., for mosquito abatement services in the amount of $43,752.60. Council concur. n. Utility Systems Division recommends adoption of a resolution declaring an emergency related to repairing the damaged culvert crossing of Panther Creek and Carr Rd., thus permitting the hiring of contractors without the delay involved with the competitive bid process. Council concur. (See 9.b. for resolution.) 8. UNFINISHED BUSINESS Topics listed below were discussed in Council committees during the past week. Those topics marked with an asterisk (*) may include legislation. Committee reports on any topics may be held by the Chair if further review is necessary. a. Finance Committee: Vouchers; Lease Amendment with LSI Logic Corporation for 200 Mill Building 3rd Floor; Principal Financial and Administrative Analyst Position Overlap 9. RESOLUTIONS AND ORDINANCES • Resolutions: a. Amendment to memo of understanding with Mercer Island re: Airport (see 7.i.) b. Declaring an emergency for purposes of repairing the Panther Creek Culvert (see 7.n.) Ordinances for first reading: a. Vacation of portion of alley south of S. Tobin St. (see 7.d.) b. 2008 Budget amendment re: Logan Ave. N. Bicycle Lane (see 7.j.) Ordinances for second and final reading: a. 2008 Budget amendment re: Ripley Lane N. Storm System project (1st reading 4/7/2008) b. Commercial Office Residential zone amendments (1st reading 4/7/2008) 10. NEW BUSINESS (Includes Council Committee agenda topics; call 425-430-6512 for recorded information.) 11. AUDIENCE COMMENT 12. ADJOURNMENT COMMITTEE OF THE WHOLE AGENDA (Preceding Council Meeting) 11111 Council Conference Room 6 p.m. Emerging Issues in Community Services; Capital Projects Update I RENTON CITY COUNCIL Regular Meeting April 14, 2008 Council Chambers Monday, 7 p.m. MINUTES Renton City Hall CALL TO ORDER Mayor Denis Law called the meeting of the Renton City Council to order and led the Pledge of Allegiance to the flag. ROLL CALL OF MARCIE PALMER,Council President;DON PERSSON; KING PARKER; COUNCILMEMBERS TERRI BRIERE; RICH ZWICKER; GREG TAYLOR. MOVED BY TAYLOR, SECONDED BY ZWICKER, COUNCIL EXCUSE ABSENT COUNCILMEMBER RANDY CORMAN. CARRIED. CITY STAFF IN DENIS LAW,Mayor; JAY COVINGTON, Chief Administrative Officer; ATTENDANCE LAWRENCE J. WARREN, City Attorney; BONNIE WALTON, City Clerk; GREGG ZIMMERMAN, Public Works Administrator; PETER HAHN, Deputy Public Works Administrator-Transportation; ALEX PIETSCH, Community and Economic Development Administrator; TINA HARRIS, Domestic Violence Victim Advocate; PREETI SHRIDHAR, Communications Director; DEPUTY CHIEF ROBERT VAN HORNE,Fire Department; COMMANDER CHARLES KARLEWICZ, Police Department. PROCLAMATIONS A proclamation by Mayor Law was read declaring April 13 to 19, 2008, to be National Crime Victims Rights "National Crime Victims' Rights Week" in the City of Renton and encouraging Week- April 13 to 19, 2008 all citizens to join in this special observance, as Renton is joining forces with - victim service programs, criminal justice officials, and concerned citizens to raise awareness of victims'rights. MOVED BY BRIERE, SECONDED BY PALMER, COUNCIL CONCUR IN THE PROCLAMATION. CARRIED. Mary Ellen Stone, King County Sexual Assault Resource Center, and Domestic Violence Victim Advocate Harris accepted the proclamation with appreciation. Ms. Stone indicated that not only is it National Crime Victims' Rights Week, it is also Sexual Assault Awareness Month, and she noted that the City is helping to end the silence so victims will come forward and get the help they need. Ms. Harris thanked the City for its continued support of local, community-based programs and for the City's domestic violence victim advocacy program. Equal Pay Day-4/22/2008 A proclamation by Mayor Law was read declaring 4/22/2008 to be "Equal Pay Day" in the City of Renton and encouraging all citizens to join in recognizing the full value of women's skills and contributions to the labor force, and further encourage Renton businesses to carefully evaluate their practices to ensure equitable pay for all employees. MOVED BY BRIERE, SECONDED BY PERSSON, COUNCIL CONCUR IN THE PROCLAMATION. CARRIED. Irene Roberts, Renton Business and Professional Women, accepted the proclamation with appreciation. She extended an invitation to the organization's Pay Equity Gala Event on April 18. SPECIAL PRESENTATION Craig Stone,Urban Corridors Office Administrator for the Washington State WSDOT: SR-167 HOT Lanes Department of Transportation,presented a report on the SR-167 high occupancy Pilot Project toll (HOT) lanes pilot project. He explained that the operation of the high occupancy vehicle(HOV)lanes is not being changed; however, solo drivers will now have the opportunity to pay to use the HOV lanes. The four-year pilot project,which begins on April 26, encompasses a nine-mile section of SR-167 between Renton and Auburn. Variable tolls will be charged ranging from fifty• cents to nine dollars based upon traffic volumes. n � April 14,2008 Renton City Council Minutes Page 116 Mr. Stone described how the HOT lanes will work and how tolls will be collected via the electronic Good to Go!payment system, which is the same system used on the Tacoma Narrows Bridge. He responded to Council inquiries regarding enforcement, transponders, rates charged, access points, safety issues, and I-405/SR-167 interchange congestion. Mr. Stone summarized the HOT lanes public outreach activities, and indicated that WSDOT will continually assess the pilot project and provide annual reports to the State Legislature and the Transportation Commission. ADMINISTRATIVE Chief Administrative Officer Covington reviewed a written administrative REPORT report summarizing the City's recent progress towards goals and work programs adopted as part of its business plan for 2008 and beyond. Items noted included: * Puget Sound Energy will be investigating a suspected natural gas leak in the vicinity of the S. Grady Way/Talbot Rd. S. intersection on April 16. If a leak is located, some reduction of lane use may result as repairs commence. CONSENT AGENDA Items on the consent agenda are adopted by one motion which follows the listing. At the request of Councilmember Zwicker, item 7.k. was removed for separate consideration. Council Meeting Minutes of Approval of Council meeting minutes of 4/7/2008. Council concur. 4/7/2008 Appointment: Parks Mayor Law reappointed Larry Reymann and Troy Wigestrand to the Parks Commission Commission, each for a four-year term expiring 6/1/2012. Council concur. City Clerk: Quarterly Contract City Clerk submitted quarterly contract list for period of 1/1/2008 to 3/31/2008, List, 1/1/2008 to 3/31/2008 and expiration report for contracts expiring between 4/1/2008 and 9/30/2008. Information. Vacation: Alley, Burnett Ave S City Clerk recommended adoption of an ordinance finalizing the vacation of a & S 2nd St,Friedman portion of alley located south of S. Tobin St. between Burnett and Williams Development, VAC-04-004 Avenues S., as all conditions of the vacation approval have been satisfied (VAC-04-004;petitioner Friedman Development, LLC). Council concur. (See page 118 for ordinance.) Streets: Seahawks Way Community and Economic Development Department recommended approval to Naming rename 1,900 feet of roadway,between Lake Washington Blvd.N. and the Seahawks' Headquarters and Training Facility northern property line, to Seahawks Way. Refer to Transportation(Aviation) Committee; set public hearing on 5/5/2008. Development Services: Ribera- Development Services Division recommended acceptance of a deed of Balko Short Plat, ROW dedication for additional right-of-way at NE 4th St. to fulfill a requirement of Dedication,NE 4th St, SHP- the Ribera-Balko Short Plat (SHP-02-129). Council concur. 02-129 Development Services: Development Services Division recommended approval to release restrictive Release of Restrictive covenants placed by King County on older plats restricting lot size and width to Covenants Placed by King standards different than current City zoning standards for the property. Refer to County re Lot Size and Width Planning and Development Committee. Transportation: Metro Route Transportation Systems Division requested approval of the Transit Now transit 153 Bus Service, King County service direct financial partnership agreement with King County and the City of & Kent Kent to enhance bus service on Metro Route 153. City's total cost share is approximately $370,000. Refer to Transportation(Aviation) Committee. April 14, 2008 Renton City Council Minutes Page 117 CAG: 07-068, Airport Transportation Systems Division recommended approval of an amendment to Memorandum of CAG-07-068,memorandum of understanding with the City of Mercer Island, Understanding, Mercer Island regarding interests related to the Renton Municipal Airport. Council concur. (See page 118 for resolution.) Transportation: Logan Ave N Transportation Systems Division recommended approval of a letter of Bicycle Lane, Boeing, Budget agreement with The Boeing Company in the amount of$300,000 regarding the Amend Logan Ave. N. Bicycle Lane. Approval was also sought to amend the 2008 Budget by transferring$111,875 from the 303 to the 316 account to increase funding for the project. Council concur. (See page 118 for ordinance.) Utility: Ripley Lane N Storm Utility Systems Division requested approval of an agreement with Football System Improvement, Football Northwest, LLC,related to the Ripley Lane N. Storm System Improvement Northwest project, that will reduce by$149,550 Renton's System Development Charge fee for the Seahawks'Headquarters and Training Facility site, transfer ownership of the constructed Gypsy Sub-Basin conveyance structures to the City, and establish easement and maintenance responsibilities. Council concur. CAG: 07-065, Mosquito Utility Systems Division recommended approval of Addendum No. 1 to CAG- Abatement, Whitworth Pest 07-065, contract with Whitworth Pest Solutions, Inc., for mosquito abatement Solutions services in the amount of$43,752.60. Council concur. Utility: Panther Creek Culvert Utility Systems Division recommended adoption of a resolution declaring an Repair, Declaring an emergency related to repairing the damaged culvert crossing of Panther Creek Emergency and Carr Rd., thus permitting the hiring of contractors without the delay involved with the competitive bid process. Council concur. (See page 118 for resolution.) MOVED BY PALMER, SECONDED BY TAYLOR, COUNCIL APPROVE THE CONSENT AGENDA AS AMENDED TO REMOVE ITEM 7.k. FOR SEPARATE CONSIDERATION. CARRIED. Separate Consideration Utility Systems Division recommended approval of an agreement in the amount Item 7.k. of$80,928 with HDR Engineering, Inc. for evaluation of an automatic meter Utility: Automatic Meter reading system. Reading System Evaluation, MOVED BY ZWICKER, SECONDED BY PERSSON, COUNCIL REFER HDR Engineering CONSENT AGENDA ITEM 7.k. TO THE UTILITIES COMMITTEE. CARRIED. UNFINISHED BUSINESS Finance Committee Chair Persson presented a report recommending approval of Finance Committee Claim Vouchers 270646 - 271338 and three wire transfers totaling Finance: Vouchers $5,024,557.70; and approval of 141 Payroll Vouchers, one wire transfer, and 744 direct deposits totaling$2,500,272.17. MOVED BY PERSSON, SECONDED BY BRIERE, COUNCIL CONCUR IN THE COMMITTEE REPORT. CARRIED. Lease: LSI Logic Corporation, Finance Committee Chair Persson presented a report recommending 200 Mill Bldg (3rd Floor), concurrence in the staff recommendation to approve an amendment extending LAG-00-002 the lease(LAG-00-002)with LSI Logic Corporation (formerly known as Engenio Information Technologies,Inc.) for the third floor of the 200 Mill Building. The Committee further recommended that the Mayor and City Clerk be authorized to sign the amendment. MOVED BY PERSSON, SECONDED BY BRIERE, COUNCIL CONCUR IN THE COMMITTEE REPORT. CARRIED. April 14,2008 Renton City Council Minutes Page 118 Public Works: Principal Finance Committee Chair Persson presented a report regarding the request to Financial and Administrative overfill the Public Works Department's Principal Financial and Administrative Analyst Position Overlap Analyst position. The Committee recommended concurrence in the staff recommendation to overfill the position for 30 days prior to the accepted resignation of the current staff member for effective training purposes, which would allow a projected hiring date of 5/15/2008. MOVED BY PERSSON, SECONDED BY BRIERE, COUNCIL CONCUR IN THE COMMITTEE REPORT. CARRIED. RESOLUTIONS AND The following resolutions were presented for reading and adoption: ORDINANCES Resolution #3941 A resolution was read authorizing the Mayor and City Clerk to execute the first CAG: 07-068, Airport amendment to the memorandum of understanding regarding airport issues Memorandum of between the City of Renton and the City of Mercer Island. MOVED BY Understanding, Mercer Island PERSSON, SECONDED BY ZWICKER, COUNCIL ADOPT THE RESOLUTION AS READ. CARRIED. Resolution #3942 A resolution was read declaring an emergency for the purposes of repairing the Utility: Panther Creek Culvert culvert at the crossing of Panther Creek at Carr Rd. MOVED BY ZWICKER, Repair, Declaring an SECONDED BY TAYLOR, COUNCIL ADOPT THE RESOLUTION AS Emergency READ. CARRIED. The following ordinances were presented for first reading and referred to the Council meeting of 4/21/2008 for second and final reading: Vacation: Alley, Burnett Ave S An ordinance was read vacating a portion of alley right-of-way located south of & S 2nd St, Friedman S. Tobin St.,between Burnett Ave. S. and Williams Ave. S. (Friedman Development, VAC-04-004 Development,LLC; VAC-04-004). MOVED BY PARKER, SECONDED BY ZWICKER, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING ON 4/21/2008. CARRIED. Transportation: Logan Ave N An ordinance was read amending the 2008 Budget to transfer from Fund 303 to Bicycle Lane, Boeing, Budget Fund 316 for the Cedar River Trail Extension Project (Logan Ave. N. Bicycle Amend Lane) expenses, and appropriating revenues in Fund 316 and authorizing expenses in that fund in the net amount of$111,875. MOVED BY PERSSON, SECONDED BY BRIERE, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING ON 4/21/2008. CARRIED. The following ordinances were presented for second and final reading and adoption: Ordinance#5368 An ordinance was read amending the 2008 Budget by increasing the funds in Utility: Ripley Lane N Storm the surface water revenue account and expenditure account in the amount of System Improvement, $678,223 pursuant to the state participating agreement with the Washington WSDOT Grant, Budget State Department of Transportation for the Ripley Lane N. Storm System Amend Improvement project. MOVED BY ZWICKER, SECONDED BY TAYLOR, COUNCIL ADOPT THE ORDINANCE AS READ. ROLL CALL: ALL AYES. CARRIED. Ordinance#5369 An ordinance was read amending Chapter 2,Zoning Districts -Uses and Planning: Development Standards, Chapter 3, Environmental Regulations and Overlay Districts, Regulations (Title IV) Docket, Chapter 4, Citywide Property Development Standards, Chapter 7, Subdivision COR Zone Regulations, Chapter 8, Permits - General and Appeals, and Chapter 9,Permits- Specific, of Title IV (Development Regulations) of City Code to amend the regulations regarding the Commercial Office Residential zone. MOVED BY PARKER, SECONDED BY ZWICKER, COUNCIL ADOPT THE ORDINANCE AS READ. ROLL CALL: ALL AYES. CARRIED. April 14, 2008 Renton City Council Minutes Page 119 ADJOURNMENT MOVED BY PERSSON, SECONDED BY PALMER, COUNCIL ADJOURN. CARRIED. Time: 7:58 p.m. Wa1 Bonnie I. Walton, CMC, City Clerk Recorder: Michele Neumann April 14, 2008 s. 1 RENTON CITY COUNCIL COMMITTEE MEETING CALENDAR Office of the City Clerk COUNCIL COMMITTEE MEETINGS SCHEDULED AT CITY COUNCIL MEETING April 14, 2008 COMMITTEE/CHAIRMAN DATE/TIME AGENDA COMMITTEE OF THE WHOLE MON., 4/21 Emerging Issues in Fire and Emergency (Palmer) 6 p.m. Services; Sound Shake Report *Council Conference Room* COMMUNITY SERVICES MON., 4/21 Ed Prince Appointment to Planning (Briere) 5 p.m. Commission; 2008 Neighborhood Grants (1st Round) FINANCE MON., 4/21 Public Education Governmental Fees (Persson) 3:30 p.m. (briefing only); Gambling Tax PLANNING & DEVELOPMENT THURS., 4/17 Release of Restrictive Covenants Placed (Parker) 3 p.m. by King County for 6,000 Square Foot Lots; City Code Title IV (Development Regulations) Docket PUBLIC SAFETY MON., 4/21 International Fire Code Adoption; (Taylor) 4 p.m. Valley Communications Interlocal Agreement Amendment TRANSPORTATION (AVIATION) (Corman) UTILITIES THURS., 4/17 Clean Sweep Program in Benson Hill (Zwicker) 2 p.m. Communities Annexation Area (briefing only); Solid Waste Pilot Program (briefing only); Contract with HDR Engineering for Automatic Meter Reading System Evaluation NOTE: Committee of the Whole meetings are held in the Council Chambers unless otherwise noted. All other committee meetings are held in the Council Conference Room unless otherwise noted. 4 (� . _ t - F EN z-='ate° N ti�{ 5.'ul�. F ",I SF+ R n - Denis Law, Mayor P r W hev'ecw, 23 million Americans are victims of crime each year and, of those, 5.2 million are victims of violent crime; and W herea4; a just society acknowledges crime's impact on individuals, families, and communities by ensuring that resources and services are available to help rebuild lives; and W he recd; victims' rights are a critical component of the promise of"justice for all," the foundation of our system of justice in America; and W here , although our nation has steadily expanded rights, protections, and services for victims of crime, too many are still not able to realize the hope and promise of these gains; and Whevecw, we must do better to ensure services are available to underserved segments of our population, including crime victims with disabilities, victims with mental illness, victims who are teenagers, victims who are elderly, victims in rural areas, and victims in communities of color; and W he re.xi observing victims' rights and treating victims with dignity and respect serves the public interest by engaging victims in the justice system, inspiring respect for public authorities, and promoting confidence in public safety; and Whe-v'ect�, the City of Renton is joining forces with victim service programs, criminal justice officials, and concerned citizens throughout the Renton community and America to raise awareness of victims' rights and observe the 28th National Crime Victims' Rights Week; Now, Therefore/, I, Denis Law, Mayor of the City of Renton, do hereby proclaim April 13-19, 2008, to be N am' C ri V&ct-m' Wei in the City of Renton, and I encourage all citizens to join me in this special observance. In witness whereof, I have hereunto set my hand and caused the seal of the City of Renton to be affixed this 14th day of April, 2008. AV Denis Law Mayor of the City of Renton, Washington 1055 South Grady Way-Renton,Washington 98057-(425)430-65o ;,i 1'1 b)430-6523 A ~ irecycled -I-, CI-JR l Ths-Jape n• 5Pi• matercarsL t3 �_- �'- �' CITY iD�� Fi.' u�� R1-4, d k� NI t 4 P'"��"i F.�Y_I' �r 4 \'''';J\7 \/,- ," Denis Law, Mayor .. j, P r Wherect4; forty years after the passage of the Equal Pay Act and Title VII of the Civil Rights Act, women and people of color continue to suffer the consequences of inequitable pay differentials; and Whereat; according to the U.S. Department of Labor statistics, women earn less in every occupational classification for which enough data is available, including occupations dominated by women; and W herea4, across the four-county region that includes King, Pierce, Snohomish, and Whatcom counties, women consistently make about three-quarters of what men earn; and W hereat, if women received the same salary as men who work the same number of hours, have the same education or union status, are the same ages, and live in the same region of the country, poverty rates would be cut in half; and Whe/ve.ao; fair pay both strengthens the security of families today and eases future retirement costs, • while enhancing the American economy; and Whore-at; Tuesday, April 22nd symbolizes the date in the next year at which the wages paid to American women catch up to the wages paid to men during the previous year; Now, thereyre; I, Denis Law, Mayor of the City of Renton, do hereby proclaim April 22,2008 to be: EqbPc2tyt7cty in the City of Renton, and encourage all citizens to join me in recognizing the full value of women's skills and contributions to the labor force, and further encourage Renton businesses to carefully evaluate their practices to ensure equitable pay for all employees. In witness whereof, I have hereunto set my hand and caused the seal of the City of Renton to be affixed this 14th day of April, 2008. '` J jj� ik �sq _ ,) - _ 1 4 .J kg • • Denis Law — .5 - A f; Mayor of the City of Renton, Washington / ''tet<4 ;, « t. - � w ON 1055 South Grady Way-Renton,Washington 98057-(425)430-6500/FAX(425)430-6523 i ~ This paper contains 50%recycled material.30%post consumer 1 "s„:24ezeze ii,jaziettie_e:71.". 47200 7 SR 167 High Occupancy Toll (HOT) Where are other HOT lanes nationally? Lanes Pilot Project = `` " ; ';S7, f,.,*,,-,,,,,,,,, :-..4e.`."s`.,':9'',', . .',,;. Paula J.Hammond,P.E. David L.Dye Steve Reinmutb b; ,"•"' ; r, ra = -! - :�:4's ;., Secreta Deputy Secretary Chief of Staff �-"�',1',:.'- '�<%'"' • � •» :„t:,-4.-4,:-;-''.. •'`�. fad.;',..-.,,•• . %k.';: ''. �,��o�arac `,,; • Craig J.Stone,P.E. 1;q-,'.''''`'•''''''- 7 rAdministrator ',k'',. ••t .y •••a� . Urban Comdors Office <!' y � ✓"` Renton City Council iamb 15 b,� ,r ✓'w" BE April 14,2008 uac.:a..a xvrirs,.,,.r,ma, WiDepaPttmeetn Transportation 1 «,•.100. Ta""o-...., How HOT lanes work Key features ,, r Renton ,.e- ` • Free flow operations goal for HOT lanes:at -- least 45 mph-90%of the time during peak —•—fes f period. 44 ,..t ?(,. a • More than nine miles of HOT lanes. t'. t` _' ` • 10 access points. p 4. '•.y;',,•,' • HOV 2+and motorcycles free. '< FG . .^ „* • $- `; . >. ... • Operating during the day(typically tolled 41- kens " ' - between 5 am and 7 pm),open to all traffic =— ;1 i) --- ', 1 at night. N • Variable tolls between 50¢and$9. Take a virtual drive in the HOT lane with Rachel —1:"7"/11 • Revenue will be used to pay for operations and maintenance,increased enforcement, and added incident response. "i'! "'CD Auburn ----T11--- ..._- ., N 3 4 Access points Electronic tolling and interoperability •Access points -defined locations for entering and exiting the HOT Lane. • The same Good to Go!payment system Minimum 1,500 feet(114 mile) wit be used on the SR 167 HOT Lanes . Most at more than 2,000 feet(1!3 mile) 7xor . ,,. Pilot Project as on the Tacoma Narrows ", :�� y Bridge. ,:: Project assessment WSDOT will report to the Legislature and the Transportation For more information Commission annually,on such items as: a. Freeway efficiency and safety; b. Effectiveness for transit; Craig J.Stone,P.E. Patty Rubstello,P.E. Administrator Tolling&Systems c. Person and vehicle movements by mode; Urban Corridors Office Development Engineer d. Ability to finance improvements and transportation services through 206-464-1222 205-464-1299 tolls; STONECrdwsdot.wa.gov RUBSTEPanwsdot.wa.00v e. The impacts on all highway users The department will analyze aggregate use data and conduct,as needed,surveys to assess usage of the facility with geographic,socioeconomic,and demographic information. 7Y Washalgtee State TI/Departmentof?raneponotton 13 14 3 J 1 2 3 4 ® Key features • Free flow operations goal for HOT lanes:at least 45 mph-90%of the time during peak period. • More than nine miles of HOT lanes. • 10 access points. • HOV 2+and motorcycles free. • Operating during the day(typically tolled between 5 am and 7 pm),open to all traffic at night. • Variable tolls between 500 and$9. • Revenue will be used to pay for operations and maintenance,increased enforcement,and added incident response. 5 6 a Electronic tolling and interoperability • The same Good to Go!payment system will be used on the SR 167 HOT Lanes Pilot Project as on the Tacoma Narrows Bridge. • Washington drivers have quickly embraced electronic tolling and signed up in record numbers—over 91,000 accounts and 220,000 transponders—the most successful launch in the country. • Over 9,000 of the accounts are in the SR 167 corridor=some 20,000 transponders. 7 a Two-phase opening 1. April 12—19 complete double-line striping that creates%mile access points from the HOT lanes into and out of general purpose lanes. 2. Saturday,April 26 opening of HOT lane system between 9:00 and 10:00 a.m.and the commencement of tolling for solo drivers. 8 M Opening week expectations April 26 — May 3 • New technology will need to be refined to meet our needs. • Complicated algorithms must be tweaked to find our"sweet spot." • We'll learn from each experience and make the system better. • There is a possibility the system will reach$9 or go to"HOV only"during peak commute times. • Confusion about crossing double white lines and when to start moving over to make your exit. • Important to remember this is a pilot project,designed to gain information and improve as we go. 9 ® Additional SR 167 work • Completion of the highway widening from Auburn to Puyallup. — one southbound lane from 277th St to 8th St E in Pierce County • Improvements to the 1-405/SR 167 interchange(one of the most congested in the state)including: — one lane in each direction to 1-405 between 1-5 and SR 169 — one southbound lane on SR 167 between 1-405 and SW 41st — Proposition One included freeway to freeway HOV ramps 10 El 11 El Summary of public outreach activities • Design and construction - Public open houses held in 2005 and 2006. - 6 focus groups-general public,low-income,small business. - Project survey of SR 167 drivers. - Presenting project information to local commute trip reduction program meetings. - Outreach to local elected officials. - Ongoing responses to citizen correspondence. • Opening - Driver education campaign to inform drivers about the new rules of the road when HOT lanes open. - Good to Go! mobile customer service centers at locations along SR 167. 1 ti`SY O� ADMINISTRATIVE, JUDICIAL, AND Cf ® , LEGAL SERVICES DEPARTMENT NTO� MEMORANDUM DATE: April 14, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council FROM: Denis Law, Mayor Jay Covington, Chief Administrative Officer SUBJECT: Administrative Report In addition to our day-to-day activities, the following items are worthy of note for this week: • Puget Sound Energy will be investigating a suspected natural gas leak in the vicinity of the Grady Way/Talbot Road intersection beginning at 7 p.m. on Wednesday, April 16. The City will have an inspector on hand to monitor the investigation. If a leak is located, some reduction of lane use may result as repairs commence. • Improvements to Burnett Linear Park, between South 6th Street and South 7th Street, will commence this month as part of the Burnett Park Phase II Capital Improvement Project. Improvements include a widened and relocated walkway, a new seating area with relocated artwork, entrysignage, new irrigation,na e g g , gat on, and landscaping. The project will include the removal ofix s large London plane trees, three pear trees, and one ponderosa pine. The 30-year-old London plane trees were planted too closely together and too close to the walkway, causing I the existing walkway to heave. The remaining trees to be removed would have interfered with a relocated and widened walkway. Five new trees will be planted in more appropriate large open areas. Construction is expected to begin in mid-April and continue through mid- July 2008. • Come celebrate spring in downtown Renton on Saturday, April 19, from noon to 5 p.m. at the Piazza on the corner of South 3rd Street and Burnett Avenue South. The 6th Annual Piazza Renton Spring Festival will be a lively event that includes live music, children's activities, food, Farmers Market vendors, and arts and crafts. You can also try your luck in the 3rd Annual Downtown Renton Poker Run from noon to 4 p.m. (starting at the Piazza) and enjoy art at the open-air Arts Unlimited Gallery in the park across Logan Avenue South. These events will be fun for the whole family. Questions? Please contact Jennifer Davis-Hayes at 425-430-6589. CITY OF RENTON COUNCIL AGENDA BILL AI/4 a / , ID , Wbmitting Data: For Agenda of: April 14, 2008 u Dept/Div/Board.. AJLS Department Staff Contact Denis Law, Mayor Agenda Status Consent X Subject: Public Hearing.. Reappointments to Parks Commission: Correspondence.. Larry Reymann Ordinance Troy Wigestrand Resolution Old Business Exhibits: New Business N/A Study Sessions Information Recommended Action: Approvals: Council Concur Legal Dept Finance Dept Other Fiscal Impact: Expenditure Required... Transfer/Amendment illoAmount Budgeted Revenue Generated Total Project Budget City Share Total Project SUMMARY OF ACTION: Mayor Law reappoints the following to the Parks Commission: Larry Reymann, 1313 N. 38th St, Renton, 98056 for a term that expires on 6/1/12. Troy Wigestrand, 2102 Queen Ave NE, Renton, 98056 for a term that expires on 6/1/12. STAFF RECOMMENDATION: Concur in Mayor Law's reappointments of Larry Reymann and Troy Wigestrand to the Parks Commission. 0 CITY OF RENTON COUNCIL AGENDA BILL AI#: / , (,! Submitting Data: For Agenda of: 4/14/2008 Dept/Div/Board.. AJLS/City Clerk Staff Contact Bonnie Walton, x6502 Agenda Status Consent X Subject: Public Hearing Correspondence City of Renton Contract Lists: Ordinance 1st Quarter 2008 Report ' Resolution Six-month Expiration Report Oleee Busw Business Exhibits: Study Sessions List of contracts fully executed from January 1, 2008 Information X through March 31, 2008; List of contracts expiring between April 1, 2008 and September 30, 2008 Recommended Action: Approvals: Legal Dept None; Information only Finance Dept Other • Fiscal Impact: N/A Expenditure Required... Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project.. SUMMARY OF ACTION: The quarterly contract report shows 49 agreements fully executed during the 151 quarter of 2008. The six-month expiration report shows 40 agreements expiring between April 1, 2008 and September 30, 2008. Source: Contract Management Module in the EDEN financial software system. 1111 Contracexpiring Between 04/01/2008 and 09/30/2( 4/3/40 OriginalCurrent CONTRACT Addendum Number Number Fully Executed Contractor Division Expiration AmountnAmount Amount unt Class CAG-07-163 Adden#1-07 08/28/2007 URS Corporation-2008 Runway Paving PBPW 04/01/2008 $149,646 $226,596 P Project CAG-00-045 Adden#4-07 08/05/2002 1256-WA ST DOT WA Transportation-Grant funding for TIP#10 PBPW 04/19/2008 $1,090,000 $1,106,772 R -SR 167;SW 27th St/Strander Blvd projects (contract was never executed) CAG-06-084 05/15/2006 Lease/Concession Agreement to CS 04/30/2008 $0 P manage/operate food&beverage concession at Liberty Park, grandstand CAG-07-033 Adden#1-07 03/21/2007 046043-MACLEOD RECKORD MacLeod Reckord-perform trail and bikeway PBPW 04/30/2008 $158,131 $158,131 P planning and design,transportation planning, signage design guidelines, and stakeholder and agency coordination assistance to the City of Renton CAG-07-036 Adden#1-07 03/26/2007 030110-GOLDER ASSOCIATES Golder Associates, Inc.to complete fisheries PBPW 04/30/2008 $109,074 $109,074 P INC monitoring activities on Section 205 of the Cedar River CAG-07-047 04/05/2007 009510-BHC CONSULTANTS BHC Consultants, LLC to remedy an existing PBPW 04/30/2008 $49,996 $49,996 P LLC surface water problem located at 2302 Camas Ave, resulting from surface water runoff discharging via Dayton Ave NE, NE 22nd St and surrounding areas CAG-07-139 06/28/2007 Rural Metro Ambulance-Agreement for Private Fire 04/30/2008 $0 $0 M Ambulance Company transport within City of Renton for referral of calls for ambularnce services on a rotation list CAG-07-183 10/29/2007 086691 -WALDRON AND Waldron&Company - Agreement of services AJLS 04/30/2008 $25,500 $25,500 P COMPANY for selection of Human Resource/Risk Management Administrator LAG-00-002 04/05/2000 2894-SYNTAX SYSTEMS Syntax Systems, Inc. (Engenio Information CS 04/30/2008 $0 $0 R Technolgies)-Lease of 3rd floor of 200 Mill Bldg. \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cm BrianHildermanO.rpt Page 1 of 5 Original Current CONTRACT Addendum Contract Contract Number Number Fully Executed Contractor Division Expiration Amount Amount Class CAG-07-134 10/18/2007 082396-TRANSTECH ELECTRIC Transtech Electric, Inc.-Signal Improvements PBPW 05/30/2008 $289,295 $289,295 P INC at Hoquiam Av NE and NE 4th St CAG-06-130 Adden#3-07 07/12/2006 060277-PARAMETRIX INC PARAMETRIX, INC.-Airport Seaplane Base PBPW 05/31/2008 $139,500 $238,300 P Dredging&Shoreline Mitigation Project CAG-06-132 07/14/2006 021968-DOUGLAS H Economic Research Services for the Finance FIS 05/31/2008 $24,000 $24,000 p PEDERSEN,&ASSOCIATES Department CAG-07-026 Adden#2-07 03/07/2007 046043-MACLEOD RECKORD MacLeod Reckord Landscape Architects for CS 05/31/2008 $17,080 $17,080 p the purpose of providing engineering services for the design and layout of the new pedestrian walkway, irrigation and landscape design for Burnett Linear Park between 6th St S and 7th St S CAG-07-110 08/09/2007 Cities of Auburn, Des Moines, Federal Way, Police 05/31/2008 $0 $0 M Kent,Tukwila,and Port of Seattle-Creation of Valley Special Response Team (VSRT) CAG-07-037 Adden#1-07 03/21/2007 104147-ALLIANCEONE AllianceOne Receivables Management, Inc.to FIS 06/13/2008 $0 $0 M RECEIVABLES, DANIEL provide collection services for the Finance Department in accordance with the State of Washington Collection Services Contract #06204 CAG-07-114 06/13/2007 400005-WASHINGTON SCHOOL Washington School Information Processing FIS 06/13/2008 $0 $0 M INFO Cooperative-Joint Purchasing Agreement CAG-03-167 Adden#1-07 11/03/2003 091526-WESTON SOLUTIONS Weston Solutions, Inc.-Prepare RFP for FIS 06/30/2008 $49,250 $199,250 P INC maintenance mgmt.system CAG-05-066 Adden#9-08 04/29/2005 038758-J A BRENNAN Planning and Design Services for Heather CS 06/30/2008 $167,148 $205,044 p ASSOCIATES PLLC Downs Park Development CAG-06-182 Adden#1-08 10/30/2006 060277-PARAMETRIX INC 2007 Bridge Inspections PBPW 06/30/2008 $26,029 $26,029 P \\central\sys2S\informgold\reports\sitespec\renton\reports\cmBrianHilderman0.r• Page 2 of 5 III , CONTRACT ndum gn Number ber Fully Executed Contractor III Amountótra ount Division Expiration ContrOriict Class • CAG-06-184 10/31/2006 068180-RH2 ENGINEERING INC Engineering Services during construction of PBPW 06/30/2008 $151,240 $151,240 P Emergency Power Generation 2006 project CAG-07-027 05/16/2007 068487-R L ALIA COMPANY SW 34th St Culvert Replacement Project PBPW 06/30/2008 $1,270,871 $1,270,871 p p S W P-27-3223 CAG-07-140 09/06/2007 014398-CECCANTI INC Ceccanti, Inc.-Water line relocation for PBPW 06/30/2008 $869,422 $869,422 p realignment of Benson Road and 1-405 overpass CAG-07-155 10/10/2007 018428-CORNERSTONE EARTH Cornerstone Earth Work, Inc.-Monroe Av NE PBPW 06/30/2008 $72,241 $72,241 p WORK INC Storm System Overflow Project CAG-07-192 Adden#1-07 11/12/2007 074075-SHEARER DESIGN LLC Shearer Design, LLC-May Creek Bridge PBPW 06/30/2008 $9,568 $9,568 P Evaluation CAG-08-024 03/04/2008 2899-WA DEPT OF TRADE Al WA Dept of Community,Trade and Economic EDNSP 06/30/2008 $10,000 $10,000 R Development(WA CTED)-Grant for holding special meeting in Benson Hill area CAG-08-036 03/28/2008 Heery International-Architectural&Space CS 06/30/2008 $224,000 $224,000 P Planning Services CAG-06-188 11/14/2006 Special Inspection&Materials Testing PBPW 07/01/2008 $9,962 $9,962 P Services for the 2006 Emergency Power Generation Project CAG-02-134 Adden#5-07 08/08/2002 042369-KING CNTY FINANCE King County Department of Transportation, PBPW 07/05/2008 $30,206 $209,862 P Road Services-USACE Cedar River Section 205 Flood Reduction Project; Landsburg Gravel Supplementation Mitigation Element CAG-07-165 08/29/2007 061760-MEDTRONIC Medtronic Emergency Response Systems, Inc. Fire 07/10/2008 $12,025 $12,025 P PHYSIO-CONTROL CORP - Defibillator Service&Maintenance Agreement \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cm BrianHildermanO.rpt Page 3 of 5 CONTRACT Addendum ContracCurrent Number Number Fully Executed Contractor Division Expiration Contractt Contract Amount Amount Class CAG-08-035 03/26/2008 042544-KLEINFELDER Kleinfelder-Geotechnical Engineering PBPW 07/13/2008 $35,752 $35,752 p Services-White Fence Ranch Sewer Extension Project CAG-07-202 01/23/2008 068828-WAGNER ARCHITECTS United Pacific Structures, Inc.- Activity CS 07/30/2008 $363,069 $363,069 p Buildings ADA Upgrades-Philip Arnold Park and Kennydale Lions Park CAG-07-129 08/21/2007 041608-KING CNTY FINANCE KC Department of Transportation -Implement PBPW 07/31/2008 $38,060 $38,060 p City of Renton and State of WA Commute Trip Reduction(CTR)for 2007-2008. CAG-07-136 07/09/2007 008545-R W BECK INC R.W. Beck, Inc.-Consultant agreement for a PBPW 07/31/2008 $92,999 $92,999 P development of a water use efficiency plan CAG-07-172 09/17/2007 073289-SEATTLE TIMES Seattle Times-Recruitment Advertising HR 08/04/2008 $22,500 $22,500 P COMPANY CAG-05-151 09/08/2005 055411 -NEW WORLD SYSTEMS New World Systems Corp software Police 08/31/2008 $83,348 $83,348 P maintenance agreement or Police Department CAG-07-070 Adden#1-07 04/27/2007 042544-KLEINFELDER Engineering Annual Consultant Agreement for PBPW 08/31/2008 $31,419 $40,470 p Geotechnical Report for Earlington Lift Station Elimination CAG-07-188 01/11/2008 R.L.Alia Company- Fiber Optic Conduit PBPW 08/31/2008 $48,100 $48,100 p Connection-North CAG-07-189 03/20/2008 Evergreen Landscape&Construction, Inc.- CS 08/31/2008 $228,363 $228,363 p Burnett Linear Park, Phase II Landscape Renovation CAG-05-137 08/24/2005 Edward Byrne Memorial Justice Assistance Police 09/30/2008 $0 p Grant Project: Domestic Violence Advocacy Assistance Program($39,120) CAG-07-161 10/30/2007 069020-RODARTE Rodarte Construction, Inc-Construct Maple PBPW 09/30/2008 $5,039,197 $5,039,197 p CONSTRUCTION INC Valley Hy(SR 169)Improvements Phase II \\central\sys211kinformgold\reports\sitespec\renton\reports\cmBrianHildermanO.re Page 4 of 5 0 Original urrent CONTRACT ndum • Contract tract Number ber Fully Executed Contractor Division Expiration Amount Class • ount P = Payables $13,362,820 R= Receivables $4,437,088 Expiring Contracts This Period: 58 M = Misc $0 \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cmBrianHildermanO.rpt \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cmBrianHilderman0.rpt Page 5 of 5 Contracts Fully Executed Between 01/01/2008 and 03/31/2008 4/3/2008 Original Current CONTRACT Addendum Contract Number Number Fully Executed Contractor Description Division Expiration Contract Amount Amount Class CAG-03-094 Adden#2-08 01/31/2008 058400-OSBORN PACIFIC Osborn Pacific Group Inc.-Perform Wetland PBPW 12/31/2013 $109,657 $172,767 p GROUP INC Monitoring Svcs. CAG-05-046 Adden#4-08 01/09/2008 082992-TRUGREEN LANDCARE Flower Program-Hanging Basket Program CS 12/21/2007 $31,355 $47,372 P CAG-05-066 Adden#9-08 01/23/2008 038758-J A BRENNAN Planning and Design Services for Heather CS 06/30/2008 $167,148 $205,044 P ASSOCIATES PLLC Downs Park Development CAG-06-089 Adden#1-08 02/05/2008 064542-PSR Annual Maintenance HVAC system at CS 06/01/2007 $7,442 $7,442 p Maplewood Clubhouse CAG-06-069 Adden#1-08 03/11/2008 Sound Transit-Transit Improvement Project- PBPW 12/31/2050 $0 P Strander Blvd/SW 27th St Extension;West Valley Highway to Oakesdale Project; Rainier/Hardie Av Arterial Improvements Project CAG-06-182 Adden#1-08 02/02/2008 060277-PARAMETRIX INC 2007 Bridge Inspections PBPW 06/30/2008 $26,029 $26,029 p CAG-07-008 Adden#2-07 01/18/2008 020180-DAVID EVANS& Prepare and process WSDOT signal permit PBPW 01/31/2008 $7,100 $41,240 P ASSOCIATES INC application for Sunset/Hoquiam signalization \\central\sys2411"inform gold\reports\sitespec\renton\reports\cmBrianHilderman1.10 Page 1 of 7 III Original urrent CONTRACT illidum Description ContractEJ tract Number ber Fully Executed Contractor Division Expiration Amountoust Class CAG-07-044 Adden#1-08 03/10/2008 008785-CITY OF BELLEVUE Cities of Anacortes,Auburn, Bellevue, PBPW 12/31/2012 $8,333 $8,333 p Bellingham, Bothell, Bremerton, Buckley, Burlington, Camas, Des Moines, Ellensburg, Everett, Federal Way, Fircrest, Kennewick, Kent, Longview, Marysville, Mount Vernon, Normandy Park, Orting, Port Angeles, Pullman, Puyallup, Renton, Richland, Sammamish, Seatac, Sumner, University Place,Vancouver, and Kitsap County and any other Phase II Permittees(collectively referred to as the Coalition),to collectively pay for the legal services of Foster Pepper PLLC to represent the CoalitionOs interests in any legal challenges to the NPDES Phase II Municipal Stormwater permit CAG-07-059 Adden#1-08 03/21/2008 060277-PARAMETRIX INC Contract Agreement with Parametrix, Inc.to PBPW 11/07/2008 $183,316 $183,316 p perform transportation and storm system improvements along Ripley Lane North(Gypsy Creek flooding). CAG-07-102 Adden#2-08 01/14/2008 071779-SEA REACH LTD Develop a Downtown Wayfinding System that EDNSP 12/31/2007 $78,820 $78,820 P will improve the system of signage into and around downtown Renton CAG-07-162 Adden#1-08 01/23/2008 059358-PACIFIC ENGINEERING Pacific Engineering Design, LLC-Design of PBPW 12/31/2008 $152,057 $152,057 P DESIGN LLC 2007 Citywide Sidewalks and Curb Ramps project CAG-07-178 Adden#1-08 02/08/2008 089299-WA ST DEPT OF WA Transportation-Signal Modification at PBPW 12/31/2008 $25,000 $25,000 P TRANS, HWYS&LOCAL PROG SR900/I-405 on and off ramps at Harrington Av NE CAG-07-179 Adden#1-08 01/02/2008 049825-MIRIAM POLLACK& Miriam Pollack&Assoc-Development of the CS 12/31/2007 $117,210 $117,210 P ASSOCIATES Library Master Plan CAG-08-011 01/01/2008 Visiting Nurse Services- Assisting seniors in CS 12/31/2008 $12,400 $12,400 P health maintenance at Senior Activity Center \\central\sys2\apps\inform gold\reports\sitespec\renton\reports\cm BrianHilderman1.rpt Page 2 of 7 Original Current CONTRACT Addendum Description Contract Contract Number Number Fully Executed Contractor Division Expiration Amount Amount Class CAG-07-188 01/11/2008 R.L.Alia Company- Fiber Optic Conduit PBPW 08/31/2008 $48,100 $48,100 p Connection-North CAG-08-002 01/08/2008 012418-BNSF RAILWAY BNSF Railway Co.-Install new concrete PBPW 03/15/2008 $1,000,000 $1,000,000 P COMPANY crossing panels along Houser Way railroad tracks CAG-08-003 01/11/2008 069671 -ROTH HILL Roth Hill Engineering Partners, LLC.- PBPW 08/31/2009 $715,350 $715,350 P ENGINEERING PARTNERS, LLC Stonegate II-Alternatives Analysis; Lift Station and Conveyance Design CAG-08-004 01/10/2008 JMS, Inc.-Youth Sports Services, Inc.-Skiing CS 02/23/2008 $0 $0 R Instruction CAG-08-026 01/11/2008 400012-FARMERS MARKET Renton Piazza-Letter of agreement regarding EDNSP 12/31/2011 $0 $0 M Farmers'Market CAG-08-006 01/18/2008 029875-GLENN MACGILVRA Census Services-To conduct special census EDNSP 03/15/2008 $101,248 $101,248 P of Benson Hill Annexation Area CAG-08-007 01/18/2008 066950-RENTON CHAMBER OF, Renton Chamber of Commerce-To provide EDNSP 12/31/2008 $129,000 $129,000 P COMMERCE tourism marketing promotion efforts in 2008; funded by hotel/motel tax revenues CAG-08-008 01/18/2008 032460- Hamilton/Saunderson-2008 Marketing EDNSP 12/31/2008 $219,000 $219,000 p HAMILTON/SAUNDERSON INC Campaign CAG-08-009 01/17/2008 091535-W&H PACIFIC INC W&H Pacific-Benson Hill Annexation Zoning EDNSP 02/01/2008 $19,641 $19,641 p Parcel Decsriptions \\central\sys2\�informgold\reports\sitespec\renton\reports\cmBrianHildermanl.rS Page 3 of 7 III Original urrent CONTRACT ndum Description Contract tract Number ber Fully Executed Contractor Division Expiration Amount ount Class CAG-07-202 01/23/2008 068828-WAGNER ARCHITECTS United Pacific Structures, Inc.- Activity CS 07/30/2008 $363,069 $363,069 P Buildings ADA Upgrades-Philip Arnold Park and Kennydale Lions Park CAG-08-010 01/23/2008 400001 -FIRE DISTRICT#40 K.C. Fire Protection District#40-Interim AJLS 12/31/2008 $0 $0 M Operating Agreement for Fire and Emergency Medical Services CAG-07-157 01/31/2008 400013-KING CNTY FIRE DIST Interlocal/Zone 3- provide reciprocal services Fire 12/31/2008 $0 $0 M #39,TO PROCESS MISC for hazardous materials/technical rescue CONTRACTS response CAG-08-005 01/28/2008 2882-TRANSPORTATION, IMPROV Transportation Improvement Board-Accept PBPW 12/31/2009 $2,411,640 $2,411,640 R funding for Duval Ave NE-SR 900 to the northern City Limits(Construction Phase) CAG-08-018 01/31/2008 Renton History Museum-City Seal on Exhibit CS 12/31/2011 $0 $0 P CAG-08-014 02/05/2008 013783-CAROLLO ENGINEERS Carollo Engineers-Long-Range WW PBPW 12/31/2008 $33,829 $33,829 P PC Management Plan Update CAG-08-015 02/08/2008 2853-SPRING GLEN FIRE DISTRIC King County Fire Protection District#40 -Fire AJLS 12/31/2028 $3,433,000 $3,433,000 R and Emergency services and joint operation of facilities CAG-08-013 02/15/2008 041950-KING CNTY METRO King County Metro Transit Division-Flexpass PBPW 02/28/2009 $34,980 $34,980 P TRANSIT DIV purchase agreement CAG-08-025 02/15/2008 400011 -BURNETT LINEAR BOMA-Letter of Agreement regarding CS 12/31/2011 $0 $0 M LANDSCAPING,AGREEMENT landscaping requirements at Burnett Linear Park \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cm BrianHilderman1.rpt Page 4 of 7 Original Current CONTRACT Addendum Description Contract Contract Number Number Fully Executed Contractor Division Expiration AmountClass Amount CAG-08-016 02/22/2008 1067-KING CNTY King County- Interlocal agreement for land AJLS 12/31/2013 $1,700,000,000 $1,700,000,000 R transfer between KC&Renton re: local parks& greenbelt property CAG-08-019 02/18/2008 066450-REID INSTRUMENTS Reid Instruments-Consultant Agreement for PBPW 03/31/2009 $33,203 $33,203 p Hazen Reservoir Telemetry Upgrades, Installation and Programming CAG-08-020 02/18/2008 060869-PACE ENGINEERS INC PACE-Surveying the White Fence Ranch PBPW 03/31/2009 $48,000 $48,000 p Sewer Extension CAG-08-022 02/18/2008 Various Local Law Enforcement Agencies- Police 12/31/2013 $4,680 $4,680 P Participation in Regional Automated Information Network(RAIN) CAG-08-023 02/20/2008 063698-CLUB PROPHET Pro-Shopkeeper Computer Sofeware, Inc.- CS 03/15/2010 $2,396 $2,396 P SYSTEMS POS System necessary upgrade and maintenance CAG-08-027 02/22/2008 041609-KING CNTY DDES King County - Interlocal agreement for AJLS 03/01/2013 $0 $0 M permiting processing-Benson Hill Annexation CAG-08-028 02/22/2008 070327-SALVATION ARMY,THE Salvation Army-Agreement with the Salvation CS 12/31/2008 $18,500 $18,500 P Army Renton Corps for 2008 Renton Emergency Assistance Program(REAP) CAG-08-021 02/25/2008 025601 -F&AO USAED SEATTLE, U.S.Army Corps of Engineers(USAGE) - PBPW 12/31/2009 $95,650 $95,650 P DEPT OF ARMY Design Agreement/Program Management Plan with the Army Corps of Engineeer Design re: Upper Springbrook Creek Restoration Project ($50,000 from grant) CAG-08-024 03/04/2008 2899-WA DEPT OF TRADE AND EC WA Dept of Community,Trade and Economic EDNSP 06/30/2008 $10,000 $10,000 R Development(WA CTED)-Grant for holding special meeting in Benson Hill area \\central\sys2\ \informgold\reports\sitespec\renton\reports\cmBrianHildermanl.l) Page 5 of 7 III . • Original urrent CONTRACT ndum Con Number ber Fully Executed Contractor Description tract Division Expiration Amountount Class ` CAG-08-029 03/14/2008 060277-PARAMETRIX INC Parametrix, Inc.-Consultant agreement to EDNSP 04/20/2010 $199,890 $199,890 P help develop the Shoreline Master Program update CAG-08-030 03/14/2008 025754-FDM SOFTWARE LTD FDM Software, Ltd-Software support and Fire 12/31/2008 $24,341 $24,341 p maintenance agreement for Fire Dept records management system. CAG-07-189 03/20/2008 Evergreen Landscape&Construction, Inc.- CS 08/31/2008 $228,363 $228,363 P Burnett Linear Park, Phase II Landscape Renovation CAG-08-031 03/18/2008 Worthy&Associates-Urban&Community CS 12/31/2008 $119,654 $119,654 P Forestry Development Plan CAG-08-032 03/21/2008 068180-RH2 ENGINEERING INC RH2 Engineering-Denny's Lift Station PBPW 10/31/2009 $124,306 $124,306 P Replacement Project CAG-08-012 03/28/2008 074570-SHORELINE Shoreline Construction, Co. -2008 Sanitary PBPW 12/31/2008 $619,309 $619,309 P CONSTRUCTION CO Sewer Repairs project CAG-08-035 03/26/2008 042544-KLEINFELDER Kleinfelder-Geotechnical Engineering PBPW 07/13/2008 $35,752 $35,752 P Services-White Fence Ranch Sewer Extension Project CAG-08-036 03/28/2008 Heery International-Architectural&Space CS 06/30/2008 $224,000 $224,000 P Planning Services • \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cmBrianHilderm an 1.rpt Page 6 of 7 Original Current CONTRACT Addendum Description Contract Contract Number Number Fully Executed Contractor Division Expiration AmountClass Amount P = Payables $5,519,290 R = Receivables $1,705,854,640 . Fully Executed Contracts This Period: 49 M = Misc $0 \\central\sys2\apps\informgold\reports\sitespec\renton\reports\cm Bria n Hi lderm a n l.rpt \\central\sys2\informgold\reports\sitespec\renton\reports\cmBrianHilderman1.10 Page 7 of 7 II) p CITY OF RENTON COUNCIL AGENDA BILL AI #: '7 fir P :Submitting Data: For Agenda of: 4/14/2008 Dept/Div/Board.. AJLS/City Clerk Staff Contact Bonnie Walton, x6502 Agenda Status Consent X Subject: Public Hearing... Street Vacation Petition for a portion of alley located south of Correspondence.. S. Tobin St. between Burnett and Williams Avenues S. Ordinance X Petitioner: Friedman Development, LLC Resolution File No. VAC-04-004 Old Business Exhibits: New Business Minutes of 10/25/2004 &4/11/2005 Study Sessions Ordinance Information Recommended Action: Approvals: Council concur Legal Dept X Finance Dept Other Fiscal Impact: Expenditure Required... N/A Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project.. SUMMARY OF REQUEST: At the regular Council meeting of October 25, 2004, the City Council held a public hearing to consider a vacation request, submitted by Friedman Development, LLC, for a portion of alley right-of-way located south of S. Tobin St., between Burnett and Williams Avenues S. The alley is ten feet in width and approximately 50 feet in length of portion running north & south, and 115 feet in length for portion running east and west. The vacation was approved subject to five conditions. On April 11, 2005, Council adopted the recommendation of the Planning and Development Committee to accept compensation at $25,500 for the alley vacation and accept the 20-foot right- of-way dedication in lieu of a part of the cash compensation that would be paid for the alley vacation. Since City Code calls for the difference between the appraised values of$25,500 to be paid to the petitioner, the monies due between the City and petitioner were zero. No other amounts are due, and staff has verified that the conditions of the vacation approval have been satisfied. Therefore, the ordinance can be adopted to finalize the vacation. STAFF RECOMMENDATION: Finalize the street vacation by adopting the ordinance cc Karen McFarland Reference: 35.79 RCW&RMC 9-14 • i 1 April 11,2005 Renton City Council Minutes Page 127 important for the public to know that Council will consider everyone who applies. Mr. Clawson explained that as Renton grows, the number of applicants • may also grow, and it is difficult to conduct quality interviews with such a large number of people. He pointed out that if someone has the interest and the background to merit an interview, Council will take a good look at them whether they are known to the Council or not. Mr. Clawson concluded by expressing his support for the revised policy. Councilman Corman stated that if there were a vacancy on the Council, a person who is interested in the position can always address Council during the audience comment portion of the Council meeting. He noted that the policy change does not shut off the ability of citizens to express their interest to Council. Councilman Clawson added that interested citizens can also contact Council via mail, e-mail, and telephone. *MOTION CARRIED. Planning &Development Planning and Development Committee Chair Clawson presented a report Committee regarding compensation for the McLendon Hardware street vacation (VAC-04- Vacation: Alley,Burnett Ave 004), located east of Burnett Ave. S. and north of S. 2nd St. The Committee S & S 2nd St, McLendon recommended concurrence in the staff recommendation to accept the appraisal Hardware, VAC-04-004 for the portion of the City alley, accept the appraisal for the 20-foot right-of- way dedication, set compensation at$25,500 for the alley vacation, and accept the dedication in lieu of a part of the cash compensation that would be paid for the alley vacation. Since City Code calls for the difference between the appraised values of$25,500 to be paid to the petitioner, the monies due the City from the petitioner would be zero. Accordingly, the monies due the petitioner • from the City would also be zero. MOVED BY CLAWSON, SECONDED BY LAW, COUNCIL CONCUR IN THE COMMITTEE REPORT. CARRIED. Planning: Critical Areas Planning and Development Committee Chair Clawson presented a report Ordinance regarding the critical areas regulations. The Committee has studied the documents prepared by City staff and the consultants, including but not limited to, best available science reviews, proposed policy, map, and regulation amendments, and public comments and responses. The Committee concurred with the staff recommended approach, and in particular finds that: The City's program for "Best Available Science Critical Areas Regulations and Shoreline Master Program GMA (Growth Management Act) Integration, Featuring New Stream, River, and Lake Regulations" focuses primarily on new stream and lake, and shoreline buffers, which are designed to develop standard stream and lake and shoreline buffer widths that would result in no net loss of functions and values. Further, to provide incentives to restore degraded buffer conditions, the City's proposed critical areas update allows for both standard and flexible review processes, so that applications proposing to substantially improve functions and values may be allowed to reduce buffer widths with added site-specific studies and mitigation. Regarding wetlands, in most cases, the City expects that the standard wetland buffers will be sufficient to protect the functions and values of wetlands. However, the proposal also recognizes: 1) Renton's proposed code would widen buffers as needed to preserve all functions and values • (including wildlife); 2)Renton has performed reconnaissance of its wetlands (and streams) and does understand to a greater degree the functions and values and categories of streams and wetlands in its jurisdiction, increasing confidence in its code structure to protect functions and values by lowering i RENTON CITY COUNCIL Regular Meeting 411 October 25, 2004 Council Chambers Monday, 7:30 p.m. MINUTES Renton City Hall CALL TO ORDER Mayor Kathy Keolker-Wheeler called the meeting of the Renton City Council to order and led the Pledge of Allegiance to the flag. ROLL CALL OF DON PERSSON, Council President; MARCIE PALMER; TERRI BRIERE; COUNCILMEMBERS DENIS LAW; DAN CLAWSON;TONI NELSON; RANDY CORMAN. CITY STAFF IN KATHY KEOLKER-WHEELER,Mayor; JAY COVINGTON, Chief ATTENDANCE Administrative Officer; ZANETTA FONTES, Assistant City Attorney; BONNIE WALTON, City Clerk; GREGG ZIMMERMAN, Planning/Building/Public Works Administrator; KAREN MCFARLAND, Engineering Specialist; DENNIS CULP, Community Services Administrator; SYLVIA ALLEN,Recreation Director;MIKE WEBBY,Human Resources I Administrator; ALEX PIETSCH,Economic Development Administrator; ELIZABETH HIGGINS, Senior Planner;DEREK TODD, Assistant to the CAO; COMMANDER FLOYD ELDRIDGE,Police Department. Added A proclamation by Mayor Keolker-Wheeler was read declaring October 28, PROCLAMATION 2004, to be "Boeing 757 Day" in the City of Renton,encouraging all citizens to Boeing 757 Day-October 28, recognize the important contributions The Boeing Company and its employees 2004 (757 Airplane Program) have made and continue to make to the City. MOVED BY BRIERE, • SECONDED BY NELSON, COUNCIL CONCUR IN THE PROCLAMATION AS READ. CARRIED. SPECIAL PRESENTATION Recreation Director Sylvia Allen presented a report on the programs and events Community Services: Summer the Recreation Division offered during the summer. Noting the growing Recreation Program Report number of participants and staffs efforts to increase the number of classes, camps, and activities offered, Ms. Allen detailed the many programs that were made available to people of all ages. She highlighted continuing events such as the Kid's Klassic Fishing Derby, the Summer Lunch Program, the Kidd Valley Family Concert Series, and the Senior Day Picnic. Additionally, she pointed out new programs such as the birthday party packages, the Best Effort Basketball Camp, the outdoor adventure activities for special populations, and the opening of the Henry Moses Aquatic Center. PUBLIC HEARINGS This being the date set and proper notices having been posted and published in Vacation: Alley,Burnett Ave accordance with local and State laws, Mayor Keolker-Wheeler opened the S & S 2nd St, McLendon public hearing to consider the street vacation petition submitted by Steven Hardware, VAC-04-004 Friedman,on behalf of McLendon Hardware and the Tennessee Group, for a portion of alley right-of-way located east of Burnett Ave. S., west of Williams Ave. S., south of S.Tobin St., and north of S. 2nd St. (VAC-04-004). The alley is ten feet in width, and approximately 50 feet in length for portion running north and south, and 115 feet in length for portion running east and west. Karen McFarland, Engineering Specialist,reported that the subject right-of-way was obtained through quitclaim deeds, was not acquired with City funds, and • does not contain any City facilities. She explained that the petitioner plans to use the vacation area in the proposed Merrill Gardens Senior Housing Project, and plans on dedicating 20 feet of right-of-way to access the remaining alley. r October 25,2004 Renton City Council Minutes Page 369 Ms. McFarland stated that the petition was circulated to various City 11111 departments. No objections were raised; however,the following conditions were recommended: • Transportation Systems Division: 1)Amend the vacation area to exclude the north 20 feet of the alley running north and south; and 2)Maintain access to the remaining alley though the proposed right-of-way dedication. • Development Services Division: 1)Provide access to the remaining alley through the dedication of an alley 20 feet in width across the northern portion of the petitioner's lot; 2)Design the alley to accommodate the minimum turning radius for emergency vehicles; and 3)Pave the alley to 20 feet in width with asphalt and crushed rock. • Fire Department: The proposed right-of-way dedication be a minimum of 20 feet in width, and have a turning radius for emergency vehicles. Ms. McFarland stated that upon circulation of the petition to outside agencies, Puget Sound Energy reported the existence of facilities in the alley, and requested that the vacation not be finalized until it has received any necessary easements. In conclusion,Ms. McFarland stated that staff recommends approval of the vacation request, subject to five conditions pertaining to amending the vacation area, protecting the existing facilities,maintaining access to the remaining alley, paving the new alley section, and accommodating a minimum turning radius. Public comment was invited. • Steven Friedman, 7426 SE 27th St.,#200,Mercer Island, 98040,representing the petitioner, clarified that five feet of the west side of the existing north/south alley will be dedicated, which allows for the turning radius requested by the Fire Department. An e-mail was read from Bob and Margaret Schmidt, 95 Williams Ave. S., Renton, 98055, stating their opposition to the vacation request if access to the alley is limited or restricted to anyone. There being no further public comment, it was MOVED BY LAW, SECONDED BY NELSON, COUNCIL CLOSE THE PUBLIC HEARING. CARRIED. MOVED BY BRIERE, SECONDED BY LAW,COUNCIL APPROVE A PORTION OF THE REQUEST TO VACATE THE RIGHT-OF-WAY SUBJECT TO THE FOLLOWING CONDITIONS: THE VACATION AREA BE AMENDED TO EXCLUDE THE NORTH 20 FEET OF THE ALLEY RUNNING NORTH AND SOUTH; THE PETITIONER PROVIDE SATISFACTORY PROOF THAT OUTSIDE UTILITIES HAVE RECEIVED AND ARE SATISFIED WITH ANY EASEMENTS TO PROTECT THEIR FACILITIES; THE PETITIONER PROVIDE PUBLIC ACCESS TO THE REMAINING ALLEY THROUGH DEDICATION OF A MINIMUM 20- FOOT RIGHT-OF-WAY ACROSS THE NORTHERN PORTION OF PETITIONER'S PROPERTY; THE PETITIONER ENSURE THE NEW ALLEY SECTION IS PAVED TO 20 FEET IN WIDTH, WITH FOUR 110 INCHES OF ASPHALT OVER SIX INCHES OF CRUSHED ROCK; AND THE PETITIONER ENSURE THE ACCOMMODATION OF A MINIMUM TURNING RADIUS OF 45 FEET OUTSIDE AND 25 FEET INSIDE TO THE EXISTING ALLEY FOR EMERGENCY VEHICLES. CARRIED. r CITY OF RENTON, WASHINGTON 1111 ORDINANCE NO. AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, VACATING A PORTION OF ALLEY RIGHT-OF-WAY LOCATED SOUTH OF SOUTH TOBIN STREET, BETWEEN BURNETT AVENUE SOUTH AND WILLIAMS AVENUE SOUTH, (FRIEDMAN DEVELOPMENT, L.L.C.; VAC-04-004). WHEREAS, a proper petition for vacating an alley right-of-way ten feet wide and approximately 50 feet in length running north and south and approximately 115 feet in length running east and west, located south of South Tobin Street, between Burnett Avenue South and Williams Avenue South, was filed with the City Clerk on August 5, 2004, and that petition was signed by the owners representing more than two-thirds (2/3) of the property abutting upon the street or alley to be vacated; and WHEREAS, the City Council, by Resolution No. 3719, passed on September 27, 2004, • set October 25, 2004, at 7:30 p.m., in the City Council Chambers of the City of Renton as the time and place for a public hearing on this matter; and the City Clerk having given proper notice of this hearing as provided by law, and all persons having been heard who appeared to testify in favor or in opposition on this matter, and the City Council having considered all information and arguments presented to it; and WHEREAS, the Administrator of the Planning/Building/Public Works Department has considered this petition for vacation, and has found it to be in the public interest and for the public benefit, and that no injury or damage to any person or properties will result from this vacation; and WHEREAS, on April 11, 2005, City Council adopted the recommendation of the Planning and Development Committee to accept compensation at $25,500 for the alley vacation 1 • ORDINANCE NO. and accepted the 20-foot right-of-way dedication, appraised at $25,500, in lieu of the cash compensation; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DOES ORDAIN AS FOLLOWS: SECTION I. The following described alley right-of-way located south of South Tobin Street, between Burnett Avenue South and Williams Avenue South, to wit: (A portion of vacated right-of-way in the Northeast Quarter of Section 18, Township 23 North, Range 5 East, W.M., in the City of Renton, King County, Washington) See Exhibit "A" attached hereto and made a part hereof as if fully set forth herein is hereby vacated. SECTION II. Compensation is set in the amount of $25,500 for this alley • vacation and a 20-foot right-of-way dedication has been accepted in lieu of the cash compensation. SECTION III. This ordinance shall be effective upon its passage, approval, and five days after itsp ublication. A certified copy of this ordinance shall be filed with the Office of Records and Elections, and as otherwise provided by law. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk • 2 ORDINANCE NO. • APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor Approved as to form: Lawrence J. Warren, CityAttorney Date of Publication: ORD.1458:4/08/08:scr • 11111 3 EXHIBIT A • LEGAL DESCRIPTION A strip of land lying within the Northeast Quarter of Section 18, Township 23 North, Range 5 East W.M., being that portion of Lots 3 and 18, Block 24, Town of Renton, according to the Plat thereof, as recorded in Volume 1 of Plats, page 135, in King County, Washington, dedicated as alley under recording numbers 2117471, 2117484, 2117478 and 7811200482 and more particularly described as follows: The east 5 feet of Lot 3; EXCEPT the north 20 feet; The north 10 feet of the south 30 feet of Lot 3; And the west 5 feet of Lot 18; EXCEPT the north 20 feet; Situate in the City of Renton, County of King, State of Washington. • • • EXHIBIT MAP ALLEY VACATION PLAT Of THE TOWN OF RENTON RENTON, WASHINGTON I I 1 F), z/ 0007200096 z W O _ _ Q h I N W 20 1 !NI 5f 7231502130 { e 2 'n L_ _ al al — _ W `� O I o ,�; 1' EXISTING 10' ALLEY, �r e, •'NI ro REC. NO. 7811200482 ' I •N no TO 8E VACATED f I tg 7231502125 O °i2 N88 23'147"W W zo ( I 1,\0.00' N88'23'47"W Nin I ti.— 115.13' J c,�'v I W 3— W • o U) al No N888'22.3.47"W 115.00' 1 .N 18 z • rt��/ / //�lJ/ /y/// 12 0.-cn 410 I o N 7231502120 Cl) ILI oN88'23'47'W 115.00 I in O Q z ,// z ` N01'29'20'E 50.08' 1/ > f.. 1 Q H- I EXISTING 5' ALLEY, N88.23.47"W W I REC. N0. 2117471 Z 4 & 2117484; 7231532030 J7 ' 2 CC PORTION TO BE VACATEDEXISTING 5' ALLEY, i o <L M REC. NO. 2117478; – J CO I Z-------7 TO 8E VACATED J \ 120.00' - -- N88'23747"W -- 16 0 W N I In cIm ' ,N N I a. I O z -Lt __ 120.13'__ -- / N88'23'47"W P:\PO4\04441.10\CAD\4441-EXHIBIT.dwg 10/27/2004 025655 PM PDT Engineering PIonning Surveying i • Penhallegon Associates Consulting Engineers, Inc. • •••,r:.:r:; •e _;. 750 Sixth Street South Kirklond• WA 98033 www.poceengrs.com : ._r . .`,. ;t.- PH: (425) 827-2014 1-800-945-8408 FAX: (425) 827-5043 Kirkland Seattle SCALE: 1" = 50' FILE:\4441-EXHIBIT.DWG DATE: 02/15/06 RLH PROJ. NO.: 04441.10 III r s CITY OF RENTON COUNCIL AGENDA BILL AI #: 7 , • , L... , Submitting Data: For Agenda of: April 14, 2008 Dept/Div/Board.. CED __ Staff Contact Alex Pietsch (ext. 6592) Agenda Status Consent X Subject: Public Hearing... Naming Seahawks Way Correspondence Ordinance Resolution Business Exhibits: New Business Issue paper Study Sessions I Information Recommended Action: Approvals: Refer to the Transportation/Aviation Committee and set a Legal Dept public hearing for May 5, 2008 Finance Dept Other 7 Fiscal Impact: n/a Expenditure Required... Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project.. SUMMARY OF ACTION: The Seattle Seahawks have requested the City rename approximately 1,900 feet of roadway adjacent to their new headquarters and training facility, the Virginia Mason Athletic Center, Seahawks Way. Renton streets are named according to the Street Grid System outlined in RMC 9-11. Exceptions from the adopted street grid naming system are allowed with City Council approval (RMC 9-11-9, Exceptions). In order to notify area residents of the proposed change and to take public comment, a public hearing should be held on May 5, 2008. STAFF RECOMMENDATION: Rename the roadway immediately adjacent to the Virginia Mason Athletic Center to Seahawks Way from the intersection with Lake Washington Boulevard to the Seahawks' northern property line. Ill DEPARTMENT OF COMMUNITY & 0 ® se't ECONOMIC DEVELOMENT • • "e'P' M E M O R A N D U M DATE: April 7, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: - ' Denis Law, Mayor FROM: Alex Pietsch, Administrator v(vcR SUBJECT: Naming of Seahawks Way ISSUE: The City has been asked to rename the portion roadway fronting the Seattle Seahawks' new headquarters and training facility, the Virginia Mason Athletic Center, to Seahawks Way. RECOMMENDATION: Rename the roadway fronting the Seattle Seahawks' new headquarters and training facility Seahawks Way. BACKGROUND SUMMARY: In August 2008, the Seattle Seahawks will open the Virginia Mason Athletic Center (VMAC) on the shores of Lake Washington. The $65+million facility will serve as the corporate headquarters for the Seattle Seahawks and the region's new Major League Soccer team, as well as the training facility for the Seahawks. Beginning with a few special events this summer, and throughout the entire month of August in each year going forward, the team will hold its training camp at the VMAC and invite thousands of fans from around the region to the facility on a daily basis to watch practice. Throughout the year, about 150 people will work at the facility on a daily basis and it will receive regular visits from members of the news media and other high profile guests. The VMAC will undoubtedly raise the profile of Renton regionally and around the nation and lead to significant economic activity. Approximately 1,900 feet of roadway is adjacent to the VMAC (see attached map). Depending on where you look (City Utility records, County GIS data, or the actual street signs in place), this stretch of road is known as either Lake Washington Boulevard, Hazelwood Lane, and/or Ripley Lane North. The adjacent portion of the street could be renamed from the intersection with Lake Washington Boulevard to the Seahawks' north property line without affecting the Misty Cove Condominiums or any of the residential properties on Ripley Lane North to the north. Conner Homes' Barbee Mill development . should not be impacted. The only property that could potentially be addressed off of _ 1 Marcie Palmer,Council President Page 2 of 2 April 7,2008 Seahawks Way is the Quendall Terminals property which is currently undergoing • environmental remediation through the EPA Superfund process. Whether or not this property is affected will depend on how it redevelops in the future and where access points are located. If the renaming were to proceed, signage for the new street should be developed so that drivers would be directed to the remaining portions of Ripley Lane North via Seahawks Way. Renton streets are named according to the Street Grid System outlined in RMC 9-11. Exceptions to the system are allowed with City Council approval. CONCLUSION: Due to the regional significance of the VMAC and the economic benefit it will bring to the City, as well as the fact that only one other property would be affected, the City should grant the Seahawks' request and rename the portion of roadway adjacent to the VMAC Seahawks Way from the intersection with Lake Washington Boulevard to the Seahawks' northern property line. Attachment cc: Jay Covington,CAO Gregg Zimmerman,PW Administrator Mike Stenhouse,Maintenance Services Director Neil Watts,Development Services Director Suzanne Dale Estey,Economic Development Director David Whitmarsh,Maintenance Supervisor Jan Conklin,Development Services Representative 1111 h:\ednsp\council\issue papers-agenda bills-ctte reports\2008\seahawks way issue paper.doc , . Misty�~Cove i 1 -,..44pr / / JL �ti o, .41 Seahawks S // 4 , Quendall Terminals ( ( • / ..,, I os' ♦.> NE•44th•S Barbee Mill IroSRan1P 1, ),,,,,/ / E:43 :St 1 i 4 1-7-'-- ' n,.• E (/////u.i \\ cn , No, ar` 313 N y 47 �C i ill `�-'''''---' I it Legend 0r. Department of Community �,�.City Limits Seahawks Way ;). & Economic Development lLY_I FAA Boundary � �z AlexPietsch,Administrator Renton Parcels Proposed Change of Street Name Adriana Johnson,Planning Technician Streets Network April 3,2008 N Produced by City of Renton(c;2008,the City of 0 180 360 Renton all fight=_resehred No warranties of any 000 Feet Including hut not limited to accuracy,fitness or File Name H\EDNSP\GIS projects\misc_protects\rndxs\ merchantabilityaccompany this product seahawks_way.mxd 1:4,200 CITY OF RENTON COUNCIL AGENDA BILL AI#: i2 Submitting Data: Planning/Building/Public Works For Agenda of: April 14, 2008 Dept/Div/Board.. Development Services Division Staff Contact Carrie K. Olson x7235 Agenda Status Consent X Subject: Public Hearing.. Acceptance of additional right-of-way to comply with Correspondence.. City of Renton code for new short plats and the Ordinance Ribera-Balko Short Plat (LUA02-129) Resolution Old Business Exhibits: New Business Deed of Dedication Study Sessions Exhibit Map Vicinity Map Information Administrative Short Plat Report and Decision • Recommended Action: Approvals: Council concur Legal Dept X Finance Dept X Other Fiscal Impact: N/A Expenditure Required... Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project. SUMMARY OF ACTION: The area to be dedicated is approximately 11,604.50 sq. ft., required street improvement along the south side of NE 4th St., then south along the east side of Lot 1, 225 feet. This dedication is to comply with City of Renton code for new short plats and the Ribera-Balko Short Nat(LUA02- 129). Council acceptance of said right-of-way should be completed prior to recording the deed with the short plat. STAFF RECOMMENDATION: Accept the additional right-of-way and authorize the Mayor and City Clerk to sign and record the Deed of Dedication. • I:\PlanReview\COLSON\Shortplats 2008\Ribera-BalkoSHPL 02m AGNBILL.doc • Return Address: City Clerk's Office City of Renton 1055 South Grady Way Renton,WA 98055 DEED OF DEDICATION Property Tax Parcel Number: 518210-0020-03 Project File#:LUA-_ Project Name: RIBERA-BALKO SHORT PLAT Reference Number(s)of Documents assigned or released:Additional reference numbers are on page Grantor(s): Grantee(s): 1. Langley 4th Avenue Associates,LLC. 1. City of Renton, a Municipal Corporation LEGAL DESCRIPTION: (Abbreviated or full legal must go here. Additional legal on page 2 ) A portion of the following described property: Parcel A,City of Renton Lot Line Adjustment No.LUA 99075LLA,recorded under Recording No. 19990623900005. Situated in the City of Renton,King County, Washington. 111 The Grantor,for and in consideration of mutual benefits conveys,quit claims,dedicates and donates to the Grantee(s)as named above,the above described real estate situated in the County of King,State of Washington. IN WITNESS WHEREOF,I have hereunto set my hand and seal the day and year as written below. Annroved and Accented By: Grantor(s): Grantee(s): Langley 4th Avenue Associates,LLC., City of Renton Denis Law, Mayor Bonnie I. Walton,City Clerk INDIVIDUAL FORM OF STATE OF WASHINGTON )SS ACKNOWLEDGMENT COUNTY OF KING ) I certify that I know or have satisfactory evidence that Notary Seal must be within box signed this instrument and acknowledged it to be his/her/their free and voluntary act for the uses and purposes mentioned in the instrument. Notary Public in and for the State of Washington Notary(Print) My appointment expires: • Dated: 2275 road dedication2.DOC\dw Page 1 Revised 7-25-2006 Form 84 0001/bh IN WITNESS WHEREOF,I have hereunto set my hand the day and year as written below. • INDIVIDUAL FORM OF ACKNOWLEDGMENT Notary Seal must be within box STATE OF WASHINGTON )SS COUNTY OF KING I certify that I know or have satisfactory evidence that signed this instrument and acknowledged it to be his/her/their free and voluntary act for the uses and purposes mentioned in the instrument Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: REPRESENTATIVE FORM OF ACKNOWLEDGMENT Notary Seal must be within box STATE OF WASHINGTON )SS COUNTY OF KING ) I certify that I know or have satisfactory evidence that signed this instrument,on oath 411 stated that he/she/they was/were authorized to execute the instrument and acknowledged it as the and of to be the free and voluntary act of such party/parties for the uses and purposes mentioned in the instrument. Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: CORPORATE FORM OF ACKNOWLEDGMENT Notary Seal must be within box STATE OF WASHINGTON )SS COUNTY OF KING On this day of ,20 ,before me personally appeared to me known to be of the corporation that executed the within instrument,and acknowledge the said instrument to be the free and voluntary act and deed of said corporation,for the uses and purposes therein mentioned,and each on oath stated that he/she was authorized to execute said instrument and that the seal affixed is the corporate seal of said corporation. Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: • 2275 road dedication2.DOC\dw Page 2 Revised 7-25-2006 • Project: RIBERA-BALKO SHORT PLAT Exhibit A WO# PID Legal Description GRANTOR: Langley 4`h Avenue Associates,LLC Street: NE 4th Street and That portion of the following described property: Parcel A of City of Renton Lot Line Adjustment Number LUA 99075LLA, recorded under King County recording number 19990623900005. Morearticular) described as follows: P Y Beginning at the Northwest corner of said Parcel A, located on the south margin of Northeast 4th Street;thence South 88°03'09" East, along the south margin a distance of 348.51 feet to the Northeast corner of said Parcel A; thence South 00°47'46" West, along said Parcel A, a distance of 211.52 feet; thence North 89°12'14" West, a distance of 42.00 feet;thence North 00°47'46" East, a distance of 170.06 feet to the beginning of a curve tangent to said line; thence northerly, northwesterly and westerly a distance of 54.27 feet along the curve concave to the southwest, having a radius of 35.00 feet and a central angle of 88°50'55"; thence North 88°03'09" West tangent to said curve, a distance of 272.22 feet; thence North 00°54'12"East, a distance of 8.00 feet to Point of Beginning. IIIAll situate in Section 15, Township 23 North, Range 5 East of the Willamette Meridian. 'v 1VYth, i yiii, Z *rt.w 4 k�047 s e�� 1 r1 ^ 1 F...� 9-19_. • 2275 road dedication2.DOC\dw Page 3 Revised 7-25-2006 EXHIBIT "B" • A PORTION OF THE NW 1/4 OF THE NW 1/4 SECTION 15, TOWNSHIP 23 N. RANGE 5 E., W.M. ADDITIONAL RIGHT OF WAY FOR NE 4TH STREET NORTHWEST CORNER SEC. 15, TWP. 23N. , RNG. 5E. , W. M. FOUND BRASS PIN IN CONCRETE, INCASED. Southeast 128th Street (King Co.) Northeast 4th Street (Renton) 41..,„ . __GI._....,._..________ _ _______ _ ______ _ _______ S88 °03 ' 09"E 2585. 74 ' 323. 22 ' • : cv 306. 43 ' C `* S88 °03 '09"E 348. 51 ' N88 °03 ' 09"W 272. 22 ' NE CORNER OF 800 °54 ' 12"W R=35. 00 ' • 0�0;.;. PARCEL B 8. 00 ' A=54. 27 ' ►:�XI 6 POB A 88 °50 ' 55" p`;�;�; r• W ►`•••41 cv 8' ADDITIONAL R/W CD- ► 4; w DEEDED TO CITY Q ,••••1 co OF RENTON - N - •••' Q *V - V O i *:.i v tD4.•• ^ o� .�;z2 1111 z ��•::: z m PARCEL A �•❖•❖•� BLA LUA 99075LLA .;•••••••O wAFN 19990623900005 ; V v N89 °12 ' 14"W /fi�tt / ^n 42. 00 ' ,e/ i' a 8 0 _ if .r. ....'. •....Ai z , Q\.) F I..L . • - 1. • "OPr'�s� o P y . o • . . 4 '4 20847cNt i; .t 9FGISTEP��SJQ Iwt /VAL LANA� •1,,.>..EXPIRES: / /9'/ 08 .� '� /lll.z",.. l%l/JJ10 CENTRE A / � ; LANGLEY 4TH AVENUE `if)- N j- ASSOCIATES, LLC . -s - 6450 SOUTHCENTER BLVD "'.v-- -/- Consultants, Inc., P.S. TUKWILA. WA 98188 206 Railroad Avenue North - Kent, WA 98032 DRAWN: RS SCALE: 1"=100' III 253-813-1901 main 253-813-1908 fax DATE: 03/13/08 JOB NO: 2275 . 0 [ RECORDING NO. '1VOLUME/PAGE • ` o LUA-al- L 2 LND- - - 5 E. , W. M. VICINITY MAP • r,NB 6th St t , — A. ThE5thSt a- i 11 NB 4th St c_iNs i I R.,Pi1UI NEStdCt • •4 NB tad PI i A lr. - r -9`.fir . \ ______ LN,. ' 41 , 1" = 1/4 mile Aker Sec . 15, North quarter corner Sec . 15, Rng . 5E. , W . M. Twp . 23N. , Rng . 5E. , W. M. ;s pin in concrete, Found 3" brass disc with _ _ ;ity of Renton punch at surface . )int no . 1503. Q �1n CI S CONCURRENCE DATE --- . NAME ild Al. 9 5_ em .Cil - REPORT City of Renton i 1.1 . e W '1FA' Department of Planning/Building/Public Works (0. niuI.A- & I DECISION ADMINISTRATIVE SHORT PLAT REPORT& DECISION A. SUMMARY AND PURPOSE OF REQUEST: i DECISION DATE: December 5, 2002 Project Name Ribera-Balko Short Plat Applicant Tim O'Kane Insignia,Kidder Mathews 411 108 Avenue NE Suite 201 Bellevue, WA 98004 Owner Ribera-Balko Enterprises 16400 Southcenter Parkway Suite 304 Tukwila, WA 98188 File Number LUA-02-129, SHPL-A Project Manager Jason E.Jordan Project Description The applicant is proposing a two-lot subdivision of a 5.97-acre site designated with Center. Suburban (CS) zoning. Lot 1 is proposed at 58,446 square feet and Lot 2 is proposed to • be 201,867 square feet in size. The property is currently vacant and no building construction is planned as part of this short plat. The subject site also contains a 42,846 square foot Category 3 wetland located adjacent to the western property boundary. The applicant has requested to fill approximately 8,136 square feet of wetland area along the northeastern wetland boundary and replace it with 8,136 square feet of wetland area along the western portion of the wetland. The applicant is also proposing to enhance 8,136 square feet of existing wetland area located along the eastern boundary of the wetland per code requirements. Project Location 4225 NE 4th Street �.; r8 p ./ iz: y +i; LIQ.„ Mr� N �7':::74; .... �Y�fQ ••►'�Q�� .s yti•.s pt �aRiiar'. ai�yNt�y p ''\, t t ...� �, gf: _.� �a ►iii �r��6p��;_. VP�''y �dCb�XeG�ysx..Iraq .-5--...,11.1-, v ..;-1:71:,: �5C' 'fir 40:1 r R�•67 =ngnt.wnn-. F'" ;v°:� I� -1 � Qli'^_�Ai. + i=us w-;, ti:a'r. ?dKda as t omen }ctl 7f^...;z:.... 7.: 7_.iiaS,.qCC:111:1 „gal 1 y:y :. M.:4*. ;tiii� t 1 a .7 +a.. .-:,..1,1- 4,47.;;;1/4-1.1� atx� �- �:i.yet. i.J -� y o:,'•�.�.7� 1 or.',IA, -.f MI i : :1.6 Ril,-- mr.Ap mix9ini, it rir rull ' er-M- -"I SINInn:7117 1 1.24-4-121!_ 73,114 J/ iii„....„.„,„..:. . Fik b i .� Mi gill ".` Alf I� araii railtAgill 0 u -- veil VAiii,,I,''';.1..mtp.dialue ! •; '-t1a.s s Project Location Map shortplat.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002;PROJECT LUA-02-129,SHPL-A Page 2 • B. GENERAL INFORMATION: 1. Owners of Record: Ribera-Balko Enterprises 16400 Southcenter Parkway Suite 304 Tukwila,WA 98188 2. Zoning Designation: Center Suburban (CS) 3. Comprehensive Plan Land Use Designation: Center Suburban (CS) 4. Existing Site Use: The site is currently vacant. 5. Neighborhood Characteristics: North: NE 4th Street and Center Suburban Zoning (CS). East: US Post Office; Center Suburban Zoning (CS). South: Residential Option (R-10 dwelling units per acre). West: Center Suburban Zoning (CS). 6. Access: NE 4th Street 7. Site Area: 5.97 acres C. HISTORICAL/BACKGROUND: Action Land Use File No. Ordinance No. Date Comprehensive Plan N/A 4498 02/20/1995 Zoning N/A 4404 06/07/1993 Annexation N/A 3946 10/07/1985 Lot Line Adjustment LLA-99-075 N/A 06/25/1999 Environmental (SEPA) LUA 01-117, ECF N/A 07/01/2002 Review HEX Variance LUA 01-117, V-H N/A 08/27/2002 D. PUBLIC SERVICES: 1. Utilities Water: There is an 8-inch water main located within NE 4th Street. Sewer: There is an 8-sewer main located within NE 4th Street Surface Water:There are existing drainage facilities located within NE 4th Street. 2. Fire Protection: City of Renton Fire Department E. APPLICABLE SECTIONS OF THE RENTON MUNICIPAL CODE: 1. Chapter 2 Land Use Districts Section 4-2-020: Purpose and Intent of Zoning Districts Section 4-2-070: Zoning Use Table Section 4-2-120: Commercial Development Standards 2. Chapter 4 Property Development Standards Section 4-4-030: Development Guidelines and Regulations 3. Chapter 6 Streets and Utility Standards Section 4-6-060: Street Standards 4. Chapter 7 Subdivision Regulations Section 4-7-080: Detailed Procedures for Subdivision Section 4-7-120: Compatibility with Existing Land Use and Plan-General Requirements and Minimum Standards shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002; PROJECT LUA-02-129,SHPL-A Page 3 Section 4-7-150: Streets-General Requirements and Minimum Standards 1111 Section 4-7-18: Industrial and Commercial Blocks and Lots-General Requirements and Minimum Standards 5. Chapter 9 Procedures and Review Criteria F. APPLICABLE SECTIONS OF THE COMPREHENSIVE PLAN: 1. Land Use Element—Center Neighborhood G. DEPARTMENT ANALYSIS: 1. Project Description/Background The applicant is proposing a two-lot subdivision of a 5.97-acre site. The property is designated as Center Suburban (CS) on both the City's Comprehensive Land Use Map and the Zoning Map. However, the development of the lots is not proposed as part of this application. The proposed lot sizes are as follows: Lot 1 — 58,446 square feet (1.34 acres) Lot 2— 201,867 square feet (4.63 acres) The property is currently vacant. Access to the site would be provided from NE 4th Street, which is located directly north of the subject site. The applicant has proposed a drive located near the northeast property boundary of new Lot 2. This drive has been designed to accommodate both Lot 1 and Lot 2 of the proposed short plat and to serve the existing US Post Office Complex located directly east of the subject site. In order to provide additional building area to what would become new Lot 1,the applicant has proposed to fill portion of the Category 3 wetland. Specifically, the applicant has requested to fill approximately 8,136 squa feet of wetland area along the northeastern wetland edge and create approximately 8,136 square feet o wetland area near the wetland's western edge. In addition, the applicant has proposed to enhance approximately 8,136 square feet of existing wetland area near the wetland's western boundary. The proposed created wetland area and enhanced wetland area has been calculated at a 1:1 ratio pursuant to the City's Critical Areas regulations (RMC4-3-050M12i). It should also be noted that the applicant has proposed to enhance approximately 3,875 square feet of wetland buffer located along the wetland's western boundary, which exceeds the requirements of the City's Critical Area regulations. In addition, the applicant notes the presence of a drainage course "channelization" throughout the center portions of the wetland. The drainage course has been identified as part of the Maplewood Creek system that eventually discharges into the Cedar River. The drainage course parallels NE 4th Street on the subject property and then turns south and flows towards the southwestern property boundary. The drainage course continues to flow through the wetland area to the southeast. The applicant received Hearing Examiner Variance approval on August 27, 2002 to culvert a portion of the drainage course that runs parallel with NE 4th Street. The variance was necessary in order to construct a sidewalk and other code required roadway improvements along NE 4th Street, which are triggered by the short plat. 2. Environmental Review The subject site contains a large Category 3 wetland and a regulated drainage course along the western property boundary, which requires environmental (SEPA) review. On June 27, 2002, the City of Renton's Environmental Review Committee (ERC) issued a Mitigated Determination of Non-Significance with nine mitigation measures. As the SEPA threshold determination does not expire and because no new environmental impacts have been discovered, a new threshold determination was not required. 3. Compliance with ERC Conditions Based on an analysis of probable impacts from the proposal, the Environmental Review Committee (ER issued the following mitigation measures with the Determination of Non-Significance—Mitigated: 1. Temporary erosion control measures shall be maintained to the satisfaction of the representative of the Development Services Division for the duration of the project's construction. shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002; PROJECT LUA-02-129,SHPL-A Page 4 1111 2. The project contractor shall perform daily review and maintenance of all erosion and sedimentation control measures at the site during the construction of both off-site and on-site improvements as well as building construction. 3. Weekly reports on the status and condition of the erosion control plan with any recommendations of change or revision to maintenance schedules or installation shall be submitted by the project Engineer of record to the public works inspector for the preliminary short plat construction. Certification of the installation, maintenance and proper removal of the erosion control facilities shall be required prior to recording of the final short plat. 4. The applicant shall install a silt fence along the downslope perimeter of the area that is to be disturbed. The silt fence shall be in place before clearing and grading is initiated, and shall be constructed in conformance with the specifications presented in Section D.4.3.1 of the 1998 King County Surface Water Design Manual, Appendix D. This will be required during the construction of both off-site and on- site improvements as well as building construction. 5. Shallow drainage swales shall be constructed to intercept surface water flow and route the flow away from the construction area to a stabilized discharge point. Vegetation growth shall be established in the ditch by seeding or placing sod. Depending on site grades, it may be necessary to line the ditch with rock to protect the ditch from erosion and to reduce flow rates. The design and construction of drainage swales shall conform to the specifications presented in Section 4.4.1 of the 1998 KCSWDM. Temporary pipe systems can also be used to convey stormwater across the site. This will be required during the construction of both off-site and on-site improvements as well as building construction. 6. Clearing, grading, stormwater, erosion and sedimentation control shall be subject to the 1998 King County Surface Water Design Manual. 7. The applicant shall comply with the recommendations contained within the Wetland Evaluation Report • prepared by Habitat Technologies dated May 22, 2002 in regards to wetland maintenance, monitoring and construction of the project. 8. The applicant shall be required to install silt fencing with brightly colored construction flags to indicate the boundaries of the wetland area and buffer prior to the issuance of construction permits. 9. The applicant shall be required to revise the preliminary short plat plan by eliminating the 36-foot drive proposed to serve Lot 1 located in the northwest corner of the subject site. 4. Staff Review Comments Representatives from various city departments have reviewed the application materials to identify and address issues raised by the proposed development. These comments are contained in the official file, and the essence of the comments has been incorporated into the appropriate sections of this report. 5. Consistency Short Plat Criteria Approval of a plat is based upon several factors. The following short plat criteria have been established to assist decision-makers in the review of the plat: a) Compliance with the Comprehensive Plan Designation The site is currently designated Center Suburban (CS) on the Comprehensive Plan Land Use Map. The proposed short plat is consistent with the objectives and policies established by the Land Use Element of the Comprehensive Plan, in that the division of property would allow for future retail establishments. It should also be noted that future development of the individual parcels would be required to be consistent with the applicable Center Suburban designation at the time they are proposed. b) Compliance with the Underlying Zoning Designation • The subject site is designated Center Suburban (CS) on the City of Renton Zoning Map. As specific development projects are proposed on the individual lots, compliance with the applicable development standards would be reviewed under the required permits. The proposed short plat is required, however, to comply with the development standards pertinent to the creation of new lots. Lot Dimensions — The minimum lot size required in the CS zone is 25,000 square feet. As proposed, the lot sizes are 58,446 square feet (Lot 1) and 201,867 square feet (Lot 2), providing shpltrpt.doc IL • City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002;PROJECT LUA-02-129,SHPL-A Page 5 more than the minimum lot size required. There are no minimum lot width and depth requirement. in the CS zone. Lot Coverage—The CS zone limits lot coverage by buildings to a maximum of 65% of the site area, or 75% if structured parking is provided. Future development of the lots would be required to comply with the current zoning designation and development standards applicable at the time of their proposal. c) Compliance with Subdivision Regulations Streets: No new public streets would be created as part of the proposed short plat. Full street improvements would be required along the subject site's northern property boundary abutting NE 4th Street. It should be noted that a portion of the regulated drainage course is located in the area where street improvements (i.e. curb, gutter and sidewalk) will be required. However, a Hearing Examiner Variance was approved and issued to culvert the drainage course where necessary to install the required improvements on August 27, 2002 (LUA01-117,ECF,SHPL-H,V-H). The proposed subdivision is not anticipated to generate additional traffic on the City's street system. As future development proposals are made for each individual lot, Transportation Mitigation Fees would be applied. Blocks:No new blocks will be created as part of the proposed short plat. Lots: The proposed lots are consistent with the applicable development standards of the CS zoning designation. In addition, the size, shape, orientation, and arrangement of the proposed lots comply with the requirements of the Subdivision Regulations. As required, each lot would have access to a public right-of-way(NE 4th Street.). d) Reasonableness of Proposed Boundaries I Access: Lot 2 is proposed to have direct access to NE 4th Street. Lot 1 is proposed to hav access to NE 4th Street via an easement from Lot 2 to Lot 1. It should also be noted that thi proposed drive would allow full movement with one exception; left turns out onto NE 4th Street would not be allowed. In addition, the drive has been designed to accommodate a revision in the access drive serving the US Post Office. All customers would be routed through the new drive I proposed to be located on new Lot 2. Therefore, staff recommends a short plat condition requiring the applicant to have all appropriate access easements executed between the affected properties I prior to final short plat approval. In addition, staff recommends a condition of short plat approval requiring the applicant to complete all off-site improvements associated with the northeastern shared drive prior to final short plat approval. Both conditions would ensure that safe and efficient access would be provided to the proposed lots and the neighboring US Post Office Complex. It should also be noted that as Lot 1 develops in the future, the applicant would have the ability to construct a joint-use drive with the commercial property to the west. This drive would be located in the northwest corner of proposed Lot 1. Topography: The majority of the property is relatively flat sloping at less than one percent from the north property boundary to the southern property boundary. However, both the western and southeastern property boundary rise approximately 12 feet from the more flat interior section of the subject site. Specifically, starting near the middle section of the site's western property boundary, the topography gradually rises to its highest point of 12 feet above the more flat central portion of the site. Similarly, the topography in the southeastern property corner also rises approximately 12 feet. As no construction is planned at this time, a geotechnical evaluation was not warranted. However, as the lots are developed in the future, a soils study would be required as part of the building permit process. The existing vegetation on the property primarily consisted of wetland vegetation, ornamental and native trees and blackberries. A Temporary Erosion and Sediment Control Plan (TESCP), the use Best Management Practices and several drainage/erosion control SEPA conditions will help tO mitigate potential erosion and off-site sedimentation impacts. Relationship to Existing Uses: The properties surrounding the subject site are designated CS and R-10 (Single Family Residential) based on the City's zoning map. The proposed subdivision shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002;PROJECT LUA-02-129,SHPL-A Page 6 • would not create dissimilar patterns to existing development in the area and is consistent with both the Comprehensive Plan and Zoning Code. e) Availability and Impact on Public Services(Timeliness) Police and Fire: Police and Fire Prevention staff indicate that sufficient resources exist to furnish services to the proposed development. Fire Mitigation Fees, based on a rate of $0.52 per square foot of new commercial building area, may be required at the time of building permit issuance in order to mitigate the proposal's potential impacts to emergency services. Recreation: The proposal is not subject to the City's Parks Mitigation Fee as it is creating lots intended for commercial use. Schools: There would be no increase in school age children to the Renton School District as a result of this proposal. Storm Water. There are existing facilities located within NE 4th Street. Additional review of these facilities, as well as the assessment of System Development Charges, will be necessary at the time future development proposals are made. Water and Sanitary Sewer Utilities: There are existing facilities located within NE 4th Street. Additional review of these facilities, as well as the assessment of System Development Charges, will be necessary at the time future development proposals are made. H. FINDINGS: Having reviewed the written record in the matter, the City now enters the following: 1. Request: The applicant has requested Administrative Short Plat Approval for the Ribera-Balko • Short Plat, File No. LUA-02-129, SHPL-A. 2. Application: The applicant's short plat application complies with the requirements for information for short plat review. The applicant's short plat plan and other project drawings are contained within the official land use file. 3. Comprehensive Plan: The subject proposal is consistent with the Comprehensive Plan designations of Center Suburban (CS). 4. Zoning: The proposal as presented, complies with the zoning requirements and development standards of the Center Suburban (CS) zoning designations, provided all advisory notes and conditions of approval are complied with. 5. Subdivision Regulations: The proposal complies with the requirements established by the City's Subdivision Regulations. 6. Existing Land Uses: Land uses surrounding the subject site include: North: NE 4th Street; Center Suburban; East: US Post Office; Center Suburban (CS) Zoning; South: Residential Single family(R-10); and West: Center Suburban (CS) Zoning. CONCLUSIONS: 1. The subject proposal complies with the policies and codes of the City of Renton, including the applicable subdivision regulations. 2. The proposal complies with the Comprehensive Plan designations of Center Suburban (CS). 3. The proposal complies with the Zoning designations of Center Suburban (CS). J. DECISION: • The Ribera-Balko Short Plat, File No. LUA-02-129, SHPL-A, is approved subject to the following conditions: 1. The applicant shall be required to have all access easements with the US Post Office facility signed and recorded or ready to record with the recording of the final short plat documents prior to recording the final short plat. The satisfaction of this requirement shall be subject to the Director of the Development Services Division prior to recording of the short plat. shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002; PROJECT LUA-02-129,SHPL-A Page 7 2. The applicant shall be required to complete all off-site construction improvements associated with NO 4th Street and the northeastern drive prior to the recording of the final short plat. The satisfaction of this requirement shall be subject to the Director of the Development Services Division prior to recording of the short plat. DATE OF DECISION ON LAND USE ACTION: December 5, 2002 SIGNATURES: �P /e0gfM /2/4fob Gregg A.Zimmerman,P/B/PW Administrator decision date Advisory Notes to Applicant: The following notes are supplemental information provided in conjunction with the environmental determination. Because these notes are provided as information only,they are not subject to the appeal process for environmental determinations. Property Services Comments for Final Short Plat Submittal: 1. See attached comments from Property Services dated November 26, 2002. Planning 1. RMC section 4-4-030.C.2 limits haul hours between 8:30 am to 3:30 pm, Monday through Friday unless otherwise approved by the Development Services Division. 2. The subject site is located within the Center Suburban (CS) zoning and comprehensive land use designation area. 3. Commercial, multi-family, new single family and other nonresidential construction activities shall be restricted to the hours between seven o'clock (7:00) a.m. and eight o'clock (8:00) p.m., Monday through Friday. Work on Saturdays shall be restricted to the hours between nine o'clock (9:00) a.m. and eight o'clock (8:00) p.m. No wor• shall be permitted on Sundays. 4. Within thirty (30) days of completion of grading work, the applicant shall hydroseed or plant an appropriate ground cover over any portion of the site that is graded or cleared of vegetation and where no further construction work will occur within ninety (90) days. Alternative measures such as mulch, sodding, or plastic covering as specified in the current King County Surface Water Management Design Manual as adopted by the City of Renton may be proposed between the dates of November 1st and March 31st of each year. The Development Services Division's approval of this work is required prior to final inspection and approval of the permit. 5. The applicant shall be required to create a separate native growth protection area containing the wetland and its buffer via a conservation easement, protective easement or tract/deed prior to final short plat approval (RMC4-3- 050G). -j 6. The applicant shall be required to erect a spilt-rail fence or other fence type as approved by the Development Services Division denoting the edge of the wetland buffer boundary prior to the finalization of all construction permits. 4 7. The applicant shall be required to permanently identify the native growth protection area by including a wood or metal sign on treated or metal posts. Suggested wording of the sign is as follows: "Protection of this natural area is in your care. Alteration or disturbance is prohibited by law." (RMC4-3-050G5) 8. The applicant shall submit a final wetland mitigation plan prior to the Development Services Division prior to the issuance of construction permits (RMC 4-3-050M16). 9. The applicant shall be required to submit a Performance Surety Device acceptable to the city such as a letter of credit, irrevocable set-aside letter or cash estimated at 1.5 times the cost of the performance of the wetland (RMC4-3-050M17a). 10. The applicant shall be required to submit a Maintenance Surety Device acceptable to the City such as a letter of credit, irrevocable set-aside letter or cash guaranteeing the wetland enhancements perform satisfactory for a period of no less than five years after final plat approval (4-3-050M17b). Building 1. None. • Fire 1. None. Plan Review—Surface Water 1. The water quality treatment and detention shall be designed to be in compliance with the Level 2 1998 King County Surface Water Manual. shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002; PROJECT LUA-02-129,SHPL-A Page 8 III2. Additional storm improvements are required to be installed in NE 4th St prior to recording the short plat. The applicant will need to contact the DOFW if the proposal is to pipe the ditch in NE 4th St. 3. There will need to be some type of storm maintenance agreement that holds the lots responsible for the storm drainage system onsite. 4. The project will be required to pay the Surface Water System Development Charges prior to the issuance of the construction permit. The fees are determined by the development proposed. 5. The storm drainage report is missing the water quality analysis and conveyance sizing calculations. The detention sizing comments are as follows: • The applicant will need to revise the detention calculations to include the 1998 KCRTS Level II flow control standard. • The KCRTS model must be run using a 1-hour time step, not the 15-min time step as shown in the repot. • It's not clear from the report what is the total project impervious surface area for developed conditions. The report should break out the pervious and impervious surface area as well as which impervious areas are pollution-generating surfaces and which are not such as roof and sidewalk. It appears from the report that approximately 2.4 acres of impervious surface will be added; however, the KCRTS time series input shows only 1.59 acres of impervious. A table showing the land use under pre-and post-developed conditions would be helpful. Plan Review—Water 1. The project site is located in the 565 Pressure Zone. The static water pressure at the street level is approximately 70 psi. 2. There is an existing 8"watermain in NE 4th St adjacent to the site. 3. Construction of a commercial building will trigger a separate review. Per the City of Renton code when the required fire flow is over 2500 GPM, the fire hydrants shall be served by a main which loops around the buildings and reconnects back into a distribution supply main. 4. Any new construction must have a fire hydrant capable of delivering a minimum of 1,000 GPM with one hydrant located within 150 feet of the structure and two additional hydrants located within 300 feet of the structure. This • distance is measured along the travel route. These issues are covered in greater detail once a development plan is submitted. This water information is intended to supply information for the applicant to use at a future date and is not intended to list design criteria for an unknown development. 5. Construction of a commercial building will trigger a separate review. SDC fee review for water will be applied at the time the development makes application for a building permit. The fees are determined by the development proposed. Plan Review—Sanitary Sewer 1. There is an existing 8"sanitary sewer main in NE 4th St. 2. There is an existing 15"sanitary sewer main located on the east side of this parcel of land. 3. A sanitary sewer main extension will not be required for this short plat. 4. This parcel of land is subject to the East Renton Interceptor Special Assessment District (SAD). This assessment is $224.52 plus interest per unit and is collected at the time each new lot develops and prior to the issuance of the construction permit. 5. This parcel of land is subject to the Fairfield Development Inc. Latecomers (Latecomers 8707). This assessment is $19,529.39 and is collected prior to the issuance of a construction permit. 6. The project will be required to pay the Sanitary Sewer System Development Charges. The SDC fees are collected at the time each new lot develops and are due prior to the issuance of the construction permit. The fees are determined by the development proposed. Plan Review—Transportation 1. This short plat shall install full frontage improvements on NE 4th St including concrete curb, gutters and a 6' sidewalk with a 6' planting strip between the curb and sidewalk prior to recording the short plat. 2. The short plat will also be required to remove and replace the existing south lane of asphalt in NE 4th St across the full frontage of the parcel of land being developed prior to recording the short plat. 3. Additional right-of-way will be required to be dedicated prior to the recording of the short plat.' 4. Street lighting designed and installed to City standards will also be required to be installed by this short plat project prior to recording the short plat. 5. As each lot develops in the future a Traffic Report may be required. • Plan Review—General 1. The site is located in the Aquifer Protection Zone 2 and may be subject to additional requirements per City code. A fill source statement (RMC 4-4-060L4) is required if more than 100 cubic yards of fill material will be imported to the project site. Construction Activity Standards (RMC 4-4-03007) shall be followed if during construction, more than 20 gallons of hazardous materials will be stored on site or vehicles will be fueled on site. Surface Water shpltrpt.doc City of Renton P/B/PW Department Administrative Land Use Action REPORT AND DECISION DATED December 5,2002;PROJECT LUA-02-129,SHPL-A Page 9 Management Standards (RMC 4-6-030E2 and 3)--Biofilters, stormwater conveyance, and water quality ponds may require a groundwater protection liner. Impervious surfaces shall be provided for areas subject to vehicular use or storage of chemicals. This is not intended to be a complete list of the APA (Aquifer Protection Area) requirements nor does this information substitute for the full ordinance, it is only intended to guide the applicant to the City of Renton code book. 2. All required utility, drainage and street improvements will require separate plan submittals prepared according to City of Renton drafting standards by a licensed Civil Engineer. 3. All plans shall be tied to a minimum of two of the City of Renton current Horizontal and Vertical Control Network. 4. Permit application must include an itemized cost estimate for these improvements. The fee for review and inspection of these improvement is 5% of the first$100,000 of the estimated construction costs; 4% of anything over$100,000 but less than $200,000, and 3% of anything over$200,000. Half of the fee must be paid upon application for building and construction permits, and the remainder when the permits are issued. There may be additional fees for water service related expenses. See Drafting Standards. TRANSMITTED this?day of December,2002 to the owner/applicant/contact: Ribera-Balko Enterprises 16400 Southcenter Parkway Suite 304 Tukwila,WA 98188 TRANSMITTED this?day of December,2002 to the applicant: Tim O'Kane Insignia Kidder Mathews 411 108th Avenue NE Suite 201 Bellevue,WA 98004 • TRANSMITTED this?day of December,2002 to the contact: Dan Balemlli Barghausen Consulting Engineers 18215 72nd Avenue South Kent,WA 98032 TRANSMITTED this eh day of June,2001 to the following: Larry Meckling,Building Official L. Rude, Fire Marshal Neil Watts, Development Services Director Jennifer Henning Kayren Kittrick Jan Conklin Carrie Olson Lawrence J.Warren,City Attorney South County Journal Land Use Action Appeals& Requests for Reconsideration The administrative land use decision will become final if the decision is not appealed within 14 days of the effective date of decision. An appeal of the decision must be filed within the 14-day appeal period(RCW 43.21.C.075(3);WAC 197-11-680). RECONSIDERATION. Within 14 days of the effective date of the decision,any party may request that a decision on a short plat be reopened by the Administrator. The Administrator may modify his decision if material evidence not readily discoverable prior to the original decision is found or if he finds there was misrepresentation of fact. After review of the reconsideration request,if the Administrator finds insufficient evidence to amend the original decision,there will be no further extension of the appeal period. Any person wishing to take further action must file a formal appeal within the following appeal timeframe. APPEAL. This administrative land use decision will become final if not appealed in writing to the Hearing Examiner on or before 5:00 PM on December 19,2002. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4- 8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425) 430-6510. Appeals must be filed in writing,together with the required$75.00 application fee,to: Hearing Examiner,City of Renton, 1055 South Grady Way, Renton,WA 98055. EXPIRATION DATE: The Short Plat approval will expire two(2)years from the date of approval. An extension may be requested pursuant to RMC section 4-7-080.M. shpltrpt.doc , lira NE L NOW. L AVE N.L. L •• --' la IM S. E +©EiS ?Jrt 41:1' a inn\ ;LIN, ra C9 S:,CI�: .711n....._,._111611111i 1• I g .'( mi l_ V^1'I Irl' )11 Ix 0! Ar.7:. J =Min ;,; 4 %j -„ _ i,4L r frit not As Yry,> • ' € `• 1(, r t! • 5 R _ _ °,� i 'ri*+jet 1� j p EtZrl6t i• 4y�L n F I C' - IL- - � -L y�L•-�� c @' Qui __.- =F:.....--.7---- % �---.-- - _ iii yrCT, 'fit' E�'' a !+i44._i [p74n1� . �1['s Si r�S ,� IQ r E Mlig;711tIon'14,: ; 11,t C t.. i 1:.. $'� Q� k'aro — 1y �! '� 1 ...<. _71F r, CC'L 3391: % az. .. ®' °'4',. roMI --__ S �,� L S �,� Y @I �' - � I.IM t S � ., � �., 1 SIE --k- _—_— ——— I_ -_ ��.,•�' _-_ .• __ .. - . .� •UfEN ANNE AVE N mc__-��"'w ate.,,., ,1 =_ .,� __- -__ (;:aa..-,...—- A. I _ i 8 t c �AAGAAGAAk k,t♦ `'i..gaba... ity;±" .4, •• .� `:'‘...,......,5. '" — —— ——---j-- ,=--_____`..Z.ua A •. - 7 n+J E !LL�.11M. * � 7-Ste^?4 �J pi� 1 r • !1 t �7 ,,,,_ i-- __� ®! "'O -3 y--_ I; -- � ''� 'M+1.'�71E3L7�R� I�¢tn R•'° ri�' 4 ll�.fJL'11lI„00140,,s4.).-k..'.S ' 1 Y:�I, �M19 la t -p —-",o. _- � �4'�M�1!�M�`hYY 9'* F r pa��lflu � � 1 x FAv.r��F • -1:-"'. q aq" r- !7 ?ra a4,•��Fs r ly �� w�t++�' , / ,,, , 1 g, rarl 1 , .. r / 4• �, .!�: 2.3 BC na�i • Utz `�I�S'.aLJ�`'Jl♦i l .r E��yy. ,� i t = h �1I.7 h:• � jl J a 1!` Y :K �I� ��•T7 I .t N zefy+7 JL•�=' I . \�' I' - ?' , cry. Iq a�`•• +nz.`�' x 4fr w t'IW i! ,.,,-a.g c �l� it7` L'�' - OiriEv �,� I.:pi►7x!� 1.�' Ad �►?a _:_�' J w�1� . F R ►y� ¢1,� +•� ' • I r.il� 'L m‘,030 4 p • � .:7 F � ��1.1 �� e _ 1RritriAria i�lf'e�� ki� ruro.�.lvea[r �1 � 67_, 7 `-'-'T.:.::::„,....,,' t; 0 :4.9 1! a rS< F ice, c �i _:g �I;. r Ida,r'r 1411i. u ilk •r.tl FC ® aQ ndd� ignf rix pI3W ^'al�lL . 3�'- --- �T- _ 1 ion Rve NE . __� �� . ~~ 1 L I ' aalrl ' uy, 11 FI .rai ��/// r� e �,1 I.� gl�u �� 1 r •".1�' yI� "1 , .-LA-,..,r1. O _ - 11 ' i'A l+Y�r'� 51111,-,J.-4- - -_ 1---- =iQI QI �I�G7L'7 L�I�..�i'aA ��Y'" � ��. o i¢ 'i � � �d � Rrw�w1��`/� J.�l�1.!'��r a yyly� I' Q t J0MIQ .76:3 +t ' IN Vtilf4 _ hi 1 �-^1 viCaCln 31:10_""k;I��.•. �AL} Ma = O I e • Ai . ' , It 1, 1}1®T �� .1 N, ms11r3V:C l 131gZPWit< MAPZI0101 ii MIMI © I.A .. � II m �4 .ii,1� I �, 3s g0 �1274 PO AL01‘5.' �w�►f'riltm $4. OW �' 21, 0t�'.-y®ialt� � '�'4y� i�.�yt igim �RIX MO.1,11,Y ter& Milli 0 r-, .��i14 li �}_-rr..IN�I, *NMI�' NOW Arai 4. • 11111-5: �01011 'Po nv V�?...0,V.fi,"r,a''f:M 'NS"�1�:' i>tj,/,,/ '� B m Z L m 11 _Ci7 ji7Aaki-4 VW g VC k• l� i- 1 �ii�y 111113 14 g• 146111 w. 1.3 /1;70- . hili 1 qa L 411,114 - ,u �y X let4r2•,��tnI�tli.11!®srl •ilitt _ , O"..�li O _-- \. Osin_ - �LI '. I. ��ee�.1/ Irin„1 : VIC e f� E '1/4r4.4 •17 i m I II 1a,. '1;'s�'�,i,�E[ L .r;.r.rl} .3W3tl8 �V 1 . LCkY S ® Q >. 'Ir *s� lel, 44' ON °o VA/100.ka 00 R�0' .s! ::A iNtiewil ®tl f . ® "C • ` ,® Q �i= •wri r7. r �; � 'ION ilk- i ?� WOO E iiprillt::,. -3q3.3 I mil 1-1 Zar Valp . ,,,,„4 ..„..o , tik-E. ;Is,-'4....ijiiimatill ill .. 1 or iipiRg ,i-,z.-4--in t CZI •. I lipim, ii3411 la RI '� Mt ,a ®R I�JI.:W u�3000o'Ry'„ �^ N.E. o •f re r 7 •. ,./• - , I. DUVALL AVE. • .' q I�II'1Ic1IFi '��, ri�� a "' t1-+ �.y,1.1tt'A'.IMwhrr Icl[ Yml ❑ )�•/.� �' 1 I" IS..... I ia 1� Ito I }��/'i _.111 NV' 7wL:;Ie1 rah �i9:,s'xiF „ �. •� w Y ri J p r`fll�4+ 8 ��i, `l�ui� e 1�-V1 g- , !„i s4 ri Id. air J! 1C1i 1� AY�`a� �If)1K.��Y# ® 3 ® L7-1 6.�•111 i ��. / rC I+ti•r �4+.uJ• ► g 'b O �� . ommx n31 1r 1 Proposed Land Use Action RECORDING NO. A PORTION OF THE NW 1/4 OF THE NW 1/4 SEC. 15, TWP. 23N., RNG. 5E., W.M. CITY OF RENTON, KING COUNTY, WASHINGTON NORTHWEST CORNER SEC. 15. TWP, 23N„ RNG, 5E., N.N. FOUND BRASS PIN IN CONCRETE, Southeast 128th Street (King Co.) NORTH QUARTER CORNER SEC. 15, INCASED. Northeast 4th Street (Renton) TWP. 23N„ RNG. 5E.. N.M. FOUND 3' BRASS DISC WITH 0 16 13' - - - _ _ NAB'03'09'W 2585,74' PUNCH AT SURFACE. 9 f REBAR ANO CAP 969.65' - STAMPED 'LS 22338' v - f0 of 1616.09' 15 N88'03'09'W 646.!11' .1 314 51' 34.00' As I 298.00' -- ET REBAR' USO mI STAMPED 'LS 22338" \ 1 SBB03'090E\ \\\\ 58446 Sq. Ft. 67'97/ \ 1.342 acres - / \ \ / 3 \ \ / e \\ ` z 1 1 \ \ 3 \ N8603.09'61 g \ 70000' \ \ 'I§ SBBA3'09'E v `)A-17,r-1 \ \ \,'R 14540' :s3 /-AI\�L_L. L� \ \ \ o \ \ II.WETLAND \ \ \ BUFFER o EDGE Of \25,0 w WETLA NO?---11 E ` I v X /v\ 1 r1 �) 15' SEWER EASEMENT v PEC. NO.8509260BB1/ 2 i ig 1 1 8609111674li 1 ) EAST LINE OF THE WEST I/O 1 I OF THE NORTHEAST 1/4 OF THE NORTHWEST 1/4 OF THE 11 i 2 NORTHWEST 1/4 OF SECTION I ) 201867 Sq. FE. / / 4,634 acres \\ I / ��` \ I ( ii I \ • \ \ \ _ S88'03'09'E 298.00'' \ \ \ ' I \ \ \ \ \ \ \\ \\ \\ /1 \\ 0 60 120 \ N''N I \\\\ REBAR AND CAP 1i \\\ \) SCALE STAMPED 'LS 22338'\ S.\ 1//, /1 1 \ / I I I RERAN EO LCAP 2338' 1'' = 6 0' S88'09'46'E 647.65' ` •/ SOUTH LINE OF THE NORTH 1/2 OF THE NORTHWEST 1/4 OF SECTION 15 •Centre 33701 9th Avenue South „9SIO 0516 �1 N E'44,0,SLga 0 Federal Way, WA 98003 NW—NW 15, T23N, R5E, WM 20„0.,4 S 41% }� (253) 661-1901 SUHYET FOR _,.,10:::,,r` Pointe Ribera / Balko Enterprises 8 IT `* 16400 Southcenter Parkway, Suite 308ta s q/,21378Ep Qom•' O Surveying Seattle. WA 98188-3302 `lpF,sl51E y0 DRAIN Bl`. CHECIGO BY: ta BEs WOOd6 s woods KING COUNTY, WASHI ON DATE Aug. 2, 2001 1O9 9S. 1839 ID ""1:. Zoo' 1014 1" - 60' BRAYING NAYS 5839 i A SHEET 2 OF ,i.—_,.... • • • I " " PRELIMINARY ACCESS PLAN E.,).x,x.•,�E ) IF•J)..JtSx.'tout.x� 2� Ii. �rE x a ie .r E1 �' I r.x x»xc „ r.. aaE�. I Q. NORTHEAST 4th STREET `.mac rI"°� a Z"°' ..3.31.4, s �oz�i ers."i " IE.uo. ";.x ,, wo aurtm k.. ssu .c S.._,� . a,w- --Sx •a - 9e t— — — — e Evr. .n . :./wx EJwFs�SEE �rKa.�, a. u l — µxE„.w w CONCRETE �KI r-- II - caEo \�—_ E > 7�4f >x �t/ �_> ru�a . NEM om.xE o� " \ — / Jr �� .r -....___,,..._v—...,1,....,,+.__191 �;•r_raNEj .Ev onrzEl (\\‘, 1-_ ,:1--=--- _ -c+�r-may,! `fix .U: I\lf �'�i1�� . ) _u: ......_ .'"r""—"Ir, , m \ .....� IL; �.s•., • J v/ art,7q r t ..�..: a L nm d. w .x kC 1L_ // )2.,,,,,,,n,“,. 3 m_�eB° xmE a \ \I ;-\ i1M"'q;'.t• n —�- 'I a°a,•:x.;n �/ \'' //,4— ,, i ;14A:4 ..ns;.. �Id `•�:� .ti :� ox ,`J', `I, 11 '/ / is , s�' i • _ ....%AI IS`-:IfelE" �T211,0 OP.0 , I / � ::::. 4z.:.:> I r ^\. ' r'm 1�°:as,• ' v-`ivi)i° 1 1, `t \ ,,,,,it5iu//`( : \ ,'I i# .� j1 / \ // .i_,_ ' :rt.:ua {{ i� \ \ {VIII /I 1,, 10, -4'' \ ' 1:Jn`:n ,i3, • \ \ I/ (l I/ 1 I It— / \ 1 /• I — 71- JE.J J�l'a,in,n' \�.�`` I I /.� \1�./ I +`L`,_ I,;�--� �-1 I I• II:11—F __& ..„..r°..a.• w / / \ ill F?,:ISTI`:. x.-4^`- f e c. I j '11 I \ , I usL :Y� I `:POST OFs'lb�i� oYiixsroc",� `.r\• :' (i\ I :II \o\,_/ \ \ I I , -', I ,I. 9"(a'Nr xq \ /j\ \I\\ j (I.,'\ \ `\ I i:F - --_ _1.1 \ w \ If'.. E )e.7s a we s !`w,:xErF rI.rn.,E • r 1\LB' 1 l R:�'�M "- I (. _" a4II,a'0.04- ''h.-. . . I liro r. �a p Wit' •''-I. -I. I 7•:1 „x,,,E '�I \\\\11\ \') \t • \ \ \ \ \ \ �) iIi •i .,r�: I t I I 111 \ \ \I 11-' ��-.4 '. .."' �! i— '. 11 ur se°n•" `/ —-‘,‘I III Y i \ \IMi u .L— '.I--F- \ —11�h i :: Q, IE.J9)IJIE'WE x[) Ix JI/ ILr 1 \ 1 / .•\ i� \ ti-1 E 31 • _-...._. / // /f\ I I / 1 \ \ II\E I ST' .IIS %'''h'—'\ 'T \ Ii 1 �\� ,.-U \\\\'\ \\ \ \\ / I \ / l \ \ ++.ilII I \l,,... '1i 1 L,1:'41.4•ss!'%l 1 3 I X K.,. s N I I hl 4• `\\\ \ \\\ I•, �In I / /' i -, 1°.. g pp qq 1 ��\ \ ! I 9 4 `� a'3'.\ •.„...I; �' ;.„,„\I",,„,..,,,,,,,_,,,,\ Qs•.c, @urtn.—�J� / ,( \ I i .:�'_ '. \ \ / I` - 9' Q, 1 \'. \ . L \ III 1 . I. I E 4 I - a0 1 . ., ,+ • a=_ \ f\\ ,'a l'''/ r„ .wo y�FE.. Ilh • 9 a SII/I 0,0k\\ \\ o \\ \ F / \ 1 , .I .�,L.__ _ _` r__� r_ • :o• Eon.o.,aw l v' \`�fI`t%, o \\ \ \1 \ \•.y, .,.. b -. *, \ `\ \ .„ t ..- °—= mmw aunurc srx,n•x. 1, \Y. \ � / �.\ I. --��`_311 Evmwonwwnawa uwnc \ •\ \\ \\ \\ \\\., \\`\ /�µ o E iy°iia+ y µ'I�� is +t •+,µ+� 4mA:° I A MS.ME ROW „✓ �\ , \\ \ \\:I\\ \ \ o Y I'\+�sy sEww.w E I,avE,µ'•" \iµ� I �►. "", + "--– ...“.“.4 COSMO, PPM.« (1'3 I•\ \ I\ \� \ I{ • xM \ b I,\, �: /...v ", At N N li a Ennwa IT.I CA. I•/' • * ' 7 I \ \ .._„2.,—"°°T III I\. \w, I • I ••••4.k.—Ig. . / ' mYi gi • P.O. .EluExa. I :l \ b r..J�c \C > \ \. N \ l �µ w o'` I mama rmE.u,a now :iamc°:'tis ar\I_ µ *•\\ \ \ \ \, \p��—� `'/I R.wIOM\\\ '' \ \ \ .. g�N" �'rr, "i nnro,m•wwr r,s[slExr I -—+ '-\= \=�ino�� 715w \/'.h0� II 1.I I I'I /----:; °_�E1 �°_.....1.,,,,m___4/•,.......7_.�\/�}-rte /y /: _ anvmm cman / •sn:.mew=wxcmE r.rtrt 1 \ I \\ : "omI\1 I � mouz „s n°.w^ °_ , lib y\\+v+ ----=sx cosmos ` \ ! run a..sssi. mLLI. \\ . \\ ,i o �co+' • n..\moao.\n.e\r,+'m'°°av,.e°.,°na. o.l./,h.,n/o./xooz w1 s.°I.L.o.•°e..m.x,.L n,.e-az,n,.e-*.ns.e-,. • • • • • • • attire by Design • = — } ,, I i,' 11114 \, uS88.03'69" \\ , -,, ,4,I 11 i --- ,,,.N..d- '9• **404%4' \\I\ L.V I i1i'. ' %'/ I 5�V;80;80w''vm - `,\ 11 I II P .•'-: 1 tit �L.✓11A%`Ir,`4 WE0 J/0M a, i-."'8--'- ' L O' ` ' II ', ;1111 1,,'fr#ij- ILLE0.26pr1 §- , -v I ; - ;' �•X111 1I��1� 1 ' -I \.1 `'1 1 I I I UI,Lir KEY MAP WETLAND/BUFFER OELINIATICN \\\�'� :,,,,•,,,,,<`-Z.� l,,•1-k4( .- AI �\` , ` I I I 1 SYMBOL PLANTING DENSITIES SPECIFIC AREA QUANTITIES IIIIi L to-l4 ,BOUNDARY •O\\ _ \` I I q AVPRORED'0U11F TREES33 PER ACRE PCO'D TREES.13 .>� \ I�'\\1\\ /, /�I�� '\1 ` \\\ ' I 1 ( I .,..-E__ t' ❑ _ / GROx 00 SHRUBS PER ACRE RCO'D SHRUBB b [i 1\1\\/` I-�- �\1 \\I\, ` I I I {• y., J i'i��F „STORM WEnANo \ II\ 6,` � ' « 1 LL c _ a PESTDR[D NE14ND ' I y 46.// I�,1 ' I " t` . Fgfil PPROK I �t PER ACRE RE0'U IRE.•Q 17'71 amNI -I1 osw \ d ; y 0 ►6-Qlwi BS Pu ACRE ATO0 S...S.136 4-a P',44 4pa1r:• N I a a`m //� '�APPROX 300 LUER[Nl PER CRL RCO'D fuf0.GCNis 64 '1_-1- . \*464*�'`',A4.I♦N \\\\-�--� �1 1 f1• O a: O w / CPEAICO MI cADON wLRANo: N[W WEIUND a NEW.11AND•C i ,,,►►►�� 1 W14_I��`(,4� /NaI- /�,•a a+ I=m°0, / PPROX 3�TPpEBPpP ACRO RED'0 TREES 30 R(0'D TREES 16 YVLOCN � / 5�8-Or."'e - 1 y / vR PER ACRE REV,SHRUBS•60 0:SHRUBS•5• I • �':".47;4.4* \' g `' AMOY O. EMMERT'S PER 'RE REO:CMERGENIS•30 RE0'0 CMEROENTS•Ir 5' N.• F R t \( S:DI A P W. cR[ATro BU!lE0.E ARIA BII!!FR BI !F[R c1 AR =560\GF \` :�Q *, y-__�_-If I yL- a U i X.';ON 10.RUB5 PER E P[0'D TREES N RCO'D TREES•38 EATS BU!!R'01'\ , \; ^ j `b744►4►044 \ A.m. sA ER ACRE REO:SHRUBS•103 RUN SHRUBS•64 RECAA0E OE SLOPES LO IE' �, �,�,,,�./ CREATED wERANO / \ �,dme,�� \\ \ I o • \ Pagp ,l\ `�,I' • // ,' .3, -ver, ,I` `.ENHANCED BWRR ` ` '1 g\ OI OI illi CRCAtEO X AV"M".v� "/�/ I�.$,OI��i� ''''-'1"°1''''' ETLAND H' •1-,-// / '�''•.`r$.40,i ENHANCED WETLAND\SI \ I\\ REVISIONS: I' 4"/ '4.44.4.4.,�IA' - .361.' , `, Z /� ll4y„N$4.4 I , , �a-::W / . N N 4b4- jf •, OIC.. t- Nop-- -eoo--,..f,�� .416/ '� ►��/ \ Loa Tn. \\ 11 I\I \ -t.. / I -A �� 'II s � ��'�.- em'. -- a\. \ I 11 FE-'3� \` DRAWWOBSUEO FOR: ',..T.•'.:._:::�__- ' _ AI®• \, ��I I'�I Y _�••,'4 K �,$',I EHAND BUFFER / „IV /` I 111 « R Y• AGENCY 1 11..' I.-'_� ,: weCIA,1'7� I1 ii- q1 ` �\�`'v„-=-- \ I .�.asEa-.�\\ : \\O - 1 \ I 11 \�. « REVIEW IF.:- �1 % .1ter. = - \\`,\,,\`\I Ex.wE4i`(p,NO BOUNDARY , i \I" Ikwre u.RC'N as.7Do2'i UIII•" y \ - ) \I ,\,ISI III , \ 11 I S \I1 ,4, 1:::yI I' ,\,111111 1`\ 1 30 \,li''' ��l ,, 1 i ll �' ,0,1 11'1 Q `\ I -"�`\— 'II • '\* I : ti%.W`�.. \\� i 4I I, u i' -- ®/,MIK � \\\\/' ,y/. - - - - \ 6 zap. V �l I aV VL � ) b +jj�I.�- �II_I" al;•''+r raEmC • i 'I S9 vi ;\�\ \�\\\ y\ II • SIK 1 ' . '''RV �R '%/ :1.:'Ele I 1 \\ ;t,,,,o ..L\' \ ��\q\ 1 i...* .• « U , sun Of _ I� 's% �_I111 ill Ikilt, .A in � �' Ili \1G\ a�j(�f, '\ ``\ \� \\ '� I” K{'« .6R 1101MEo`�' • \J\\ P lkkb o \\ I I it ' •IT 1ANDSCMB MCHRECT N � , ', �� ti f II MDo- \`I\\\. '` \. \l/// I\ o '\ «4\ \-\'�� I I 1 IIll' --s-4-1.,\./ /S lL-1Kr— (jl.';P, �I ).. , I . Y'\ /, \, IG,NBRDE DwEN9 b 1 \ \ \ ; ICERTIMME ND.6RR +,f-/Et .,. @ FmAu .r,. \ V/ \\v‘ `� \\\ \ \\ $1 \\I \`., �:'!'t\OQ \ 111'11I R•t Y111r '_'...- I'• j `l,\V Y:\ Y('// \ \ \\ \ \ i 1\ L PROJECT NO.: OZ�1L7fGY _ ,'-';...,l'ie P \� JN 1 •- ) CREATED DUERP c1 : / x �� / \\ \\ \ \ \\ \ I II -1 • FEENAME1.2o,1•E:Eio.J. l VA,,,t, \NS f, l 3. s.. ti•• •..',21..'. ACCOMODATE NEW GRADE SIOE SLOPES TO • „,. .),//),,,//y 2,// // O\ \ �,;y.:\\\ ( PARTS: aWt I;'.:-pRi`T? .�• '`�r E.......I J I ��y.....•.:/ ... xERAND AREA 1 y / // - �\ Q;xaAI \A 'TIO l '.;4 y.. A..r;�. i F.UA'�A :...( / ' . r jr> -;aBO- III i\\ a�Lcuner: Kio a� ,1 � 1 /� -� I \I II I PLOT SCALE: 1.1 =1,k,'a •R'...�. [HEATED ` / \ �- DRAWwG1CAlEt:aaBl-m 111, •',�VI '�>” "'a,-•'.' / AETIAND'c' 1u• .!":nnka� nmesm: ".TI�oaE,.t:: T, -M- •�y� •-�_ I' J - I .... `16�_7_- -`_Ex.DRAdGE SWAL '` 1 I(�i:,(�fDa Mu) 1�.3o'-oq _ !ti!' •AI(IIT E Foo'-0'• - -"�- ---�'-- -A.-1a,--. DRAWING COMENIS OVERALL SITE MAP / - '90 a o' ;' 1. \, COMPENSATORY KEYMAP s8aos3sse1T �•;. U 7 1 __ r /- \-�,�t 11111 i WETLAND MITIGATION scuE.1.Ew•-o I, =-- , -__C . ,, ,x,. I - COVER SHEET STREAM, WETLAND AND BUFFER • N DRAwwGNG.: KEYMAP 4111 /I -1 • SCALE:1'•JO'-0' L L a 3 0 • 0 0 0 . • • - ',, 1 \ \ 711 \ / ./, i I WETLAND/BUFFER HYOROSEED MIXTURES ;; / I IIt 11 ; ; WETLAND MITIGATION Nature Desi n _ WETLAND AREA SOIL MOISTURE CONDITIONS by. P, III 1I PLANT LEGEND TRACT 4 -,..,-;,-,-.1..,...1,.',,-,-- u$88-03'b9 \` \ I I III I l r COMMON NAME SCIENTIFIC NAME PERCENT BY WEIONT \/\ L.v 1 /�r 1 // A n a WETLAND/BUFFER TREES ��• �;' _ wMINO A i \ I I =OXTAIL A�'ep�c.w.y.niwlRty. eoi SYMBOL OTY DESCRIPTION SIZE /I I I I _ UPLAND BUFFER AREA SOIL MOISTURE CONOIPONS V.q;'.e�`'e1,„.7_ _ \wEtw+D1� /I / ”S.'� 1 / �• T i I 15 Acer macro h I 5•HT.MIN. 257.480.808] I li II 1/I.C,C EILL5Dw2b p 1 I Lc,: V 1 COMM.NAUC SCIENTIFIC NAPE PERCENT BT WIGHT P Num I .,,p,.,. \/// � 1 1 ® 81q Leal Maple 12'-16'O.C. S+'�"IlT:.'S5T8•••m ` ‘, 1// \I I 11 CNW�AL BCxiOPA55 Aye•tl•E.T.A tis •n•e.•s 1 H /1 I n rESN[ !•et a w,eamecw 27 Flaxlnua=lie 1'HT.MIN. (,,�o �\\t \ I • ;TAXARttanss dx ee• ® Oregon ash 10'-15'O.C. ,III �1 IAS *•' I �\ \ / 1 1 x RCD FESCUE feNuce ru4ro tea \' •e• Et// J O \ 1 APPLY AT THE RATE OF ISO les.PER00 A000 2 Picea ailchensis 5'HT,MIN. • 1• III» ` / 'Y\ /` ` REFER TO THE xCY MAP FOR M[nA110 AND UPLAND PLANTING AREAS. Silk°spruce t2'-15'O.C. //I O n/� 8X.W'EIUND\\ \\\ \ _ ISI\\J •••FFF 1 30UNBNtY .. 1 2 Populua lricnocarpa 'MT.MIN t\ / 011 1 ', \ \ 1 Black Cottonwootl 10•-15'O.C. ES �I\\\\s/ \1\�\\ \\ ` I DIAME20.TER AT 15 Prunus OmorgenaA 4'HT.MIN. \\I \L- `' l TOE.PM. `1, I \ I ® bitter cherry 10'-I6.O.C. y 11 '0, 14 1 \\\ I fesA 19 Pa°udolsu enzleall 5•HT.MIN. RR I I.,,(p.�i' •. raj. SI::•0 I `\ go m 1 w .�y \ 3' •\ I Douglas fir 12'-15'O.C. y �. Ps 0 1 yp11MR` ,n \ \ 28 Pyrus lust° pp< g1 HT.MIN. y '21 m I I. (,1.Iii 1 h� it,�A Western crabapple 5•-B'O.C. E0,4 C - - a R- „Il�y�y,/, P' \$it8-03.1••e I i 27 Solis silchenaia • 4'HT.MIN. °e o �I IIS" U r1. T-— • �\ 1501 4111) $ilk°willow 10'-IS•O.C. 0. �" CATED SIDE SLOPES �RRR,�1111113106"t• \ O ®0 ° N _i—� 18 TW<91°ln ol0d cedar 5'NT.'NIH. O 0. ~m PEGRnO[ DE sOPEs .Y' ^u' \ r, \ C CREATED A yy�rT \ \ (Z�® t \\\ .. 2 Populue Irozpitdes 5'HT,'18 p i n 'a 6 6 ' •i "- \ \I 2T7 Ot • \\\ ® Ou°4inq Aapen 12'-15'O.0 s 's; P:'' m T ® ExHANCED BUFFER\\\` U � -IIN, `oI<:'a^°e \ tines=iYn.:' 11.. �IIII 11 SP-IL,.I151: y`` - S 10 DOWNED LOG♦ 00il ` II IFII�II I Ilcn L /TREE J STUMPSL:y.n ®. \ \ �Z, I' 11"'11 1-0411�II-II- See oelaR See Det011 I7 U CI O \-` �II IIIII IIIII II 11K11� r e ,Ellv 111111 II II l llll.li�111itu..... ' • T[o / , nO`` ® Q - \\ ouuETER NT / �, WETLAND/BUFFER SHRUBS c.,®, ....e \ WNERAND'B' / —:°J.•»»��. t ,....„,,v,:}\ O O ® '` \ x1 `� SYMBOL OTY DESCRIPTION SIZE 0 " f�'' °. o .:,�� STUMP a ' : y LxHnxe o w:nAND 1 Q I .36 B! DIE:TYPICAL VERTICAL LARGE WOODY DEBRIS(LSO)FOR irci 2 1 1,''''' �i• °�f• O OO•q ®®°P\tYn� - 1 PLACEMENT IN NEILAND AND BUFFER AREAS. - 28 Ate!< nalum 2 CAL. <^ �1 11 ® mt; o• ° Vine Maple o 6'O.C. 40.--_-_ `` Wn',: ;; '1,,,, �® cal 1 MINIMUM 20'MIGIH 1{ B<rberis nervosa 1 CAL. "ADD--�`II\` \ 11. I I ID a Oregon Grope m 3'O.C. REVISIONS: - \S\4„ \1 / M. "-- �LW. et Cares oD'uDlo 4•plug O ��I\\\n „ I 1 /"' , II I lough edge O t'O.C. - i/ \``\`.\\.cq�R�`�, l' / \ I 1 \ x 1 carylua aornulo z GAL. - \ \\I, \ 1Ee1�A7�e�!`I' \1\ i /,I 1 \ 'R hoxelnul o a'O.c. 1 1 IA � J ® Oo Bo cornua alalan lora z cpL. I I� h rt•`� ��` -- / / _.. I' 11 - ... red osier dogwood o a o.c. • I\II I I/i A( •,\.t`W�ILAND BUFFER ,10° / I IId11LVRA=C1 IClCllAVIERVHAIICt1'1 III�I I IaICV=LMv.1 'SII 11�IICII 711`t11-11 O 14 Caulher°shallon '0 CAL. q I \\\\ \ \ _ �I #II u-u4B 11-- \\\\W\`tI EX wE1•DBouxoARY�+ IL'II II=iC II IhII SDlal _ -I \ u ' I WIN II-1111=II�IhIL- DRAWING ISSUED MR: - 1 \\'O \ ISIS xo-anMAR 1-11.-11 Ili=1R-II'-11FI I\I Iql I I I/�'\E� \ I LOG R b'ABOVE,001 COLLnR 11'-II V yaoaarpua c pi o w P (� \I 111111 I 7 \ "3B' II_IIIl==1IIILIGIf it l O 80 Pin°bark y t t O 1 O.C. AGENCY 1 NOTE:TYPICAL HORIZONTAL LARGE NUOOY DEBRIS(Z!OR Pllnnl h'• `\ � _ -1nelirn=n:-1s-, REVIEW ,ems III PLACEMENT IN WEPAND AND BUIlER APEAS(uAY USE ENTIRC' 1♦ Ribea aanguineum 2 C /1,':::',--„-- /T.�111��",(�O T' \\ /' 1 i;/�'�� _ _II NEC)1 . Rowerinq currant n \M•-,`gi\ an.� / \I, \ O 1 O.C. DATE MARCH 25.2002 ',-' �[, •\ \`E'C ,`' '\�'t '\ \1.S. \\\I\ Wm! LOG AND STUMP DETAILS O 1 Rosa gymnoaAAPO z c�L. �C..]] I ; I I\ ,s `\ Ts ` �0I.V .,\`\ \\ i\ wlltl m0 O 1 O.C. a`VMY` 1 \ 80 RUbus spec lob Ills 7 6461 'U`/ut \\% ' \' ' PI\�0,4t \\,\\\\ \\ © solmonDerry ....1E::. ►3 c. \ 6 40\\ I � 'r1 `� `` \\\\ ` 41 %P Z acutua1•plug1P Haraatem Bmruen oYo.c. 11 \ \\�I � . O \ `\' 41 S'1 STATE DF B l�"`� � I ` 1 \I\ Q prus mlcro<arpus 1•plug WASHINGTON $.R��. 'T T�R REGISTERED LANADD.'' \\ ��,Zit`�,yt'03' \ \\ Jm \ mall bulled bulrush 1 1'o.C. DS..AR.ITEaT 1 I \ °'yT`•�, N'Fr•��\ 4 'Q';\. 16 Sympnorlcarpoa albus 1 GAL I I • •'IKa:, '�� '` AAAA''''�@`' \ \ 1 anphorIcy /0 4'O.C. r'• / / �� ,1 . \p\\• `\ \ \ I 4 Rubua parol/torus 1 GAL GR CREATEDE YDPES I I /.:� aye' *N� Oo l \\ \\\\ \ / y CERTIFICATE NO.w: This eeb<rc O a•O.C. 1/14a11.11,..1 TO ACCOMODATE NEED E. R' TS...* I KR..R..AREA I r •'/�T ^ O\ \\ `::4t.��`\ 1 � [aeTV1i, �±_.'.-A x� q� \\ .•.:1L: 'A81 PROJECINO: 0220 CPCAIEO 'oa' �1 0 .D e '�p,J p • \--, RIE NAME: 220L1-1 NET AxD'C' I L— �'•�A '�O� y..• 1 _'N'_ �.ji,.�, .�01�•,_ I �' \ %REPS: CINL 11'°.• =�i --�'1 CHECKEDRAWN : KLO I'J-��\ [! -. - EX.ORANGE SWALE CHECKED BY; KLO - R - __ -_� _'P`d --�, PLOTSGIF: 1:1 390 d• �;; STREAM, WETLAND AND BUFFER SECTION DRAWING SCALES:1•m30'-0• P A 06 ENLARGEMENT f< I'.1o_0 ---:: -*-5'-.'"L'": 2-0'-:.''' SCALE:I•N10'-0• DRAWING CONTENTS I - �_-- CREATED BUFFER • STREAM, WETLAND AND BUFFER PLANTING DETAIL N ENLARGED PLACAING' CREATED WETLAND ENHANCED ENHANCED PLAN&TYPICAL ENLARGEMENT 4 \J WETLAND WETLAND eETLAN0 BUFFER +1 SECTION , SCALE 1•N10'-0• 1111, vl DRAWING NO.: L1 . 2 _ • 2 OP 3 ' E6 - 1 . 123N R5E W 1/2 ' z St. r '— IT 4th St ------ � , , ______L-111,- R,`�b _� . -�,S I r'_-- ----77-77-7- • __ --.6S CS---- 0__j1.0:- NE 3rd Pl_ : /efiii ' R-10(P) ; R-8 • 1J ' — - C1-11R-8 .... ._R_4_61_ _l co SE 132nd -11---8--:.- ------J.- -, ‘'I /---All /--- --\e- .._, FIR--8 1-,- --T. i 1 --Du .. ..._ .7)._. 6 I r a, _1 I / Ce `\---, ,--:Ei§ . _, __= - - f. ap W i I •o -- 8� � \ / C �� U1 IM RT8 •E .'4•-i � I ! H — 1 ----- \ ti \-0-N.. ___ 0 I � . i -I � ) `` ' .-\61\'�n \y 's \7'\- \ \ -\-- --' (_;________:._____J--)-- \ -- R-8 /1 t 141st S5E � j_.___ 1 SE 142nd St. U) RC(P) 1 -71-, 7 Ss 1 :(P) 0\• ?/ I G6 - 22 T23N R5E W 1/2 G�` Y 4 Eao to F 6 '{' ZONING ----Renton tltty Limit/ t® '�, e $ PB/PW TECHNICAL SERVICES � o �� 15 T23N R5E W 1/2 5315 4 t CITY OF RENTON COUNCIL AGENDA BILL .._,-7. AI#: f '' ' d •Submitting Data: Community & Economic For Agenda of: April 14, 2008 l Development Dept/Div/Board.. Development Services Division Staff Contact Neil Watts, x-7218 Agenda Status Consent X Subject: Public Hearing.. Release of Restrictive Covenants for 6,000 Square Correspondence.. Foot Lots Ordinance Resolution Old Business Exhibits: New Business Issue Paper Study Sessions Information Recommended Action: Approvals: Refer to Planning & Development Committee Legal Dept iii Finance Dept Other Fiscal Impact: Expenditure Required... Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project.. SUMMARY OF ACTION: Many subdivisions in the Highlands and Kennydale neighborhoods of Renton were originally platted while in unincorporated King County, and ownership limited to no less than 6,000 square feet for suburban S-2 use, with a minimum lot width of 60 feet. Most of these properties are now zoned for R-8 development standards, which allow for 5,000 square foot lot sizes and a 50-foot minimum lot width. The outdated restrictive covenants prevent property owners from exercising the same property rights as owners of similarly zoned properties, and also impede development to the standards expected with Council approval of current zoning and development standards. With the Council's approval, Renton Policy 400-13 establishes a procedure to formally remove restrictive covenants placed upon properties within the City of Renton. STAFF RECOMMENDATION: Approve the release of the restrictive covenants placed by King County on older plats restricting ellot size and width to standards different than current City zoning standards for the property. H:/Division.s/Develop.Ser/Admin/Temporary Docs/Lot Sizes—Agenda Bill.doc 1 • ti`sY O� DEPARTMENT OF COMMUNITY � ® � AND ECONOMIC DEVELOPMENT �‘NTO MEMORANDUM DATE: April 2, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: _Denis Law, Mayor r'ROM: Alex Pietsch, Administrator STAFF CONTACT: Neil Watts,Development Services Director, x-7218 SUBJECT: Release of Restrictive Covenants for 6,000 Square Foot Lots ISSUE: Should the City of Renton release the restrictive covenants placed by King County on plats restricting lot size and width to standards different from today's zoning • development standards? RECOMMENDATION: Staff recommends that Council approve the release of the restrictive covenants placed by King County on older plats restricting lot size and width to standards different than current City zoning standards for the property. BACKGROUND SUMMARY: Many subdivisions in the Highlands and Kennydale neighborhoods of Renton were originally platted while in unincorporated King County. During the 1950's and early 1960's it was common practice to place a zoning-related restriction on the face of the plat, limiting lots to the size and width allowed by the zoning in place at the time. A typical example of this restriction reads as follows: "No lot or portion of a lot shall be divided and sold or resold or ownership changed or transferred whereby the ownership of any portion of this plat shall be less than 6,000 square feet for suburban S-2 use, with a minimum lot width of 60 feet." This restriction is a typical example of the restriction placed on most, if not all, of the plats approved in King County in this era. It noted the zoning in place at the time the • subdivision was approved, and stated the lots within the subdivision could not be divided any smaller than that specific zoning would allow. This restriction would have been H:/Division.s/Develop.ser/Admin/Temporary Docs/Lot Sizes—Issue Paper.doc { 6,000 Square Foot Lots Page 2 of 2 April 2,2008 • enforceable under the then current code. However, over the decades the neighborhoods and region have changed, along with the zoning for these properties. Most of these properties are now zoned for R-8 development standards, which allow for 5,000 square foot lot sizes and a 50-foot minimum lot width. It is the position of King County for similar plats still in unincorporated King County that these old restrictions cannot be enforced as they are superseded with the development standards in effect today. This form of restrictive covenant exists on many existing subdivisions in the north part of Renton. Staff is recommending that Council approve the blanket release of this outdated covenant on all properties with this type of restrictive covenant which limits lots to development standards of old zoning designations which have been replaced over the years with new zoning. The blanket release would provide for greater consistency for project reviews than releasing this type of restrictive covenant on a case by case basis over a many year time frame. Renton Policy 400-13 establishes a procedure to formally remove restrictive covenants placed upon properties within the City of Renton. Restrictive covenants may be removed with Council approval upon finding that due to changes in circumstances the covenant has become undesirable from the City's standpoint or that the covenants are duly burdensome on the property owner. In the case of these old restrictive covenants, the criteria for approval of releasing the • covenants is met. The change in comprehensive plan designation and zoning of the properties constitutes a change in circumstance. The outdated restrictive covenants prevent the properties from being developed to the standards anticipated with the Council's approval of current zoning and development standards. The application of these outdated restrictions prevent the affected property owners from exercising the same property rights as owners of similarly zoned properties. It is staff's recommendation that Council approve the blanket release of these restrictions, and direct staff to ignore these outdated restrictions when reviewing land use applications for these affected properties. • 2 CITY OF RENTON COUNCIL AGENDA BILL AI#: '*----7 .2 • Submitting Data: Public Works For Agenda of: Dept/Div/Board.. Transportation Systems April 14, 2008 Staff Contact Nathan Jones, ext. 7217 Agenda Status Consent X Subject: Public Hearing.. - Correspondence.. King County Metro/City of Renton/City of Kent Ordinance Transit Now Route 153 Transit Service Partnership Resolution X Old Business Exhibits: New Business X Issue Paper Study Sessions Resolution Information KC Metro Route 153 Partnership Agreement Recommended Action: Approvals: Legal Dept X Refer to Transportation Committee Finance Dept Fiscal Impact: (317.12706) Expenditure Required... $72,310 (2008) Transfer/Amendment Amount Budgeted $225,000 (2008)* Revenue Generated Total Project Budget $72,310 (2008) City Share Total Project.. $72,310 (2008) • SUMMARY OF ACTION: Description: Beginning in September 2008, this agreement provides funding to extend weekday 30-minute service between the hours of 9:00 a.m. to 3:00 p.m. by adding 12 additional roundtrips to serve larger Renton employment sites located along Lind Avenue SW. King County Council authorized its portion of the funding on March 25, 2008, and the City of Kent will authorize its portion on April 15, 2008. Benefits: This proposal addresses the need for midday, off-peak service along East Valley Road in Kent and Lind Avenue SW in Renton. By adding 3,900 annual platform hours, this route will maintain 30-minute service throughout the day and gain 25 riders per hour and 95,570 riders annually by the fifth year of the partnership. Total Cost (Year 1): $433,865 (2/3 KC Metro + 1/6 Renton + 1/6 Kent). Partner(s) Portion of Cost (Year 1): $144,620 ($72,310 Renton + $72,310 Kent). The agreement is for five years so the total cost to Renton is approximately $370,000. * Budget note: $225,000 per year for the Transit Program (project 12706)preserves $75,000 per year specifically for the Route 153 partnership. STAFF RECOMMENDATION: • Consider the subject enhancements to Route 153, and authorize the Mayor and City Clerk to enter into the KC Metro Route 153 Partnership Agreement with King County Metro Transit and the City of Kent. H:\Division.s\TRANSPOR.TAT\PLANNING\Nathan Jones\KC_METRO\transit_now\agenda_bill_materials\TN_153_AGENDA BILL.doc `SY o PUBLIC WORKS DEPARTMENT 'LL MEMORANDUM DATE: April 14, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: j f Denis Law, Mayor FROM: Gregg Zimmerman, dministrator STAFF CONTACT: Nathan Jones, Transportation Planning (extension 7217) SUBJECT: King County Metro/City of Renton/City of Kent Transit Now Route 153 Transit Service Partnership ISSUE: Should Council authorize the Mayor and City Clerk to enter into an agreement with King County (KC) Metro Transit and the City of Kent to enhance transit services on KC Metro • Route 153? RECOMMENDATION: Consider the subject enhancements to Route 153, and authorize the Mayor and City Clerk to enter into the KC Metro Route 153 Partnership Agreement with King County Metro Transit and the City of Kent. BACKGROUND: The voter-approved KC Metro Transit Now program provides funding for partnerships to expand transit routes in communities via financial partnerships between public and/or private entities and KC Metro. KC Metro will provide funding for service hour increases at a 2:1 ratio. Transit Now requires partners commit to a minimum of$100,000 per year for five years for existing route service expansion and $200,000 per year for five years for new route development. The Metro Transit Route 153 is a peak-hour weekday only service connecting Downtown Renton and Downtown Kent. A map showing the route is attached. Service runs about every 30 minutes between 6:00 and 8:30 a.m. and 2:45 to 6:00 p.m. Currently,there are 460 daily • riders (116,840/year) and annual baseline platform service hours are 4,775. Marcie Palmer,Council President Members of the Renton City Council Page 2 of 2 April 14,2008 • In order to provide better Route 153 service, the City of Renton,jointly with the City of Kent, submitted a proposal for the Transit Now partnership program in late 2007 to pursue service improvements. Beginning in September 2008,this proposal extends weekday 30-minute service between the hours of 9:00 a.m. and 3:00 p.m. by adding 12 new roundtrips (adding 3,900 annual platform hours). This service enhancement will provide employees of larger Renton employers' sites located along Lind Avenue SW such as Wizards of the Coast, Classmates.com, Honeywell, and others, with a midday transit connection with 30-minute service throughout the day. It is estimated this proposal will yield 25 riders per hour and 95,570 new riders annually by the fifth year. The King County Council authorized its portion of the funding on March 25, 2008, and the City of Kent will authorize its portion on April 15, 2008. The total cost for the first year of the service will be $433,865. KC Metro will cover two-thirds of this cost with the remaining third, $144,620, to be split between Renton and Kent with each paying $72,310 for 2008-2009. The agreement is for five years so the total cost to Renton is approximately$370,000. • There is $225,000 in the Transit Program 2008 budget. $150,000 is preserved specifically for a future partnership (estimated to initiate in 2010) with KC Metro for the Renton circulator Route 110 leaving $75,000 for the Route 153 partnership. The partnership for Route 110 is conditioned upon a separate subsequent agreement to the partnership agreement for the Route 153. Attachment: 1 map cc: Peter Hahn,Deputy PW Administrator—Transportation Jim Seitz,Transportation Planning&Programming Supervisor Nathan Jones,Transportation Planning Project Manager Connie Brundage,Transportation Administrative Secretary • h:\divi si on.s\tran spor.tat\planning\nathan j ones\kc_metro\transit_now\agenda_bi I l_materi al s\tn_153_issuepaper.doc • CITY OF RENTON, WASHINGTON RESOLUTION NO. A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING THE MAYOR AND CITY CLERK TO EXECUTE THE TRANSIT SERVICE DIRECT FINANCIAL PARTNERSHIP AGREEMENT BY AND BETWEEN KING COUNTY AND THE CITIES OF RENTON AND KENT, WASHINGTON. WHEREAS, in September 2006, the King County Council adopted Ordinance 15582, the Transit Now ordinance, directing the submission of a proposition to King County voters to fix and impose an additional sales and use tax of one-tenth of one percent to fund expansion of the King County Metro public transportation system and a variety of transit service improvements; and WHEREAS, the Transit Now ordinance identified a number of transit service measures • to be implemented using the one-tenth of one percent sales and use tax collected through Transit Now that focus on capital, operating, and maintenance improvements that are expected to expand and improve bus service on local streets and arterials within King County; and WHEREAS, mutually beneficial contractual arrangements with other public and private entities ("service partnerships") that leverage public and private funds to provide both new and better bus service to cities and major employers is one of four key strategies (the "Service Partnership Program") identified in the Transit Now proposition approved by King County voters in the general election on November 7, 2006; and WHEREAS, the Service Partnership Program is also designed and intended to support the service development objectives and financial strategies of the Six-Year Transit Development Plan for 2002-2007, and its successor, the Ten-Year Strategic Plan for Public Transportation • 2007-2016; and 1 RESOLUTION NO. WHEREAS, the Ten-Year Strategic Plan for Public Transportation 2007-2016 adopted 41) by King County Council November 13, 2007 Strategy IM-3 exempts service partnerships, schedule maintenance, contracted services or partnership agreements from subarea allocation and reduction requirements; and WHEREAS, the City of Renton has submitted an application for a direct financial partnership for transit service and has met the criteria established by the County for awarding such partnerships; and WHEREAS, the proposal submitted by the City of Renton has been deemed to show a potential gain in ridership; and WHEREAS, the proposal submitted by the City of Renton has been approved by the King County Council; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, • WASHINGTON, DOES RESOLVE AS FOLLOWS: SECTION I. The above findings are true and correct in all respects. SECTION II. The Mayor and City Clerk are hereby authorized to execute the Transit Service Direct Financial Partnership Agreement By and Between King County and the Cities of Renton and Kent, Washington. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk • 2 RESOLUTION NO. • APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor Approved as to form: Lawrence J. Warren, City Attorney RES.1332:3/27/08:scr 110 I • • 3 TRANSIT SERVICE DIRECT FINANCIAL PARTNERSHIP AGREEMENT BY AND BETWEEN • KING COUNTY AND THE CITIES OF RENTON AND KENT,WASHINGTON THIS TRANSIT SERVICE DIRECT FINANCIAL PARTNERSHIP AGREEMENT(the "Agreement")is made by and between King County,a political subdivision of the State of Washington and home rule charter county with broad powers to provide public transportation within the County's geographic boundaries, by and through the King County Department of Transportation,Metro Transit Division(the"County" or"Metro Transit')and the cities of Renton and Kent(both Washington municipal corporations)("Service Partner,"whether one entity or multiple entities),all of which entities may be referred to hereinafter individually as"Party"or collectively as the"Parties." WHEREAS,in September 2006 the King County Council adopted Ordinance 15582,the Transit Now ordinance,directing the submission of a proposition to King County voters to fix and impose an additional sales and use tax of one-tenth of one percent to fund expansion of the King County Metro public transportation system and a variety of transit service improvements;and WHEREAS,the Transit Now ordinance identified a number of transit service measures to be implemented using the one-tenth of one percent sales and use tax collected through Transit Now that focus on capital, operating,and maintenance improvements that are expected to expand and improve bus service on Iocal streets and arterials within King County;and WHEREAS,mutually beneficial contractual arrangements with other public and private entities("service partnerships")that leverage public and private funds to provide both new and better bus service to cities and major employers is one of four key strategies(the"Service Partnership Program")identified in the Transit Now proposition approved by King County voters in the general election on November 7,2006;and WHEREAS,the Service Partnership Program is also designed and intended to support the service • development objectives and financial strategies of the Six-Year Transit Development Plan for 2002-2007, and its successor,the Ten-Year Strategic Plan for Public Transportation 2007-2016; WHEREAS,the Ten-Year Strategic Plan for Public Transportation 2007—2016 adopted by the King County Council November 13,2007 Strategy IM-3 exempts service partnerships,schedule maintenance, contracted services or partnership agreements from subarea allocation and reduction requirements;and WHEREAS,Service Partner has submitted an application for a direct financial partnership for transit service and has met the criteria established by the County for awarding such partnerships;and WHEREAS,the proposal submitted by Service Partner has been deemed to show a potential gain in ridership;and WHEREAS,the proposal submitted by Service Partner has been approved by the King County Council, NOW,THEREFORE,IN CONSIDERATION OF THE MUTUAL PROMISES,COVENANTS AND AGREEMENTS SET FORTH HEREIN,AND FOR OTHER GOOD AND VALUABLE CONSIDERATION, THE RECEIPT AND SUFFICIENCY OF WHICH ARE HEREBY ACKNOWLEDGED BY THE PARTIES, THE PARTIES HEREBY AGREE AS FOLLOWS: 1. PURPOSE OF AGREEMENT DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 1 of 10 111 mutuallybeneficial contractual relationshipfor enhanced The purpose of this Agreement is to enter into a transit services consistent with the goals and directives of the Transit Now ordinance and initiative as authorized by King County Council Ordinance 15582 (approved in September 2006) and passed by the voters of King County as Transit Now in the general election on November 7,2006 to leverage sustainable local resources for transit service and to increase transit ridership. This Agreement establishes the responsibilities of the Parties in relation to the transit service partnership, including methods for financing,implementing,monitoring,improving and terminating the partnership. 2. COUNTY'S RESPONSIBILITIES 2,1 The County will provide transit service enhancements in accordance with the service specifications set forth in Attachment A, which is incorporated herein and made a part of this Agreement by this reference, pursuant to which the County and Service Partner will share the fully allocated cost of the increased service hours at a rate of not more than two-thirds from County funds to not less than one-third from Partner funds (actual contribution specified in Attachment A). Fully allocated costs include the cost of fuel,maintenance, driver wages, service supervision, infrastructure maintenance, revenue collection, scheduling, rider information, data analysis;and administrative and management costs. The County's cost allocation model will be used to determine the Service Partner's contribution. The County will manage the service in accordance with its regular procedures and as may be further specified in this Agreement. The Parties understand and agree that, notwithstanding Service Partner's fmancial contribution, the transit service referenced herein will be open to the general public. 2.2 The County will include the new transit service enhancements provided for under this Agreement in its annual route performance monitoring. Enhanced transit service provided for via service partnerships will be expected to perform at or above the subarea average for its particular type of service in at least three of the four standard indicators monitored in Metro's annual Route Performance Report: a) Rides per revenue hour; b) The ratio of fare revenue to operating expense; c) Passenger miles per revenue hour;and d) Passenger miles divided by platform miles. 2.3 More specific benchmarks applicable to the enhanced transit service provided for herein are set forth in Attachment A. Three(3)years after implementation of the enhanced transit service provided for herein and annually thereafter,the County will make a determination as to the productivity and viability of the service. The County will notify Service Partner of its assessment of the service's productivity,performance,and ongoing viability. If the County deems that changes can be made to improve the service,the County and Service Partner will discuss possible modifications and may agree on any decisions to modify the service enhancements provided for herein,provided,however,that any such modifications shall be consistent with the requirements set forth in KCC 28.94.020(BX2). After consultation with Service Partner,if the County determines that the enhanced service provided for herein is not viable based upon performance,and proposed changes are insufficient to boost productivity beyond a minimum threshold as may be established and the Parties cannot agree on a substitute investment on a different route or a different corridor,the County will notify Service Partner of its intention to terminate the Agreement. 3. SERVICE PARTNER'S RESPONSIBILITIES 3.1 Monetary Contributions. Service Partner will contribute,via payment of billings from the County twice per year, as specified in Section 5.1 of this Agreement, at least one-third of the fully allocated cost of the enhanced service described in Attachment A,in an amount not less than US$100,000 per year for five(5) years to add to existing transit service or a minimum of US$200,000 per year for five (5) years to DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT • BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 2 of 10 implement new transit service. The foregoing dollar amounts represent the minimum monetary • contributions that Service Partner will be responsible for pursuant to this Agreement. The amount of Service Partner's actual yearly monetary contributions, over and above the minimum yearly contributions specified in this Subsection 3.1, are to be determined by application of the cost allocation calculation specified in Attachment A, which is attached hereto and incorporated herein by this reference. If application of that cost allocation formula yields a higher dollar amount, Service Partner shall pay the larger amount. 3.2 Transit Service Enhancements. In addition to the financial contributions referenced in Subsection 3.1, Service Partner will undertake a number of additional actions that are expected to increase ridership on the enhanced bus services provided for herein, including, but not limited to implementation of transportation demand management programs, parking management, service promotions, and communication infrastructure and transit signal priority improvements. The transit service enhancements to be undertaken by Service Partner pursuant to this Agreement are set forth more fully in Attachment A, which is attached hereto and incorporated herein by this reference, The Parties acknowledge and agree that the goal of this Agreement is to increase ridership. Toward that end, the Parties agree to work together in good faith to refine the details of the required transit service enhancements in order to assure effective and timely - implementation. 4. TERM OF AGREEMENT AND APPROVAL BY KING COUNTY COUNCIL 4.I This Agreement shall commence upon signing by the Parties and,for each service specified in Attachment A,expire five(5)years after the start of that service,unless extended or earlier terminated pursuant to the terms of this Agreement. If after five(5)years the enhanced transit service is deemed viable by the County pursuant to the performance indicators set forth in Section 2.2 of this Agreement and the additional performance benchmarks specified in Attachment A, and Service Partner desires to have Metro Transit continue to provide the enhanced transit service beyond the initial five year period,this Agreement may be extended by the Transit General Manager for an additional five years without additional approval by the • King County Council. 4.2 This Agreement is subject to review and approval by the King County Council and, if necessary, the governing bodies of any other governmental entities that are a Party to this Agreement. 5. INVOICES/PAYMENT PROCEDURES 5.1 The County will invoice Service Partner twice each year for its contribution, as specified in Section 3.1 of this Agreement,to the transit service provided for herein. Service Partner will receive two(2)billings each calendar year for the actual costs incurred by the County to operate or manage the service. 5.2 An estimate of the total service costs based on scheduled service hours is shown in Attachment A. This estimate will be adjusted in January each year,based on the per mile and per hour rates for that year. This adjustment will be provided to the Service Partner. 5.3 Service Partner shall make payment within forty-five(45)days after receipt of an invoice. Should Partner fail to pay the County the amount due within forty-five(45) days of receipt of a billing invoice from the County, a late payment assessment shall be applied to any outstanding balance due for that invoice. The late payment assessment shall be fixed at the maximum rate allowable under Washington state law. 6. INDEMNIFICATION AND LEGAL RELATIONS 6.1 It is understood and agreed that this Agreement is solely for the benefit of the Parties hereto and gives no right to any other person or entity. No joint venture or partnership is formed as a result of this Agreement. No DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 3 of 10 • employees or agents of one Party or its contractors or subcontractors shall be deemed,or represent themselves to be,employees,agents,contractors or subcontractors of the other Party. 6.2 Each Party shall comply, and shall ensure that its contractors and subcontractors, if any, comply with all federal, state and local laws,regulations, and ordinances applicable to the work and services to be performed under this Agreement. 6.3 Each Party shall protect, defend, indemnify and save harmless the other Party, its elected officials, officers, officials, employees and agents while acting within the scope of their employment as such,from any and all costs, claims,judgments, and/or awards of damages,arising out of or in any way resulting from each Party's own negligent acts or omissions. Each Party agrees that it is fully responsible for the acts and omissions of its own subcontractors,their employees and agents,acting within the scope of their employment as such,as it is for the acts and omissions of its own employees and agents. Each Party agrees that its obligations under this provision extend to any claim,demand,and/or cause of action brought by or on behalf of any of its employees or agents. The foregoing indemnity is specifically and expressly intended to constitute a waiver of each Party's immunity under Washington's Industrial Insurance Act,RCW Title 51, as respects the other Party only, and only to the extent necessary to provide the indemnified Party with a full and complete indemnity of claims made by the indemnitor's employees. The Parties acknowledge that these provisions were specifically negotiated and agreed upon by them. 6.4 Each Party's rights and remedies in this Agreement are in addition to any other rights and remedies provided by law. 6.5 This Agreement shall be interpreted in accordance with the laws of the State of Washington. The Superior Court of King County,Washington,located in Seattle,Washington,shall have exclusive jurisdiction and venue over any legal action arising under this Agreement. 6.6 The provisions of this section shall survive any termination of this Agreement. • 7. CHANGES AND MODIFICATIONS This Agreement may be amended or modified only by prior written agreement signed by the Parties hereto. Such amendments and modifications may be executed by the General Manager of the County's Transit Division without additional Council approval, so long as any such amendments are consistent with the intent and purpose of this Agreement. 8. TERMINATION OF AGREEMENT 8.1 Either Party may terminate this Agreement, in whole or in part, in writing if the other Party substantially fails to fulfill any or all of its obligations under this Agreement through no fault of the other; provided, however, that, insofar as practicable, the Party terminating the Agreement will give not less than 135 calendar days prior to the County's February, June or September service change, by written notice delivered by certified mail,return receipt requested,of intent to terminate. 8.2 In addition to termination under Paragraph 8.1 of this Section,the Countymayterminate this Agreement �' pursuant to the provisions of Section 2.3 of this Agreement, in whole or in part, provided, that Service Partner will be given not less than 135 calendar days prior to the County's February, June or September service change,by written notice delivered by certified mail,return receipt requested,of intent to terminate. 8.3 If either Party terminates, Partner will pay the County a pro-rated amount for services performed in accordance with the Agreement to the date of termination. 9. FORCE MAJEURE DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT 411 ROUTE 153 Page 4 of IO _ l Either Partyshall be excused from performingits obligations under this Agreement during the time and to 4111 g �' the extent that it is prevented from performing by a cause beyond its control, including,but not limited to: any incidence of fire,flood,earthquake or acts of nature;strikes or labor actions;commandeering material, products, or facilities by the federal, state or local government; and/or national fuel shortage; when satisfactory evidence of such cause is presented to the other Party, and provided further that such non- performance is beyond the control and is not due to the fault or negligence of the Party not performing. In no event, however, shall this provision eliminate the obligation to make payment to the County for work performed in accordance with this Agreement. • 10. WAIVER OF DEFAULT 1 Waiver of any default shall not be deemed to be a waiver of any subsequent default. Waiver of breach of any provision of this Agreement shall not be deemed to be a waiver of any other or subsequent breach and shall not be construed to be a modification of the terms of this Agreement unless stated to be such in writing,signed by authorized Parties and attached to the original Agreement. • 11. ASSIGNMENT This Agreement shall be binding upon the Parties, their successors, and assigns; provided, however, that neither Party shall assign or transfer in any manner any interest, obligation or benefit of this Agreement without the other's prior written consent. 12. NO THIRD PARTY BENEFICIARIES Nothing in this Agreement,express or implied,is intended to confer on any person or entity other than the Parties hereto and their respective successors and assigns any rights or remedies under or by virtue of this Agreement. • 13. MUTUAL NEGOTIATION AND CONSTRUCTION 4111) This Agreement and each of the terms and provisions hereof shall be deemed to have been explicitly negotiated between, and mutually drafted by, the Parties, and the language in all parts of this Agreement shall,in all cases,be construed according to its fair meaning and not strictly for or against either Party. 14. ALL TERMS AND CONDITIONS This Agreement merges and supersedes all prior negotiations,representations and agreements between the Parties related to the subject matter hereof and constitutes the entire agreement between the Parties. This Agreement may be amended only by written agreement of the Parties. This Agreement contains all the terms and conditions agreed upon by the Parties. No other understandings, • oral or otherwise,regarding the subject matter of this Agreement shall be deemed to exist or to bind any of the Parties hereto. • DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 • Page 5 of 10 • 15. CONTACT PERSONS The County and Service Partner shall designate a contact person for purposes of sending inquiries and notices regarding the execution and fulfillment of this Agreement. Service Partner Contact Name Nate Jones Cathy Mooney Organization City of Renton Public Works City of Kent Public Works Department Title Transportation Planner Senior Transportation Planner Address 1055 South Grady Way 220 Fourth Ave.S. Renton,WA 98057 Kent,WA 98032-5895 Telephone 425-430-7217 } 253-856-5564 Fax 425-430-7376 1253-856-6500 E-Mail njones@ci.renton.wa.us cmooney@ci.kent.wa.us King County Contact Name Matt Hansen Title Supervisor,Market Development,Metro Transit Division Address YES-TR-0600 _. 400 Yesler Way Seattle,WA 98104 Telephone 206-263-3598 Fax 206-684-2058 • E-Mail matt.hansen@kingcounty.gov 16. Each Party warrants and represents that its execution of this Agreement has been authorized by its governing body,via King County Ordinance No. 16041 dated March 24,2008,and via[City of Renton Ordinance No. , dated _ 1,and via[City of Kent Ordinance No. ,dated ]. 17. Effective Date. This Agreement shall take effect when it is signed by all the Parties hereto. IN WITNESS WHEREOF the Parties hereto have executed this Agreement on the day of ,2008. KING COUNTY SERVICE PARTNER By: By: Title: Title: Date: Date: SERVICE PARTNER By: Title: Date: DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT 11111 ROUTE 153 Page 6 of 10 ATTACHMENT A Direct Financial Partnership Scope a of Work City of Kent City of Renton A. Monetary Contributions 1. Monetary Contributions to be Made by Service Partners The Cities of Kent and Renton agree to contribute one-third of the fully allocated cost for five(5)years of additional service on Route 153 as defined in the Service Description in Section C of this Attachment A.The actual annual cost the Service Partners agree to pay on an annual basis shall be determined in accordance with Section 5.2 of this Agreement. The proportion of the fully allocated annual cost that each Service Partner agrees to pay is specified in Section D of this Agreement. 2. Monetary Contributions to be Made by County The County agrees to operate the service as defined in Service Description, in Section C of this Attachment A and Section 2.1 of this Agreement. B. Transit Service Enhancements 1. Service Partners agree to implement additional actions that are likely to increase ridership on the new services, including all those listed below or similar activities, if authorized in advance by the King County Metro Transit General Manager. Such additional actions shall be implemented no later than two(2)years from the effective date of this Agreement. At least six months prior to the start of the new services, Service Partners will contact King County Metro's Market Development group to refine the details of these actions to help assure effective and timely implementation. Service Partners remain responsible for the cost and implementation of the following actions or similar activities as agreed with Market Development staff: City of Kent a. Promotion • Promote the new service to businesses through the Chamber of Commerce. • Promote the new service through articles in the IN BOX utility bill insert,the Kent Reporter,and the monthly CTR newsletter. • Advertise the new service on the City's Web site and TV stations,Kent TV21. • Continue to encourage greater use of enhanced transit service,through encouraging use of programs such as FlexPass. b.Facility Improvements • Continue with project to construct street and signal improvements to increase efficiency of transit service in the Central Avenue/East Valley Highway corridor. DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 7of10 4111 City of Renton a. Promotion • Promote new service using media outlets including TV,Web site,and print(local newspapers,utility bill inserts). • Outreach to 3 tiers of users: employers(CTR and non-CTR sites),business leagues(e.g. Chamber of Commerce,Downtown Association,Renton Connection),and community service groups/neighborhood associations(e.g. Kiwanis). • Promote services through the City's pilot program for transit center security and Downtown Visitor's Assistance program. 2. The County agrees to undertake the following supporting actions: a.Additional promotion of service • Designate new trips funded by partnership in the bus timetables for the affected routes. • Work with Service Partners to promote transit use on the affected routes. C. Service Description County and Service Partners agree to share in the cost and responsibilities of adding midday service on Route 153,operating 30-minute headways between approximately 9 a.m.and 3 p.m. The service will operate with a 30-foot diesel coach.The intent of the service enhancements on Route 153 is to provide midday service along Lind Avenue Southwest and East Valley Road and connect employers,retail,and residential development in the corridor. The service implemented • will be generally consistent in scope and service levels and may vary from this description should County and Service Partners mutually agree to implement alternative service of similar scope following any required public outreach and any necessary King County Council authorization. D. Service Cost Estimate The estimated cost is a planning-level estimate based on the hours and miles identified on the spreadsheet attached hereto as Exhibit 1 entitled"Preliminary Cost Estimate,"which is incorporated into and made a part of this Agreement by this reference.The actual hours and miles needed to operate the service are determined by the County during the scheduling of the service prior to implementation.The actual fully allocated cost may be higher or lower than the estimate provided in Exhibit 1. Total estimated annual hours: 3,900 Total estimated annual miles:50,018 Estimated fully allocated annual cost(County's+Service Partners'cost): $433,865.34(based on 2008 fully allocated annual cost) City of Kent's 2008 estimated annual share of fully allocated annual cost: Sixteen and two-thirds percent($72,310.89 based on 2008 fully allocated DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT • ROUTE 153 Page 8 of 10 •• annual cost) City of Renton's 2008 estimated annual share of fully allocated annual cost: Sixteen and two-thirds percent($72,310.89 based on 2008 fully allocated annual cost) E. Benchmarks for Evaluating Route Performance Metro has a consistent,formal route-performance evaluation process to identify individual routes that may require modification,expansion or termination.Routes are grouped by subarea and time period for similarity in operating conditions.Each partnership route will be compared by time period to other routes in its subarea to ascertain performance level. Data for a particular year is typically available by the middle of the following year.The comparison will be made at the time the data is available. The 2006 benchmarks for the service additions applicable to this Agreement are as follows: South Subarea—Off-peak(midday) Rides per revenue hour: Average—37.6 Fare revenue/operating expense: Average— 17% Passenger miles/revenue hour: Average—227 Passenger miles/platform miles: Average— 11.45 Initial performance review for this service will use benchmarks determined using 2008 data. 11111 DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 9 of 10 0 0 0 EXHIBIT 1 Preliminary Cost Estimate ., ‘,q11,111"orwr,. hiLinFIF-,'7111inni-•; ,'.T.-ii•-firmi.„4.,.,. , , ,., „ . ii 1 i op 1'IN,Mirgi."titiiiiiMititligairiP111 IF mil Fr,, . piliiiiipigvermavitinsigqiilifirill [ilig Ir. po„NPTI'P -11,.,,-1.,i-;111140 iff: 111.111'1111,1011.0111 illitilliktbiliiii gat*To2Pftlim 1 I kid II viitik...biLLHoiligilifiniolillimi 4 ilim 1 I'll iiilillipiiillitilipmilliWilwill1101 il 11101 • Kw'': ''.' 'ill'iii Iiiiir011. 11 '1' Ili 1'11';I'''-{''..r `rff$1,1TAI'l jill'. . Ill'emtjltf 11,41171g(ligghilit,001I11,111i,OM". l'''. •,1)1,1011,14,00,11,4,1114[1,1,01,11,111,1,11,,,,,,„op,it, .4,10,2;1:. ,r, ,.,., :11041 1 f ,iti 1 ii•[1,1,14,i4j!', tillik All Ji ii 1.,:,1,,.'.,',-1, 6,16e4114.,! ,IlIl , ,..d ', .11 1 a .*.euctoilikoiwo,1 )11.001,111,1,11 011414411111010111.1141114111iiiiiiiniiIIiiilultilii1111110tigij 111V0 il,,111.1 ,1,,i,111'111,11111 , I.11- al 11 11,110144, ,I 111 gP11 Iii II.1,v,ibmillitplmitivnn,14 If i iu plillo.,01.0!ItlitinglifloqiNiv,I441iiiivgiiiii PagaortiLIP,BylitthilltP,opsAAgatili.it,huithlt:iti Hill_tt 153 M-F north 9:00—3:00 Midday Kent Station to Renton 12 RTransit Center 3,900 $327,327.00 50,018 $106,538.34 $433,865.34 n T 153 M-F south 9:00—3:00 Midday entoransiti to Kent StatCenter 12on . A. ,. 1rgiviiireTwilidirrii.,4,T,ririciiiiiii,,,u4-15V:1"" :: iii IPPriitijiailgiligrjfilU'lltrill:lii;1?i,:i:'.. 1.:-HI:!;t,:,1',':1::',i1';:.":'''''-.H!1:!'!':.:'i'l.:1!',1.1111'itIVIPV.iiiik:111!l'illi];v3g,(1,.4p.00 i)!..iii+.9 ., e 1 .41i9ar .5 81}34,11‘...1[1.44'33863.-.541,1 .I..:,..:1,::,..: 4,.0 ,Imd, .,.1, o ! ;4..11 .-,. ...•...4.......”..,,,...R..'.‘,.0,..z, ....,..,=—. King County Metro Transit contribution $289,243.56 City of Kent contribution $72,310.89 City of Renton contribution $72,310.89 • DIRECT FINANCIAL SERVICE PARTNERSHIP AGREEMENT BETWEEN KING COUNTY AND THE CITY OF RENTON AND THE CITY OF KENT ROUTE 153 Page 10 of 10 • • , • . ......... .. . '`t I ; T• = ' $ - y Partnership Fa -._.. is1;. `_ ,. . - iii 1 r; i • 17^,n.,,..1 ■ ■ ' A"ci ,,': ` Y;:-_ ..gN3i'5t /�£. 1 Discussion■ III .,,_.-t Rent6iii:::.„ ., i i P&R'ii - . R ,z,..,.....„,;., -.a� sn FY �Krjo Route 153 t g )i Ca. . • t " 3„-.0". L3tltg -g -< Renton: ' - I n F � y < TtanSR . .:: ; r Center . y RENTON A, . •',-1t„_ South RenttoaP&R . , ys ' u y • Surface Lot 1v .atTukwda ”: I '.tation , • ;_k . ,.G S L.I, - t, JTS 1 :3_i1r,S: { ..a.��f mow+' �,. „+'` 1 • f ., — III s } 7 _ tis - . SE i9?,113 J i 1 i 1 ti 3 `t .B f F 1 _i m:u..ir`Jrfh I. t Y j I 1 c, LEGEND c-,,,,,,...Route 153 F;, K ""`Other Metro Routes wi C" D.+ Sounder Commuter f, *' I Rail&Station _:.a;,,5; • u - ® Permanent Park&Ride Lot a Leased Park&Ride Lot s _ e, - _ - Kent Urban Center In I 3 Renton Urban Center 1 Park I , - ,. _ rn...6,-nirn... sex t.Mw Cy sn.-.n.^m Kent/James .. ,. a, `: "N ,yam„_. s: Street P&R ” a �,r m m a �t tea'N'm� K ,m -M :Am :: ti h Si monem9 ,a..ff�x.. ttra,a a vt-oaa, _..,,,....,„E ,.-^ +.r":,.a �:._... M.e«y ai.l..,w..�ew.,g t.„mr...>tic t�,.,,.,,w:o zs- Ii III i ...n_U ..a: <e ,,,,.�.. .. ....,..a..,.,.., e.. ze:�et. :R.a:k.,x...,xar me,�ero..n r kW..attar,eKtna.otTnneini nxvoot 8r ' "=Kent Garage at Kent Station(ST} M `” m i A}r• w.ma a.Kna Cop"aANV,,, ,,a••nM A ... •.;` -":: , .�, RcnMC<- ,scniil rm I`6 } _. 1 lail '1672 �County i i t � y • I ., ,# Partnership • �1,"___SS Langston Rd �` � - aS N 3D i s c u s s i o • n■3 Mar� . ''"'l .• K.w s <a �s rpoRrteWnaton . m. ( aS wg9S = 1 Route 153% G�Rr, ��, y"' s� -54th St • `P a sw Sunset siva Renton ° Transit tl _ \ 1. Center SW 7th St - V' �° _ -RENTON., '`\dG ,/ SW ia11Y WaY Soutthh Renton P&R iii � `,/ SW tem S' `O; VI, 10 H01 Q Tukwila O[' ° -- S 21st St .•• . ' Surface Lot F4 ` .. _ - _ at Tukwila { Y■Station 'T - 1 O t'o a '"el etr 1?, a .. tstta o \ m ITS j m ' TO; ; - . . \ _ ,...._ SE 168th St t/131 1 - SE jr 176th St SE Pelrovilsky x e' I s,'"17 S 1801 ,-SW 43rd St i i //-1'. 7-c'' • - r=, • _ - _ I. _.• .SE 192nd St S 196th St yt ! m Ctl 1 G. t, tg likt tn G. - . S 208th St • SE 208th St S 212th St j., - S 211t St _ i !!! - SE 216th St ' m . S 216th st„' ,r { • LEGEND . , . -Route 153 N m<r. / N-- -Other Metro Routes °r m Sounder Commuter m ® Rail&Station „S 228th St •u}/� m mr N © Permanent Park&Ride Lot ff4 ® Leased Park&Ride Lot / Kent Urban Center KENT a --; Renton Urban Center /Z ; Park // m • m iff/ m btonMONm Uvs map Penn ae,,,wno...or. KenUJames , < la .� -Tof ty sources me mmt.at.a-nne.a.a notm.,rw County $t StreetP&F2 _ makes ess.�o."«n�. u aa°"`rmst.om., C"'ay, E James St 5 240th St WWI note.ma.for. 'gene...p.om.eae.a�nane.ml.or O r. ,l I z.a ro.�".n a,. .mp..a a rofrom the use or rresuse of Pae Noma.o.meci qt My le otN.mm or nMmabn m.map a poHh deaaaptN { Kent Garage at Kent Station(ST) °°" a°"°"°`°""' • • W Smith St m.p ohroeumm. rA"arDepemmp.arm.ton.mnf ere Giem,Sen..Development Semon Sem®MIE err -,O f ..5 C9,r' ! P4meq Group Fkn.pc cHl5J mN - EIM —. �, Q it\\� ti\ SF-- © SE 248th St o a.zs os ..._�. W Wil ' ) l __1. Lid412 .: ( August 7,2007 KingCounty • CITY OF RENTON COUNCIL AGENDA BILL r • AIN: � / ` Submitting Data: Public Works Department For Agenda of: Dept/Div/Board.. Transportation Systems Division April 14, 2008 Staff Contact Ryan Zulauf, Airport Manager, Agenda Status x7471 Consent X Subject: Public Hearing.. First Amendment to the Memorandum of Understanding Correspondence.. Regarding Airport Issues (CAG-07-068) Between the Ordinance. Cities of Renton and Mercer Island Resolution X Old Business Exhibits: New Business X Issue Paper Study Sessions Resolution Information Recommended Action: Approvals: Legal Dept X Council Concur Finance Dept Other... Fiscal Impact: Expenditure Required... $0 Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget N/A City Share Total Project.. N/A - SUMMARY OF ACTION: On April 9, 2007, the cities of Renton and Mercer Island signed a Memorandum of Understanding (MOU), CAG-07-068, which established a cooperative relationship in the process of updating the Airport Layout Plan, which is a major component of the 1997 Airport Master Plan. A First Amendment to the MOU has been prepared, which addresses the termination of the Request for Proposal for a jet center at the Airport and the cancellation of the Airport Noise Study. The Airport Noise Study, which was outlined in the MOU, was cancelled in early 2008, when The Boeing Company announced its intent to again lease a portion of Apron B. STAFF RECOMMENDATION: Approve the First Amendment to the Memorandum of Understanding, CAG-07-068,regarding Airport issues between the cities of Renton and Mercer Island and present the resolution for reading and adoption. • C:\DOCUME-1\BWalton\LOCALS-1\Temp\Agenda bill MOU Renton-MI Amendment#l.doc �(CY O PUBLIC WORKS DEPARTMENT MEMORANDUM DATE: April 14, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: „ Denis Law, Mayor FROM: Gregg Zimmerman ' ininistrator STAFF CONTACT: Ryan Zulauf, Airport Manager(x7471) SUBJECT: First Amendment to the Memorandum of Understanding Regarding Airport Issues (CAG-07-068) Between the Cities of Renton and Mercer Island ISSUE: Should the City of Renton approve the First Amendment to the Memorandum of • Understanding, CAG-07-068, regarding Airport issues between the cities of Renton and Mercer Island? RECOMMENDATION: 1. Approve the First Amendment to the Memorandum of Understanding, CAG-07-068, regarding Airport issues between the cities of Renton and Mercer Island. 2. Authorize the Mayor and City Clerk to sign the First Amendment to the Memorandum of Understanding regarding Airport issues. BACKGROUND SUMMARY: The cities of Renton and Mercer Island signed a Memorandum of Understanding (MOU), agreeing to share information and take certain actions to assure that citizens of both cities were fully informed of Renton's Airport Master Plan process. Staff recommends articles 7, 14 and 15 of the MOU be deleted to reflect changed circumstances resulting in Renton taking a different course on its Airport development plans. The amendment to the MOU is attached. Initial Airport development planning alternatives: In 2006, Renton's Airport Master Plan • process generated three Airport Layout Plan (ALP) alternatives. Renton's master plan consultant presented these to the Renton Airport Advisory Committee (RAAC) and to the Marcie Palmer,Council President Members of the Renton City Council Page 2 of 4 April 14,2008 • Renton City Council's Transportation Committee in the fall of 2006. One of the ALP alternatives would have used apron space (freed by expiration of a Boeing Company land lease)to develop a corporate jet center. On learning that this alternative was recommended by the consultant and favored by members of the RAAC, Renton and Mercer Island residents expressed concern about the perceived noise disturbance that might result from increasing numbers and frequency of jet operations over their neighborhoods. Community meetings were held in Renton in October and December 2006, and on Mercer Island in January 2007. Soon afterward, staff of both cities crafted an agreement that Renton would take no further action on selection of an ALP alternative until the noise effects of each of the alternatives had been thoroughly evaluated and reported to both communities. The two cities signed a Memorandum of Understanding in April 2007, laying out specific steps they would take together, and steps that would not be taken, until more information was known and citizen input had been considered. Article 7 of the Actions to be Taken section of the MOU states that the City of Renton would direct its Airport Advisory Committee (RAAC) to refrain from making a recommendation on future Airport development until an aircraft noise study was completed, and results delivered to both cities. Accordingly, Renton instructed the RAAC last spring to take no further action on the proposed Airport Layout Alternatives • until noise study results were reported. In partnership over the ensuing five months, the cities solicited proposals for a study of the noise effects of the ALP alternatives, selected the consulting firm Harris Miller Miller & Hanson (HMMH), prepared a draft scope of work, presented the consultant team and the preliminary work scope at community meetings, and invited citizens' participation in final scoping. Boeing request to regain leased apron space: Just as HMMH and staff of both cities were revising the scope of work to incorporate the citizens' input, The Boeing Company approached the City of Renton indicating that apron space leased by Boeing for decades but recently turned back to the City, would once again be needed for 737 production. The current Boeing lease of that space expires in 2010; Renton intends to write a new lease with The Boeing Company at that time. Boeing's request of lease rights to aprons A and B leaves insufficient space for any of the ALP alternatives as initially described, and removes a corporate jet center from further consideration. The only remaining options for Airport development will continue the types of businesses and activities historically present at the Airport. Because a jet center is no longer under consideration, and none of the other ALP alternatives initially prepared by the master planning consultant can be implemented in • their original form, staff called for the consultant to prepare a new Airport Layout Plan h:\file sys\air-airport,transportation services division\03 projects\01 tasks\agenda bills\agenda bill-mi mou amendment#1\issue paper first amend to mou.doc Marcie Palmer,Council President Members of the Renton City Council Page 3 of 4 April 14,2008 • accommodating Boeing's new requested lease needs and eliminating a corporate jet facility. In late October, considering the dramatic changes surrounding Renton Airport planning, Renton and Mercer Island agreed to suspend work on the noise study so that money would not be wasted. The contractor was instructed to stop work immediately and the contract expired at the end of January (according to the original terms of the contract) with no further expenditure. Revised Council policies on Airport development: During the early months of 2007, the Renton City Council also re-examined the policy basis for its Airport master planning. The Renton Council has now revised and clarified its policies, declaring that its highest priority is sensitivity to the effects of aircraft noise on Airport neighbors. On March 26, 2007, Renton City Council approved four key governing policies for the Airport,the first of which reads, "Airport operations should be sensitive to neighborhood impacts and should strive to minimize those impacts." On June 27, 2007, the Renton City Council adopted the revised Airport development policies that removed references to a jet center and deleted wording indicating the City's interest in increased jet operations. November 5, 2007, the Renton City Council officially withdrew consideration of a corporate jet center at the Renton Airport. New Airport Layout Plan: Renton's Airport master planning consultant has now prepared a new Airport Layout Plan to replace the three alternative ALPs proposed one and one-half years ago. By Renton policy and procedure, the preliminary draft of a replacement ALP must go to the RAAC for its review, comment and recommendation before the City Council takes action. Given continuing pressure from the FAA to complete the Airport Master Plan, Renton referred the new draft ALP to the RAAC on December 18, with prior notification to Mercer Island that the RAAC would be asked to review and critique the plan, but to refrain from making a recommendation until Mercer Island agrees to lift the restriction laid out in Article 7 of the MOU. Mercer Island agrees to amend the MOU: On Tuesday, February 19, 2008, Mercer Island City Council adopted the First Amendment to the Memorandum of Understanding Regarding Airport Issues Cities of Renton & Mercer Island, "so that Renton may request that its Airport Advisory Committee provide a recommendation on the new proposed Airport Layout Plan, provided that the Plan does not include facilities, programs or activities to support increased jet traffic at Renton Airport." The following amendments to the MOU have been adopted by the City of Mercer Island and are being recommended for approval by the City of Renton. • Delete Article 7 requiring that the RAAC refrain from making a formal • recommendation on Airport development until completion of the noise study. h:\file sys\air-airport,transportation services division\03 projects\01 tasks\agenda bills\agenda bill-mi mou amendment#1\issue paper first amend to mou.doc Marcie Palmer,Council President Members of the Renton City Council Page 4 of 4 April 14,2008 • • Delete Article 14 that describes the process the two cities will follow when noise study results are available. Work on the noise study was suspended when Boeing's request to regain leased apron space rendered the original development alternatives moot. • Delete Article 15,which specifically calls for community meeting(s) at the conclusion of the noise study. Likewise, now that the noise study as initially envisioned will not occur, the original plan for community meetings is no longer relevant. If other noise-related analyses are undertaken by either city in the future, new plans will need to be prepared for public information, citizen input and dissemination of results. Attachment: First Amendment to the Memorandum of Understanding Regarding Airport Issues Cities of Renton &Mercer Island cc: Peter Hahn,Deputy PW Administrator—Transportation Ryan Zulauf,Airport Manager Connie Brundage,Transportation Administrative Secretary Susan Campbell-Hehr/Carolyn Currie,Airport Secretary s • h:\file sys\air-airport,transportation services division\03 roJects\01 tasks\agenda bills\agenda bill-mi mou amendment#1\issue paper first amend to mou.doc w • First Amendment to the Memorandum of Understanding Regarding Airport Issues Cities of Renton & Mercer Island The "Actions to be Taken"section of the Memorandum of Understanding Regarding Airport Issues / Cities of Renton &Mercer Island shall now read as follows: Actions to be Taken: The Cities agree to move forward in a cooperative and collaborative fashion to examine Airport development options. To that end, the Cities agree to take the following actions: 1) BOTH CITIES will publicly describe this partnership through a joint press release issued to the Mercer Island Reporter, the Renton Reporter and other news media, and explain that the noise study will include both Mercer Island and Renton neighborhoods. 2) The Mayors of MERCER.ISLAND and RENTON will prepare"op/ed" articles promoting this partnership and submit them for publication in their respective community newspapers. 3) The MERCER ISLAND representative to the RAAC and the RENTON Councilmember who is also a voting member of the RAAC will discuss with the RAAC membership the substance of this Memo of Understanding and the Cities' decision to proceed • 1 collaboratively. 4) MERCER ISLAND will provide RENTON with a summary of issues of concern to its residents that were raised at the community meeting held on Mercer Island on January 29, 2007. 5) MERCER ISLAND will identify key questions raised at the January 29 community meeting that remain unanswered and provide these to RENTON. Together the staffs of the Cities will determine which of these key questions can be satisfactorily answered at this time, and which require additional data. 6) On or before April 30, 2007, with prior review and assistance from MERCER ISLAND on ways to disseminate, RENTON will provide answers to the questions that the staffs of the Cities deem appropriate to answer at this time. -. - • - : e - - - - .. 847) Staff of RENTON and MERCER ISLAND will develop a draft scope of work for a noise study to be conducted by a jointly-selected consulting firm. The cities will seek qualifications from consulting firms, including but not limited to the firm of Hams Miller Miller&Hanson, based on the article by the firm's President Mary Ellen Eagan entitled, "Using Supplemental Metrics to Communicate Aircraft Noise Effects" (Transportation Research Board, Nov. 10, 2006). 948) The cities may elect to solicit public input for the study scope and will share the gra) information gathered from such public input. First Amendment to MOU Regarding Renton Airport Issues Page I CITY OF RENTON, WASHINGTON • RESOLUTION NO. A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING THE MAYOR AND CITY CLERK TO EXECUTE THE FIRST AMENDMENT TO THE MEMORANDUM OF UNDERSTANDING REGARDING AIRPORT ISSUES BETWEEN THE CITY OF RENTON AND THE CITY OF MERCER ISLAND. WHEREAS, on April 9, 2007, the cities of Renton and Mercer Island signed a Memorandum of Understanding (MOU), CAG-07-068, which established a cooperative relationship in the process of updating the Airport Layout Plan, which is a major component in the 1997 Airport Master Plan; and WHEREAS, a First Amendment to the MOU has been prepared, which addresses the termination of the Request for Proposal for a jet center at the Airport and the cancellation of the Airport Noise Study; and • WHEREAS, the Airport Noise Study, which was outlined in the MOU, was cancelled in early 2008, when The Boeing Company announced its intent to again lease a portion of Apron B; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DOES RESOLVE AS FOLLOWS: SECTION I. The above findings are true and correct in all respects. SECTION II. The Mayor and City Clerk are hereby authorized to execute the First ISI Amendment to the Memorandum of Understanding Regarding Airport Issues between the City of Renton and the City of Mercer Island. • 1 i f RESOLUTION NO. • PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor Approved as to form: • Lawrence J. Warren, City Attorney RES.1331:3/26/08:scr • 2 I CITY OF RENTON COUNCIL AGENDA BILL AI a: Submitting Data: Public Works Department For Agenda of: Dept/Div/Board.. Transportation Systems Division April 14, 2008 Staff Contact Peter Hahn, Deputy PW Agenda Status Administrator - Transportation Ext. 7242 Consent X Subject: Public Hearing.. Correspondence.. Fund Transfers for the Logan Avenue North Bicycle Ordinance X Lane Agreement with The Boeing Company Resolution Old Business Exhibits: New Business X Issue Paper Study Sessions Letter of Agreement Information Ordinance Recommended Action: Approvals: Council Concur Legal Dept X Finance Dept X Fiscal Impact ($188,825 from Parks Division account#316.000000.020.5940.0076.63.020055) Expenditure Required... $300,000 Transfer/Amendment $111,175 Amount Budgeted.. $300,000 Revenue Generated Amount Needed Not to exceed $300,000 City Share Total Project. SSUMMARY OF ACTION: For a number of years the City has been planning to construct the Lake Washington Trail (South Lake Connector, also known as Sam Chastain Trail, Cedar River Trail Extension, and Logan Avenue North Bicycle Lane) linking two major regional trails. In July 2007, it became apparent that the trail could not be constructed with a connection across the north edge of the Boeing plant. The City reviewed its options and decided that a southbound bicycle lane on Logan Avenue North would achieve a significant benefit in the regional trail system. However, The Boeing Company had just completed the design of an adjoining park, called the Boeing Employee Park. In order to construct the bicycle lane, The Boeing Company needed to redesign its park and then take on the added costs related to a different (and more expensive) construction sequence. The City of Renton committed to paying these additional costs. The Letter of Agreement formally commits to the payment of such costs up to a maximum of$300,000. The 2008 budget for the Cedar River Trail Extension is $188,125. With the transfer of$111,875 from account 303.000000.000.3450.0085 (Community Development Impact Mitigation) to account 316.000000.020.5940.0076.63.020055, the budget will be increased to $300,000 and will provide the funding needed for this project. STAFF RECOMMENDATION: Authorize the Mayor.and City Clerk to sign the Letter of Agreement with the Boeing Company regarding the Logan Avenue North Bicycle Lane, approve the transfer of$111,875 from account 303 to account 316 and adopt the ordinance. • C:\DOCUME-1\BWalton\LOCALS-1\Temp\Boeing Letter Logan Agenda bill.doc ® PUBLIC WORKS DEPARTMENT ‘e'P- NT-v0 MEMORANDUM DATE: April 14, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: Denis Law, Mayor FROM: Gregg Zimmerm is Works Administrator SUBJECT: Fund Transfers for the Logan Avenue North Bicycle Lane Agreement with The Boeing Company ISSUE: Should Council authorize the Mayor and City Clerk to sign a Letter of Agreement between The Boeing Company and the City of Renton regarding the Logan Avenue North Bicycle Lane and approve the transfer of$111,875 from account 303 to account 316 to increase funding for the project? • RECOMMENDATION: Authorize the Mayor and City Clerk to sign the Letter of Agreement between The Boeing Company and the City of Renton regarding the Logan Avenue North Bicycle Lane and approve the transfer of funds from account 303 to account 316. BACKGROUND: For a number of years, the City has been planning to construct the Lake Washington Trail (South Lake Connector, also known as Sam Chastain Trail, Cedar River Trail Extension, and Logan Avenue North Bicycle Lane) linking two major regional trails. In July 2007, it became apparent that the trail could not be constructed with a connection across the north edge of the Boeing plant. The City reviewed its options and decided that a southbound bicycle lane on Logan Avenue North would achieve a significant benefit in the regional trail system. However, The Boeing Company had just completed the design of an adjoining park, called the Boeing Employee Park. In order to construct the bicycle lane, The Boeing Company needed to redesign its park and then take on the added costs related to a different (and more expensive) construction sequence. The City of Renton committed to paying these additional costs. The Letter of Agreement formally commits to the payment of such costs, up to a maximum of$300,000. • Marcie Palmer,Council President Members of the Renton City Council April 14,2008 Page 2 of 2 • The 2008 budget for the Cedar River Trail Extension is $188,125. With the transfer of$111,875 from account 303.000000.000.3450.0085 (Community Development Impact Mitigation)to account 316.000000.020.5940.0076.63.020055, the budget will be increased to $300,000 and will provide the funding needed for this project. cc: Mike Bailey,Finance&Information Services Administrator Terry Higashiyama,Community Services Administrator Alex Pietsch,Community and Economic Development Administrator Peter Hahn,Deputy PW Administrator—Transportation Leslie Betlach,Parks Director Suzanne Dale Estey,Economic Development Director Juliana Fries,Transportation Program Development Coordinator Connie Brundage,Transportation Administrative Secretary File • 411 H:\File Sys\TRP-Transportation Planning&Programming\Boeing Letter Logan Issue paper doc I • April 14, 2008 Ms. Lori Pitzer, Site Services Director The Boeing Company P.O. Box 3707, MC 9U-LW Seattle, WA 98104 Subject: Letter of Agreement for the Logan Avenue North Bicycle Lane Dear Ms. Pitzer: For years now, the City of Renton has been in the process of planning for a major trail project called the Sam Chastain Trail to connect two major regional bicycle and pedestrian trails. One of the featured connection links was to be a trail across the northern edge of the Boeing plant • property, connecting Gene Coulon Park and the Cedar River Trail. Unfortunately, for several reasons, this particular connection was not feasible. In the fall of 2007 the City of Renton identified an alternative connection—a southbound bicycle lane that would connect the bicycle lane from the intersection of Lake Washington Boulevard North and Park Drive North, along Logan Avenue North to the intersection of Logan Avenue North and the Cedar River. Approximately 4,000 lineal feet of this new southbound bicycle lane is immediately adjacent to Boeing's property where Boeing has been designing a new Boeing Employee Park, and other Boeing property is in the process of being improved. When the City identified the alternative to the Sam Chastain Trail, the Boeing Park and the other improvements were already completely designed and ready for construction. The Boeing Company was asked to consider narrowing the park by a sufficient width(approximately five feet)to allow for the new southbound bicycle lane. At the time of the request, the City of Renton was made aware of the costs to Boeing for such an action, and committed to reimbursing Boeing for any consequences of the redesign of the park. The purpose of this Letter of Agreement is to implement the reimbursement promised to The Boeing Company by the City of Renton. • Lori Pitzer April 14,2008 Page 2 of 2 The City of Renton hereby agrees to pay The Boeing Company up to $300,000 for expenses • related to the redesign of the Boeing Employee Park and for additional construction costs caused by delays imposed by the City's need for the bicycle lane. The City of Renton will pay such expenses upon receipt of invoices and supporting documentation. The City of Renton appreciates The Boeing Company's responsiveness to the needs of the City and agreeing to make significant adjustments in its schedules for the park design and construction. Please signify The Boeing Company's approval by signing both originals and return one of them to the City. Sincerely, Denis Law Mayor For The Boeing Company: • Lori Pitzer Date Site Services Director cc: Gregg Zimmerman,Public Works Administrator Terry Higashiyama,Community Services Administrator Alex Pietsch, Community and Economic Development Administrator Peter Hahn,Deputy PW Administrator—Transportation Leslie Betlach,Parks Director Suzanne Dale Estey,Economic Development Director Larry Warren,City Attorney Shaunta Hyde,Manager Boeing Local Government Affairs P.O.Box 3707,M/S 14-49 Seattle,WA 98124-2207 Jeff Adelson Boeing Realty Corp. P.O.Box 3707 M/S 7W-60 Seattle, WA 98124-2007 • H:\File Sys\TRP-Transportation Planning&Programming\Letter of Agreement Boeing re Logan Ave.doc CITY OF RENTON, WASHINGTON • ORDINANCE NO. AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING THE FISCAL YEAR 2008 ANNUAL BUDGET AS ADOPTED BY ORDINANCE NO. 5325 TO TRANSFER FROM FUND 303 TO FUND 316 FOR CEDAR RIVER TRAIL EXTENSION PROJECT EXPENSES, AND APPROPRIATING REVENUES IN FUND 316 AND AUTHORIZING EXPENSES IN THAT FUND IN THE NET AMOUNT OF $111,875. WHEREAS, on March 10, 2008, the City Council adopted Ordinance 5362 approving the 2008 Annual Budget; and WHEREAS, it is necessaryto amend the 2008 Annual Budget to accommodate revenue g and expenditures for the Cedar River Trail Extension Project (Logan Avenue North Bicycle Lane); NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, • WASHINGTON, DOES ORDAIN AS FOLLOWS: SECTION I. The Fiscal Year 2008 Annual Budget is hereby amended to include the following adjustment in Community Development Impact Mitigation Fund (303) to transfer to Fund 316 as listed below: Community Development Impact Mitigation Fund (303) FY 2008 REVENUES 2008 After Budget Increase Amended 2008 Budget Carry Forward Budget Funding Source Mitigation Fees 250,000 0 250,000 Investment Interest 5,000 5,000 Revenues 255,000 0 255,000 EXPENDITURES 0 Park Projects 0 111 875 J 111,875 , Expenditures 0 111,875 111,875 Unbudgeted Ending Fund Balance 255,000 -111,875 143,125 1 ORDINANCE NO. SECTION II. The Fiscal Year 2008 Annual Budget is hereby amended to include • the following increased revenues transferred from Fund 303 and expenditures in Municipal CIP Fund (316) as listed below: MUNICIPAL CIP FUND (316) FY 2008 REVENUES 2008 After Budget Increase Amended 2008 Budget Carry Forward Budget Funding Source 16,869,090 New Revenues 111,875 111,875 (Transfer from Fund 303 to Fund 316) Revenues 16,869,090 111,875 16,980,965 EXPENDITURES 13,708,000 13,708,000 Park Projects 1,967,983 111,875 2,079,858 Municipal Facility 871,319 871,319 Projects Other 321,788 321,788 Expenditures 16,869,090 111,875 16,980,965 • SECTION III. This ordinance shall be effective upon its passage, approval, and 30 days after publication. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor • 2 r ORDINANCE NO. • Approved as to form: Lawrence J. Warren, City Attorney Date of Publication: ORD.1456:3/27/08:scr • • 3 CITY OF RENTON COUNCIL AGENDA BILL AI #: /® • Submitting Data: Public Works Department For Agenda of: April 14, 2008 Dept/Div/Board.. Utility Systems/Surface Water Staff Contact Steve Lee, ext. 7205 Agenda Status Consent X Subject: Public Hearing.. Football Northwest, LLC Agreement for the Ripley Correspondence.. Lane North Storm System Improvement Project Ordinance . Resolution Old Business Exhibits: New Business Issue Paper Study Sessions Agreement Information Easement Recommended Action: Approvals: Council Concur Legal Dept X Finance Dept Other Fiscal Impact: Expenditure Required... $149,550 Transfer/Amendment iiiAmount Budgeted $1,121,800 Revenue Generated Total Project Budget $1,800,023 City Share Total Project $1,121,800 SUMMARY OF ACTION: The Surface Water Utility is proposing to construct the Ripley Lane North Storm System Improvement project. The project will extend the storm system improvements constructed on the Seattle Seahawks' Headquarters and Training Facility site by Football Northwest, LLC to the east across Ripley Lane North to 1-405. This agreement between the City of Renton and Football Northwest, LLC (FNW) provides the City with the necessary easements, ownership of a constructed stormwater facility built by FNW, and establishes a cost share for the constructed stormwater facility by FNW for the oversizing of the 60-inch and 72-inch storm system improvements on the Seahawks' Headquarters and Training Facility. This agreement also establishes the cost share of the constructed 60-inch and 72-inch Gypsy Sub-basin stormwater conveyances whereby FNW will receive a reduction of the City's Water Utility System Development Charge (SDC), in the amount of$149,550, for the Seattle Seahawks' Headquarters and Training Facility site development. The Surface Water Utility will reimburse the Water Utility in the amount of this $149,550 SDC fee reduction within five years. The Ripley Lane North Storm System Improvement project along with the downstream storm system improvements, already constructed by the Seahawks, are sized to accommodate existing and future increases in runoff from the total tributary area including WSDOT 1-405 right-of-way. STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to sign the agreement between the City of Renton and FNW that would reduce its SDC fee, in the amount of$149,550, for the Seahawks' Headquarters and Training III Facility site, transfer ownership of the constructed Gypsy Sub-basin conveyance structures to the City on Seahawks' property, and establish easement and maintenance responsibilities. H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200- Agreements\Vulcan\City Corres\Vulcan Agreement AGENDA BILL.doc\STLtp o PUBLIC WORKS DEPARTMENT MEMORANDUM DATE: April 3, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: enis Law, Mayor FROM: Gregg ZimmermaitKlministrator STAFF CONTACT: Ron Straka, Surface Water Utility Supervisor(ext. 7248) Steve Lee, Surface Water Utility Engineer(ext. 7205) SUBJECT: Football Northwest, LLC Agreement for the Ripley Lane North Storm System Improvement Project ISSUE: Should the Council approve the agreement between the City of Renton and Football Northwest, LLC (FNW) for the Ripley Lane North Storm System Improvement in order 111 for the City to construct the storm system improvement project on the FNW site, secure easements and maintenance responsibilities for constructed structures by the City and FNW, and obtain consensus on the cost share reimbursement for the oversizing of the storm system improvements constructed by FNW as part of the Seahawks' Headquarters and Training Facility construction? RECOMMENDATION: Approve the agreement authorizing the Mayor and City Clerk to sign the agreement whereby FNW will receive a reduction of the City's Water Utility System Development Charge (SDC), in the amount of$149,550, for the Seattle Seahawks' Headquarters and Training Facility site development, which is the City's cost share associated for oversizing of the storm system improvements constructed by FNW. This agreement also includes easement documentation that would transfer ownership and maintenance responsibilities of the Gypsy Sub-basin conveyance structures constructed by FNW for the Gypsy Sub-basin discharge into Lake Washington. In addition,the easement document grants the City rights to construct and maintain the Ripley Lane North Storm System Improvement project on FNW's property that would reduce flooding on Ripley Lane North. BACKGROUND: The Surface Water Utility is constructing the Ripley Lane North Storm System Improvement project, which will connect the 60-inch and 72-inch downstream storm • system improvements, constructed recently by FNW, to the existing upstream 24-inch and 48-inch stormwater discharge pipes on WSDOT property to the west of Council/FNW Agreement Ripley Lane April 3,2008 Page 2 of 2 • Interstate 405. The Ripley Lane North project includes installing a vault structure, on Seahawks' property, 481 linear feet of 36-inch storm pipe, and 290 linear feet of 45-inch casing pipe under the BNSF railroad and the King County Wastewater 84-inch Sanitary Sewer Eastside Interceptor. The 36-inch storm pipes will be extended to the east side of Ripley Lane North and transition to channel improvements up to the I-405 roadway where the existing 48-inch and 24-inch storm systems discharge runoff from I-405 and the upstream basin (see Exhibit C). This Renton-FNW agreement establishes the cost share of the constructed 60-inch and 72-inch downstream storm-water structures and easement for the 60-inch to 72-inch pipe/manholes, and the connection structure to be built by the City on FNW property. The agreement and easement are necessary components associated with the oversizing of the storm system improvements to accommodate the future runoff condition upstream of the FNW project site, and will benefit a larger contributory area that will alleviate flooding issues on Ripley Lane North. The overall Ripley Lane North project design and permitting has been completed. The construction plans and contract specifications advertisement started on March 25, 2008. The construction contract bid opening is planned for April 15, 2008, with the bid award planned for April 21, 2008. The project construction is planned to start in late May or early June 2008 and end in October 2008. The Surface Water Utility will reimburse the Water Utility in the amount of$149,550 • SDC fee reduction within five years. Within the $149,550 to reimburse the Water Utility, the WSDOT contribution is $126,496.77, as shown in the project cost share worksheet included within this packet. CONCLUSION: Approve the agreement authorizing the Mayor and City Clerk to sign the Gypsy Sub- basin/Ripley Lane North Storm System Improvement project agreement. Attachment cc: Lys Hornsby,Utility Systems Director File r H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City Corres\Vulcan Agreement Issue PaperVer2.doc\STLtp O 0 . 0 4 --- --,..... a ,4 • ,, /,i . . i 1,' 4 1 " r•-• o. . . . . .. .. . . ..... ...„ .. „..... r'rtop moo,' • ?, tn p 0205105 1I t... '" • - I ACCESS MD i co • , ••.., . 'Ink .,/ SEE CDT STD UM %,:..":..-..Z.7.„.., i.,....)-,-NOTZS: ..„.....„, Seahawk Headquarters and Training Facility Site • 1.,CONSMICT:04 ACCESS E0A15 tS A 1 es 00 ., • . I I i • ' WW1 LANE 1510 ItEtiELFENt.?MTN To Ont. 0.. ; • ....y,,.,,,,,,__..:_ -. 1, .,,,....„,,,../.,,_/ ley' 4:7 .1/./ 1 .,... , .......i .............":••.77--,,,,,,..... •,, .,,, . ,..t-•- , . 0 i/LOT 11 r,-0, 1 ,, - .---„,••••• :Li. , I ,,,,, • , . i, ,. ,1 [192 OSGO3t 2524 0 SOD 55 1 EX 10-12' '; ,1 I CODE(ACCESS RD- 1' _ -.5, ,I ,r_1::.71:....,;:,,:........:tia.... .......: ::1'._...._,_i•,•1 .; ....,,, , , -_t„- - -s,4 , .f---x. • ....,:,......AFA,,,,,Futto,F-4AF.to. • ritr7';',..,•Li••',":,.,-...:::.-;,-;:t.•,:i5,,,,.751:55,,,,,52'.75".5%•...., ,,,,,,K,,.,,,At •utZligii,itilirt•e•••,---•C,:::-• •''''' l'•&117'•.".4.1.. 4,0411)P"' Ailt ,..„...347.,..,,4,..,.757:•:..,.c.,,.:"••,,.......,....:......,.,,,,...,,,,,,,,,,,,,,,,,,,,,,z,,4.....,...z_e7,_, g QI' I tt 11.1 ,-----...'.' II 01,14-2-"Tr"••••••••••••••-..--,-,(2-.-i.:.,,,, ,,, ir.01:., , ___.... ....... ,. .„ '-..4.,I=1;-.F..i.-.E:Es::::.•'-:i -.-::::..... .F•air?.:••...,,-;i:,..,•,..i-,..i4 :: "." ",„....,1, .„e' i,i,,,...z,,,...._-.Tr J-- '- 3,•'• -•'--,-:,, _ ; .L?fr .iol• ......-..... ....._. .,._._...... 1 -„,:..:7,,,..,..,.....77-,,,..,:17.-:',"'":=......"-:,-,--17-,-,".';',.'-7--,...7.--,,,F22-r-.7.=aj,..,,,s1Kr,..,7-Zfil--,1 1 1..",s-Yii"...tat,318.^.7,,,,,•:•••......,,,-, ,,,-;zr4i.;,./sliiiiviccatirlar.,..,........,•;-,...,r_15477!-.7.7::F'...,:i.2,7< i 'th , _.........,E.,4.--:-:,,,,,___,,,„„,.„, ,.,,4,..:f•-,!.,„;.7.,...z.,,,,,,,'"-,,,;,,---"--i:-.,...: 64,,,,.,,..„„:,•„-a„.,,,,,,,,,'''',„,:,,,,-t,..v-.„"-......,-.-C,Irr...4TM___,,,,;...t1."...ti;,...........=".....-3".,7-"lt7.-L--7.,17,.3.7,...-4.-.77.1.7.I4°7•7•THTLitt",,E....-•.:-_-t:•: •,-t..1.,7E--;',..:„.'''.,-, . -* --'-•----------.....-::-- ------------ ' ::-.::=-7-22.1'"7,rf-7-:;', '...=_:_.siwitsviniitIthwArlstg,ectst '„:---.4..--: ...:-7--7-77'7--I'''.'":'"t. '..,-•- w r.:7:" .-5,''''''.-:'!.'..H'..".,:7.7:.•::::'.7'2.7-....f..7...f.'::::........:.:..-_-,...::_-_:-..,,-...:::,5.-4-ii-ti_ET-1( ti-iftfri.i.mt,"--..10 ittra Dujitmti.,,,,,,aro,T,-4,,,Rmt,troi,p4T,T.,....w„.................- -....—.• .— 0-- -t 1-- . - -• > . ..... 44.+4-. .•I•tOttarlwooD-ISEEs,cbillSkrtiR-Ss.,4tcOaliDisMe---- •--•------7,77-7::.•:",:-:'^:-.17-.--17,--1.:'t . ---"-'"''"-----•• 0 '.:,;;;;;;i:,,"if.„;;;;=' ._Nit.CLEAsttaw...wt:10342.."..---.•"•' " CC .._....._.... . ....... a. W •,,- , -•---- :.:4u):-t.....7..;aEii: ::,-..,,,,,;„.: ..•.-.:::::::„:.:.: -....,;.::::-.-----------,--:::.-7.•.,V.:777.-:-.,------ > , __-••.• 1,1.z..,-•-=.7:.--.7-- - '---",-r!... ---"---- ..:......,...._...,„., 04 '---- '-------.--!!.: .., .:. 74.t....4*.r::_, ,,,-,„;:,-.,,.--•••••:::••------,--; -- .' 0 i:„..-,•,^"..":.-.4.'"7=77."..;7.::.:7-'.11.22.:2'.7_4jusEnjw,..-71.7:1;,',...y.-....121:117.7.1-..i.':..-7;."...........:-a'..---...,i,4, . ,.,.ttp. .iig..,..,:.4ai."-".a.i.‘"-::::::..g:; .S,,,....--....,..,,„,..,.,..,3,,I.:t........,„ii.....,,,,kv„,,,,,,,,,..„,.,,,,,,,..,L',....:::,..„......".•......„____\ s,.. „.-../. / . 2 j---,-.....;;;; -,.„,..,......,......".0,Q.,....s. --,..„,,,,,,,,,,,i,":4—,,,,,,...;;;,.7”.„.......,.,,,,,,,....--,—........-.... i ,,tv.:=-4,....,..f=iin. ,.";.7.,.:C.iii:,,,:ori•$44.*.lt.,*,...‘"f...,_'!......-i,"..A.......v4:::.^,: ,-,"."'""77.'"'"...'"'""'""'1"="'"7'''''-''''... ......s7.----77'..* - o 7- 77 51"'' '''''''''''''""'‘``*"---"'"'41'""'"'"'""-''''''''''-''' -.""-::-:-"Illa-..'''-.------,---.=-- " ''''*:-4r------'^-;.-----o,--- -•.,t:-•,•;=',..-----,•-,-- -•-•,z,-.7,-,•--",..- ------------ o.--,----.,,-,--- ---.,-,---/; ....... .. .... s--....-.---,---:--------*,-,--------o,,,,o---,----...o.---...-..,...,,,,...--..........---liV•,*7 7 . ., 1 LI5a22. Ii. g .-•..--111,-.7:: 't-t potmo1..., •. .g21•50. "'.."--"*—/----"---S-.•"-.... >- :: , ,- — - . ifis 7:, .: _ _Z - __ - - , ---— ...., ...•,..,-.-....1. 0 d. .,, o b•CAlk i_;1..; • -- •. .--\1/;.--;:-:,WiY<' ..t.$1 /,::',:,•0?),,,;.' .'•,, tv-5040 CONSIRUCItal ACCESS ROAD.) \ . 'ILI.. WA. • ,' "..ri,,:',.....t1 SEE COY GTO PUS GOO---- l ' -b- •, ,, tlii 't ;. / ''‘'t,• "/ ..,„ 1 I I ' • ' ••-• i ,,,ftlif.'11 T ......... ,,•;• I AX LOT .. RUMOR TO DENNYOLLE I? . \.,,.....). 252.1051002 1 , -• N._ \ 1"1"-:1 i I I.A : 1) i '''"' S045 ,: CLOTS MOP 0065100(WS)5(1010 • .,./YA . ID*,,,,,arry ECOLOGY MOCK YOU. ' Ex 021.00611 Mu Et 27.0 %. IRS FARM FENCE If•,, •, ••••••,Tt• . ' t r,•,:•,.. /dr,sio Pm imas .0.,,2/012 tz,,,,. ,,, IIII . , 1,..• ,,,,, /". It.t''.././/4">,•„.. ____....._ .._ 1 ., oi , ' , .„, , o - -, --,• 0 02v, SECTION , At, a A .-..:.-J.4',3.:::;:j3;4:,...::. ,-Tt110:FAD 000 GERM FOR CONNECTION TOES CRANDO, NO SCALE CS .4 C, ::-""-- ••;-•• :•(it' SOC SCE 70202,S,ODA NOTES 0 SDECIIICARMS COD 02 PLAN - C‘,..%614.7P/CtS) Wag iii FEET :"it/ . ' • ' • , 5 o -"---2.2....5tr-7"; .. EX.HIBIT e _:. .City Ripley Lane North Storm System Improvement Prelfeet _ , ___ - ,. ... .._ ........,..a...... ..... -41...4.0“. err, c,Ty OF RIDLEY LANE H.STORM SYSTEM IMPROVEMENT rnoJecT N/00., Parametrix.• F:: ..„. .., ... .............-.....-....-...- —....-...........,-.--.."71r..rchia ..-......... ...... ..,„. 7.0rc R E N TON EMI! 3ir —!!:-.._ - No NEvrycli --.-Fip-,4-- .. /,,,,,,,,,,,,,,Ilul,COM. TESC/CONSTRUCTION ACCESS Mill m, wt.. !,,,,, :476.8.7.15 "----' 11,1M1111 • iliffililling AGREEMENT • For THE GYPSY SUB-BASIN/RIPLEY LANE NORTH STORM SYSTEM IMPROVEMENT PROJECT Between THE CITY OF RENTON And FOOTBALL NORTHWEST, LLC THIS Agreement for the Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project ("Agreement") is made and entered into this day of , 2008, by and between the City of Renton, Washington, a municipal corporation of the State of Washington, (the "City") and Football Northwest, LLC, a Washington limited liability company ("FNW"). WHEREAS, FNW is constructing the Seattle Seahawks Headquarters and Training Facility on property with King County Parcel Identification Numbers 2924059001 and 2924059015 located at 5015 Ripley Lane North in Renton, Washington, east of Lake Washington, west of Ripley Lane North on a site located north of Lake Washington Boulevard (the "FNW Site"); WHEREAS, an existing drainage system known as the Gypsy sub-basin drainage system conveys surface water runoff across the FNW Site to Lake Washington for a basin area located east of the property; WHEREAS, Ripley Lane North experiences flooding during significant storm events that limits use of the City street by the public and presents a public safety hazard; WHEREAS, the Gypsy sub-basin drainage system across the FNW Site had to be relocated and modified as part of the construction to accommodate the construction of the Seattle Seahawks Headquarters and Training Facility, and to maintain drainage across the FNW Site from the upstream tributary area; WHEREAS, the FNW storm system improvements consisted of installing storm pipes, catch basin structures, outlet structure, and other appurtenances to convey the existing runoff from the upstream tributary area; WHEREAS, the storm system improvements on the FNW Site needed to be designed and constructed in a manner to accommodate the existing condition runoff and the future condition runoff to accommodate the increased runoff due to upstream land use changes and transportation system improvements; • City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 WHEREAS, the additional cost associated with over-sizing the storm system improvements • to accommodate the future runoff condition will benefit a larger contributory area and is a necessary component to solving flooding on Ripley Lane North; WHEREAS, FNW is responsible for funding the work associated with the FNW Site's storm system improvements necessary to accommodate the existing condition runoff and the City is responsible for funding the costs associated with the over-sizing of the storm system to accommodate the future condition runoff; WHEREAS, the City proposes additional upstream storm system improvements that will connect into the storm system improvements made by FNW on the FNW Site; WHEREAS, the additional upstream storm system improvements will be funded separately by the City and the work will require an easement for construction, operation and maintenance of the additional improvements on the FNW Site, along with coordination of initial construction and maintenance with FNW's construction and operation of the Seattle Seahawks Headquarters and Training Facility on the FNW Site; and WHEREAS, ground lessor Port Quendall Company has reviewed this Agreement and has indicated its willingness to sign the permanent easement contemplated herein. NOW THEREFORE, in consideration of the mutual covenants herein it is agreed as follows: • SECTION 1: PURPOSE AND SCOPE The purpose of this Agreement is to establish the cost share reimbursement to FNW for the over-sizing of the storm system improvements constructed by FNW as part of the Seattle Seahawks Headquarters and Training Facility construction. The Agreement also includes the following: • Assignment of maintenance for the storm system improvement, • The transfer of ownership of the improvements to the City for the FNW storm system improvements on the FNW Site and, • The easement rights for construction, operation, maintenance and access for the City for the additional upstream storm system improvements to be constructed by the City on the FNW Site. The scope of the storm system improvements constructed by FNW on the FNW Site are generally shown on Exhibit A — (Site Plan) and described in Exhibit B — (Bill of Sale and Final Cost Data) attached hereto, which include the following: • 67-linear feet of 72-inch reinforced concrete pipe • 525-linear feet of 60-inch reinforced concrete pipe • 57-linear feet of 36-inch corrugated polyethylene pipe • One 108-inch Type 2 Catch Basin • Two 96-inch Type 2 Catch Basins • One 84-inch Type 2 Catch Basin • Inlet and outlet facilities and appurtenances 2 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 The City will be constructing additional storm system improvements to the east of the FNW • Site, which will not be located on the FNW Site as shown on Exhibit C —Ripley Lane North Storm System Improvement Project. The scope of the additional upstream storm system improvement to be constructed by the City on the FNW Site is shown on Exhibit C, which generally includes the following: • One 10-ft wide by 28-ft long reinforced cast-in-place vault structure • 40-linear feet of 36-inch high-density polyethylene pipe • Inlet facilities, maintenance access improvements and appurtenances • Temporary construction access • Other improvements related to site restoration The City will construct the additional storm system improvements in accordance with the final construction plans and construction contract specifications for the Ripley Lane North Storm System Improvement Project(SWP-27-3375). SECTION 2: TERM AND EFFECTIVE DATE: n This Agreement shall remain in full force and effect and be binding on both parties hereto upon accomplishment of the following: a) The storm system improvements constructed by FNW on the FNW Site are completed and a final inspection and acceptance by the City is completed. b) Final 34-inch by 22-inch as-built mylar drawing(s) to scale with a Professional Land • Surveyors certification stamp along with construction details and profile plans of the II FNW storm system improvementsare provided to and accepted bythe City, along with a Bill of Sale in the form shown at Exhibit B. c) An easement (Exhibit D) in favor of the City with legal description and figure for construction, operation, maintenance of and access to the improvements shown on Exhibit C hereto in an area shown on Exhibit C hereto and the storm system improvements constructed FNW for access and maintenance purposes as shown in Exhibit A and described in Exhibit B is provided and accepted by the City. d) This Agreement is approved by the City Council of the City of Renton. e) This Agreement is signed by FNW and provided to the City. f) FNW pays all remaining City Utility System Development Charge fees, subject to the cost sharing provision in Section 4 of this Agreement. g) The City executes this Agreement and the easement (Exhibit D) is recorded. The City of Renton will assume ownership, maintenance and replacement responsibility of the improvements storm system improvements constructed by FNW as shown on Exhibit A, described in the Bill of Sale (Exhibit B) and the additional storm system improvements located on the FNW Site to be constructed by the City and as shown on Exhibit C, all of which is within the easement (Exhibit D). • 3 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\I 200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 SECTION 3: CONSTRUCTION,PERMITS AND WARRANTY: II/ FNW is responsible for constructingthe FNW storm system improvements on the FNW Site P y p (described in Exhibits A and B) in accordance with the plans that were reviewed and approved by the City. FNW is responsible for obtaining and complying with any and all State and Federal permits required for said storm system improvements. FNW shall be responsible for satisfying any permit mitigation requirements and will indemnify the City against any claims or legal actions from third parties arising from the original construction of the storm system improvements constructed by FNW on the FNW Site. FNW shall warrant the construction of the storm system improvement that will be transferred to the City, against material defects or faulty construction of the improvements, for a one-year period following approval of this Agreement. The City will be responsible for constructing the additional upstream storm system improvement located on the FNW Site and further east of the FNW Site in accordance with City standards. The City will be responsible for obtaining and complying with any and all State and Federal permits required for the construction of the additional upstream storm system improvements located on the FNW Site and further east of the site. The City shall be responsible for satisfying any permit mitigation requirements and shall indemnify FNW and Port Quendall Company against any claims or legal actions arising from the additional upstream storm system improvements to be constructed by the City on the FNW Site. SECTION 4: SITE CONTAMINATION: • Soil on the FNW Site was the subject of remediation activities prior to and in conjunction with the development work related to the FNW's construction of the Seattle Seahawks Headquarters and Training Facility. The remediation work was performed to satisfy the requirements specified in the Prospective Purchaser Consent Decrees (Order Number DE92TC-N335 as amended) between Washington State Department of Ecology and Port Quendall Company, Restrictive Covenants, and the Cleanup Action Plans (ThermoRetec, 2000b, and ThermoRetec, 2000c). The cleanup activities related to the capping and institutional controls are outlined in the Engineering Design Report (EDR; RETEC, 2006) and were required to complete cleanup obligations in accordance with the Consent Decrees. A partial Certificate of Completion letter was issued by Ecology on April 10, 2006. As outlined in the Soils Management Plan, FNW Site maintenance staff and contractors shall follow the procedures outlined in the Soils Management Plan for maintenance and construction activities on the FNW Site. The City assumes the material installed in and around the FNW storm system improvements complies with the Consent Decrees (Order Number DE92TC-N355 as amended) and Cleanup Action Plans. If contamination is found in the City's easement area in the future that is in excess of concentrations allowed in the Cleanup Action Plans, and is attributable to the contamination that existed on the site prior to the site contamination remediation, then FNW shall be responsible for any required cleanup. Cleanup activities shall be in compliance with applicable laws and regulations. • 4 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 SECTION 5: PROJECT COST SHARE AND FUNDING: • The City shall reimburse FNW for the over-sizing of the storm system improvements constructed by FNW by reducing the amount of the City Water Utility System Development Charge fee that is owed by FNW for the Seattle Seahawks Headquarters and Training Facility. The City's share of the cost associated with over-sizing of the storm system improvements constructed by FNW as described in Section 1 and shown on Exhibit A and B will be based upon the percent of increase in surface water runoff from the tributary basin between the existing land use runoff (148.6 cubic feet per second) and the future land use condition runoff for the 100-year storm (198.9 cubic feet per second), as determined by a hydrologic analysis performed by Parametrix LLC (June 15, 2007). The following are cost share percentages allocated to the storm system improvements constructed by FNW as described in SECTION 1 and shown on Exhibit A and B. Existing Future Calculation to Cost Share Participants Land.Use " Land Use Determine Flow Flow Cosi t Share - Percentage e Percentage FNW 148.6 cfs - 148.6/ 198.9 74.7% City - 50.3 cfs 50.3/ 198.9 25.3% The City will reimburse FNW for the City cost share percentages shown above. • Accordingly, the City will reimburse FNW for 25.3% of the actual cost of$591,106.41, as shown in Exhibit B, that was associated with the storm system improvements constructed by FNW as described in Section 1 and shown on Exhibit A and B on the Seattle Seahawks Headquarters and Training Facility site. The City may effectuate this reimbursement by reducing the City Water Utility System Development charge owed by FNW, for the Seattle Seahawks Headquarters and Training Facility site development by $149,550. The City will be responsible for any reallocation or reimbursement between the City Surface Water Utility and the City Water Utility for the $149,550 Water Utility System Development Charge fee that is being waived by this Agreement. SECTION 6: TRANSFER OF OWNERSHIP AND MAINTENANCE The transfer of ownership and assumption of maintenance for the storm system improvements constructed by FNW, as described in Section 1 and shown on Exhibits A and B, on the Seattle Seahawks Headquarters and Training Facility site, will occur upon completion of the conditions listed in Section 2 above. • 5 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 SECTION 7: PAYMENT • FNW will receive a reduction of the City Water Utility System Development charge owed by FNW for the Seattle Seahawks Headquarters and Training Facility site development by $149,550 upon the payment of all remaining City Utility System Development Charges, that are owed by FNW and recording of the easement as described in Section 2 above and attached as Exhibit D hereto. SECTION 8: COORDINATION AND PROJECT MANAGEMENT ASSIGNMENT The City's representative for this Project is: Ron Straka City of Renton Surface Water Utility Engineering Supervisor 1055 South Grady Way Renton, WA 98057 (425-430-7248) FNW's representative for this Project is: Elaine Wine, Project Manager Football Northwest 505 Fifth Avenue South, Suite 900 Seattle, WA 98104-3821 (206-342-2397) • SECTION 9: PROJECT AUDIT AND PROJECT ACCEPTANCE Upon request by the City, FNW shall provide the City with documentation of costs and payments described in Exhibit D hereto. If this Agreement is audited, FNW shall provide reasonable additional documentation required by any such audit. SECTION 10: AMENDMENTS Any amendments or modifications to this Agreement shall be made in writing and signed by the parties hereto, and neither the City nor FNW shall be bound by verbal or implied agreements made by any official, agent or representative of either the City or FNW with respect to the subject matter of this Agreement. SECTION 11: TERMINATION In the event the City Council does not approve this Agreement, unless otherwise mutually agreed, FNW shall own and maintain the storm system improvements constructed by FNW on the FNW Site and allow upstream tributary runoff to be conveyed across the FNW Site. The storm system will remain as a privately owned and maintained storm system on the FNW Site until such time as the City or other public agency thereafter accepts the improvements. • 6 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp City of Renton—Football Northwest LLC Gypsy Sub-basin/Ripley Lane North Storm System Improvement Project Agreement 03/27/08 SECTION 12: WAIVER • No waiver by either party of any term or condition of this Agreement shall be deemed or constructed as a waiver of any other term or condition. No waiver shall be effective unless in writing. THIS AGREEMENT AUTHORIZED BY THE CITY COUNCIL ON , 2008 Bonnie Walton, City Clerk APPROVED BY THE MAYOR ON , 2008 Denis Law, Mayor Approved as to legal form: Larry Warren, City Attorney • APPROVED BY FOOTBALL NORTHWEST, LLC. ON , 2008 Lance Lopes, Vice President, General Counsel EXHIBITS: Exhibit A: Site Plan showing FNW storm system improvements. Exhibit B: Bill of Sale and Final Cost Data for the FNW storm system improvements to be transferred to City. Exhibit C: City Ripley Lane North Storm System Improvement Project to be constructed on FNW site that will connect into the FNW storm system improvements and extend to the east of the FNW site. Exhibit D: Easement to the City from FNW for access to and maintenance of the FNW storm system improvements constructed on the FNW Site to be transferred to the City and the City storm system improvements to be constructed by the City on the FNW site. 11111 7 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200-Agreements\Vulcan\City-FNW Agreement 080320 FINAL.DOC\RStp . I 1 . . 1 . � . ? . . I ?._.1-1.-..-.1-4_-_,-_.1.___,..___4_,.,_1. ✓' 1 ,' 1.l 7.,_, . ?.....--....-1.-Y--.„7-1-_.-1 I " _i��..y_�s '�.i-:i-''--p--a`;'�—' op©! i i: l I `I N. .. I I ,i tf.,, !' MAGNUSSON k. I I" KLEMENCIC I r .. 'I n5soaacs � HIBIT Ao FNW Sitey i ;I ?. Plan Storm System Improvements i ' ' ' : I • - . . .,.,.. :. .: I ' , 'r• . ' ': 00 • I :i x • r0 I -m EI`C1 bpY Z Z • ; R�r,-' :ii is ueisti tri a.sl' .E O an.re a 0.11115030310.MM.. j : ' ..'' JI f 1 1.ilI .. ! _u mo um I i ;I l • f............_.4..-. __ WU - _ b 0 • Vii: .,✓ __ Y., `m6i ;;'.i`m='N^FI'm='.m"-...., �^'_. _ . �,,,m.,.m ... .-._ .,. • , t' • ,11 /- O__[Uw:!. _ __ YI'(I ill I� �� ' N1�1-�ii�16 A•�' r. '.'.y IF it^'9if.5d IY1 „ �__- .. ter to :___-_ -'i •Jji: ' "'.tdd 1 / .fOS w'• -SN Ru�iB 11ro 10 I .-::,,i.___:.,2,_._..____"___�____._ �. OW xrMlNao ____ _ .. ., ,1 I IE. EY 041 • - - - _ ! - 1.: - r .0asu•� I w _ ! _ 1.1 x NMfA I _ ., _ — t 0E010 MI citouttRt TO clif 513301095 I. 0 ! GYPSY SUBSASIN v?. -- - - 7.----- I STORM DRAIN n.. _ _ _ _ - ' to •o tp la I + - RELOCATION • 1 •`.aeiCi PUN 1/ZOfl.009 s.onnru upur,000 Par,WA•CIVIL NIefcCIV11POP F.NIS40N9.per11.0.J.i0.1.WoSIrrcrVC1015r•CWOI.001. rw.uxPL0i51EEr VuexlprpV! CG301.... • , „ III 411 1 EXHIBIT B BILL OF SALE AND FINAL • COST DATA 109 VULCAN fr- March 20, 2008 Ronald J.Straka Surface Water Utility Engineering Supervisor Renton City Hall-5th Floor 1055 South Grady Way Renton WA 98057 Re: Gypsy Sub basin Stomwater Improvement Project Dear Ron, This letter is to certify that the sum of$591,106.41 has been paid by Football Northwest towards the design and construction of the Gypsy Sub basin Stormwater Improvement project. The costs incurred are as follows: a .. Construction: $521,960.00 Design: $ 69,146.41 Additional accounting of this effort is available on request. Sincerely, Ray Colliver VP Design and Construction Football Northwest cc: Elaine Wine,Vulcan Inc. Lance Lopes, 505 Fif..,r..;S s:,;ie SJoo Originals sent via:Method S eai(k. `/1/( 98104 Copies sent via: Method • ).ig.,,•,2000 Tel ",.'.342 30130 Pax • Return Address: City Clerk's Office City of Renton 1055 South Grady Way Renton, WA 98055 BILL OF SALE Proj Name: Property Tax Parcel Number: Project File#: Street Intersection: Address:60/0"itedp4py 44'!'yy,- N Reference Number(s)of Documents assigned or released:Additional reference numbers are on page Grantor(s): Grantee(s): 1. PO/er QU//V 'GG Con1f'f4NY 1. City of Renton,a Municipal Corporation 2. A/aN ell-W4654"S7 The Grantor,as named above,for,and in consideration of mutual benefits,hereby grants,bargains,sells and delivers to the Grantee,as named above,the following described personal property: WATER SYSTEM: Leneth Size Type L.F.of Water Main • L.F.of Water Main L.F.of Water Main each of " Gate Valves each of " Gate Valves each of Fire Hydrant Assemblies SANITARY SEWER SYSTEM: Length Size Type L.F.of Sewer Main L.F.of " Sewer Main L.F.of Sewer Main each of " Diameter Manholes each of ' Diameter Manholes each of " Lift Stations STORM DRAINAGE SYSTEM: Length Sire Type L.F.of Storm Main L.F.of Storm Main L.F.of Storm Main 777+•Ce each of Storm Inlet/Outlet each of Storm Catch Basin each of Manhole STREET IMPROVMENTS: (Including Curb,Gutter,Sidewalk,Asphalt Pavement) Curb,Gutter,Sidewalk L.F. Asphalt Pavement: SY or L.F.of Width STREET LIGHTING: #of Poles By this conveyance.i;rantor will warrant and defend the sale hereby made unto the(nantce against all and even•person or aer,ons. whomsoever.luo idly claiming or to claim the same This conveyance shall hind the heirs,executors.administrators and assigns forever O:\Forms\PBPW\BILLSALE2.DOC\bh Page 1 4111 • IN WITNESS WHEREOF,said Grantor has caused this instrument to be executed this day of ,20_. INDIVIDUAL FORM OFA(.7h'NOWLEDGMENT Notary Seal must be within box STATE OF WASHINGTON )ss COUNTY OF KING I certify that I know or have satisfactory evidence that signed this instrument and acknowledged it to he his/her/their free and voluntary act for the uses and purposes mentioned in the instrument Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: REPRESENT.4771:E FORM OFACKNOWLEDGMENT Notary Seal must be within box STATE OF WASHINGTON )SS COUNTY OF KING I certify that I know or have satisfactory evidence that signed this instrument,on oath stated that he/she/they was/were authorized to execute the instrument and acknowledged it as the and • of to be the free and voluntary act of such party/parties for the uses and purposes mentioned in the instrument. Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: CORPORATE FORM OF ACRNO U'L EDGi l ENT Notary Seal must be within box STATE OF WASHINGTON )SS COUNTY OF KING On this day of ,20`,before me personally appeared to me known to be of the corporation that executed the within instrument,and acknowledge the said instrument to be the free and voluntary act and deed of said corporation,for the uses and purposes therein mentioned,and each on oath stated that he/she was authorized to execute said instrument and that the seal affixed is the corporate seal of said corporation. Notary Public in and for the State of Washington Notary(Print) My appointment expires: Dated: O:1Forms\PBPW\BILLSALE2.DOC1bh Page 2 • • Attachment A Gypsy Sub Basin storm drainage system components: • 67-linear feet of 72-inch reinforced concrete pipe • 525-linear feet of 60-inch reinforced concrete pipe • 57-linear feet of 36-inch corrugated polyethylene pipe • One 108-inch Type 2 Catch Basin • Two 96-inch Type 2 Catch Basins • One 84-inch Type 2 Catch Basin • Inlet and outlet facilities and appurtenances including riprap armor at shoreline • • Return Address: City Clerk's Office City of Renton 1055 South Grady Way Renton,WA 98055 Title: UTILITY EASEMENT Property Tax Parcel Number: 2924059015 Project File#: Street Intersection or Project Name: Reference Number(s)of Documents assigned or released:Additional reference numbers are on page Grantor(s): Grantee(s): 1. Port Quendall Company,a Washington 1. City of Renton,a Washington municipal corporation corporation Legal Description: Portion of City of Renton Lot Line Adj LUA-00-044 as recorded under King Cty No.20010105900005. Full legal is attached at Exhibit A. Grantor's Tax Parcel No.: 2924059015 Grantee's Tax Parcel No.: N/A • SEADOCS-#50895173-v1-fnw_city_1nw_gypsy_creek dtainagc eascment.DOC\ Page 1 FORM 03 0013/bh/CA2-21-97 • • This UTILITY EASEMENT("Easement")is entered into as of the day of 3008,by and between Port Quendall Company,a Washington corporation("Grantor")and the City of Renton,a Washington municipal corporation("Grantee"). I. RECITALS A. Grantor is the fee owner of certain property in the City of Renton through which an existing drainage system known as the Gypsy sub-basin drainage system conveys surface water runoff. B. Grantor is the ground lessor of said property to Football Northwest LLC("FNW"). C. Grantee and FNW are parties to the certain Agreement for the Gypsy Subbasin/Ripley Lane North Storm System Improvement Project(the"Agreement"). The Agreement contemplates that FNW will convey storm system improvements to the City of Renton and that the City of Renton will receive an easement for maintenance and access to those improvement. D. To further the Agreement,Grantor wishes to convey this easement to Grantee City of Renton for the location of,maintenance of,and access to the storm system improvements as described in the Agreement. Now,therefore, for good and valuable consideration,the receipt and sufficiency of which is hereby acknowledged,the parties agree as follows: • II. AGREEMENTS 1. Grant of Easement. Grantor hereby grants,bargains,sells and conveys to Grantee,its successors and assigns,a perpetual,nonexclusive easement for storm system utility purposes over,under,through,across and upon the easement area as legally described at Exhibit A hereto and shown for informational purposes on the sketch at Exhibit B attached hereto(the"Easement Area"),for the purpose of reconstructing,repairing,replacing,operating and maintaining the storm system utilities and storm system pipelines,catch basins,and inlet and outlet facilities and appurtenances,right of ingress and egress thereto without prior institution of any suit or proceedings of law as described below. 2. Use of Easement. Grantee shall keep Grantee's storm system utility facilities in good and serviceable condition. Grantor,its employees, contractors,and agents shall not use the easement area in any way that damages Grantor's property or the improvements located thereon. 3. Maintenance. Grantee shall be responsible for maintenance and all costs of maintenance of Grantee's storm system utility facilities. All repairs shall be made in compliance with all applicable laws,ordinances,codes and regulations. Except for emergencies,Grantee shall give reasonable notice to Grantor or FNW of any maintenance or repair activities and shall schedule maintenance and repair activities in consultation with Grantor or FNW in order to minimize inconvenience to Grantor or FNW's use of the Easement Area or abutting property. To the extent possible,Grantee shall avoid any staging or damage to the fields developed for professional football use on the Easement Area or adjacent property. After any maintenance or 50895282.1 • • repair of Grantee's storm system utility facilities,Grantee shall restore Grantor's property as nearly as practicable to the condition prior to the maintenance or repair activity. Any restoration shall be consistent with the capping and institutional controls required by the Washington State Department of Ecology requirements imposed pursuant to Prospective Purchaser Consent Decree Order No.DE92TC-N335 as amended(the"Consent Decree"). 4. New Structures. After the initial construction as described in the Agreement,Grantee shall not enlarge or build any new structures in the Easement Area without the express written consent of Grantor,which consent shall not be unreasonably be denied or delayed. 5. Reservation of Other Rights. Grantor retains,reserves and shall continue to enjoy the use of the Easement Area for any and all purposes which do not unreasonably interfere with the rights granted to Grantee herein. Without limiting the generality of the foregoing,Grantee shall not a. Erect or maintain any buildings within the Easement Area; b. Plant trees or other vegetation with deep root patterns that would likely cause damage to the utilities within the Easement Area; c. With the exception of the professional football practice fields in a portion of the Easement Area, the irrigation systems for those practice fields,and the barriers and other requirements of the Consent Decree,Grantor shall not develop,landscape or beautify the Easement Area in any way that would unreasonably increase the costs to Grantee of restoring the Easement Area and any private improvements therein; d. Perform construction activities that would disturb the compaction of or unearth Grantee's storm system utility facilities;or • e. Blast within fifteen(15)feet of the Easement Area. 6. Liens. Grantee shall not allow any liens or encumbrances of any kind whatsoever upon the Easement Area. 7. Governing Law. This Easement shall be governed by the laws of the State of Washington. 8. Binding Effect. The easements and covenants herein shall run with the Iand and be binding upon and inure to the benefit of the parties hereto,and their respective successors in interest. 9. Amendments. This Easement may not be modified or amended without prior written approval of the parties hereto,or their respective successors or assigns. 10. Authority. All parties executing this Easement in a representative capacity covenant that all necessary approvals have been granted by any body required to provide them with the authority to enter into this Easement. 11. Attorneys Fees. In the event either party believes the other party is in default under the terms of this Easement,the party shall provide notice and reasonable opportunity to cure to the allegedly defaulting party. The parties shall meet and attempt to resolve any alleged default prior to filing suit. If after notice and opportunity to cure,a party seeks to enforce this Easement in court,the most prevailing party in such action shall be entitled to its reasonable attorneys fees, expert fees,and costs incurred both during initial suit and on any appeal. 50895282.1 • • 0 12. No Third Party Beneficiaries. The parties agree that this Easement is solely for the benefit of the parties hereto,and their successors and assigns,and shall not be construed to confer any rights or enforcement rights to any third party. IN WITNESS WHEREOF,this Easement is executed as of the date first shown above. GRANTOR: GRANTEE: PORT QUENDALL COMPANY, CITY OF RENTON, a Washington corporation a Washington municipal corporation Name: Name: Its: Its: STATE OF WASHINGTON ss. COUNTY OF • I certify that I know or have satisfactory evidence that is the person who appeared before me,and said person acknowledged that said person signed this instrument,on oath stated that said person was authorized to execute the instrument and acknowledged it as the of PORT QUENDALL COMPANY,a Washington corporation,to be the free and voluntary act of such corporation for the uses and purposes mentioned in the instrument. Dated this day of ,2008. (Signature of Notary) (Legibly Print or Stamp Name of Notary) Notary public in and for the state of Washington,residing at My appointment expires 50895282.1 0 s 1 1 il STORM SEWER LINE EASEMENT DESCRIPTION THAT PORTION OF"BAXTER PARCEL NORTH"OF CITY OF RENTON LOT LINE ADJUSTMENT NO. LUA-00-044, RECORDED JANUARY 5, 2001 UNDER RECORDING NO. 20010105900005, IN KING COUNTY, WASHINGTON, CONTAINING 15,116 SQUARE FEET, MORE OR LESS, AND LYING WITHIN A STRIP OF LAND, VARYING IN WIDTH, AND HAVING A CENTERLINE MORE PARTICULARLY DESCRIBED AS FOLLOWS: COMMENCING AT THE MOST EASTERLY CORNER OF SAID`BAXTER PARCEL NORTH"; THENCE SOUTH 30°31'48"WEST 133.79 FEET ALONG THE LONG CHORD OF A 50.00 FOOT OFFSET TO A SPIRAL CURVE,SAID SPIRAL CURVE BEING THE CENTERLINE OF RIGHT OF WAY FOR THE NORTHERN PACIFIC RAILROAD COMPANY; THENCE SOUTH 30056'16" WEST 479.51 FEET ALONG THE MOST EASTERLY LINE OF SAID "BAXTER PARCEL NORTH", ALSO BEING THE WEST MARGIN OF RIGHT OF WAY FOR THE NORTHERN PACIFIC RAILROAD COMPANY, TO THE TRUE POINT OF BEGINNING OF SAID EASEMENT CENTERLINE; THENCE NORTH 42°59'21" WEST 10.41 FEET ALONG SAID CENTERLINE OF A STRIP OF LAND 20.00 FEET IN WIDTH,HAVING 10.00 FEET OF SUCH WIDTH ON EACH SIDE OF SAID CENTERLINE; THENCE SOUTH 30°56'16"WEST 76.17 FEET ALONG SAID CENTERLINE OF A STRIP OF LAND 26.50 FEET IN WIDTH HAVING 10.00 FEET OF SUCH WIDTH EAST OF CENTERLINE,AND 16.50 FEET OF SUCH WIDTH WEST OF CENTERLINE; THENCE CONTINUING SOUTH 30°56'16"WEST 28.09 FEET ALONG SAID CENTERLINE OF A STRIP OF LAND 32.50 FEET IN WIDTH HAVING 10.00 FEET OF SUCH WIDTH EAST OF CENTERLINE,AND ID 22.50 FEET OF SUCH WIDTH WEST OF CENTERLINE; THENCE NORTH 54°01'34" WEST 601.35 FEET ALONG SAID CENTERLINE OF A STRIP OF LAND 20.00 FEET IN WIDTH,HAVING 10.00 FEET OF SUCH WIDTH ON EACH SIDE OF SAID CENTERLINE TO THE TERMINUS OF THIS EASEMENT CENTERLINE; SAID TERMINUS BEING SOUTH 73°30'43" WEST 898.80 FEET FROM THE POINT OF COMMENCEMENT; THE SIDELINES OF THIS EASEMENT SHALL BE SO SHORTENED OR LENGTHENED SO AS TO MEET AT ANGLE POINTS; SITUATE IN GOVERNMENT LOTS 4, IN THE SOUTHWEST QUARTER OF SECTION 29,TOWNSHIP 24 NORTH,RANGE 5 EAST,W.M.,IN THE CITY OF RENTON,KING COUNTY,WASHINGTON. FOOTBALL NORTHWEST BAXTER PROPERTY STEVEN A HITCHINGS,P.L.S. BRH JOB NO.96145.07 MARCH 1 I,2008 O -; ;-' ; BUSH,ROED&HITCHINGS,INC. 2009 MINOR AVENUE EAST i • i 1 MISTY COVE CONDOMINIUM COMPLEX I i N I \ / b, ,)1�• S30°3r48'W 133.79' .c i.. LONGTO CSPIRAHORDC OF OFFSET L URVE serypa.. ZI . G(V M19 - 0. 0 1,p, 0 J6 VJ 0 Str! q . At' th• Sal a QU V m C a o� m Z Z/ EX/STING BU, 0 w LDING a) T F CC f 0, Z • 1 yN42.59'21"W m0 10.4T a 72" I-:1 OUTFALL Ian 3 1 J� i POINT of �� - '----� m. TERMINATION N54'OT34"W -- mp 601.35' --.I Hn 16.50'--�11.-- 1 26.50' I :-: q 120 60 0 120 I Alf SCALE 1"=120' �2?•50'-�'I O..-. —10' w�A.y�T° N o A_ °i y BUSH,ROED&HITCHINGS,INC. v �►�� CIVIL ENGREERS&LAND SURVEYORS A 2009 MINOR AVE E (206)323-4144 �w ',1 .11' SEATTLE,WA 98102-3513 , BRH JOB NO.96145.07 3-3-08 '++�\(��,11. REVISED 3-11-08 -a-A� I° owwE- 1 ,/ 0 /VI • STORM SEWER EASEMENT SKETCH PREPARED FOR: FOOTBALL NORTHWEST • BAXTER PROPERTY PROJECT RENTON,WA 410 s. PROJECT COST SHARE WORKSHEET Ripley Lane N Storm System Improvement Project(Gypsy Subbasin Drainage) On Seahawk's Site (60-inch to 72-inch downstream storm system): $ 591,106.41 =Actual Cost to Design/Construct Downstream 60-inch storm system (Seahawks) Cost Share% (See Note 1) Design/Constr. Seahawks' 0.747 $ 441,556.49 WSDOT 0.214 $ 126,496.77 Renton 0.039 $ 23,053.15 Total: $ 591,106.41 Ripley Lane N. (Estimated Costs) Preliminary Cost Estimate: $ 200,816.00 $ 1,721,575.90 Cost Share% (See Note 1) Design Est. Construction Design/Est. Constr. WSDOT 0.287 $ 57,634.19 $ 494,092.28 $ 551,726.48 Renton 0.713 $ 143,181.81 $ 1,227,483.62 $ 1,370,665.42 Total: $ 200,816.00 $ 1,721,575.90 $ 1,922,391.90 Notes: 1. Cost share percentages are based upon 100-yr flow for the Gypsy Subbasin Drainage 2. Ripley Lane N design cost include original consultant contract amount and $17,500 addendum#1. 3. The Ripley Lane N. project total cost estimate may change once the actual low bid • is awarded. The cost estimate includes a 10% contingency 4. The City will pay WSDOT's cost share % of the Seahawks 60"storm system. WSDOT shall fully reimburse Renton for their share of the Seahawks' 60-inchdownstream pipe by paying for more of the construction cost associated with the upstream storm system improvements. 5 The Seahawk's cost share is based upon actual cost information provided by Vulcan on 3/20/08 6. The WSDOT agreement increases the Ripley Lane cost share percentage for WSDOT to reimburse the City for the City's payment of the WSDOT share of the Sehawk 60"storm system. The following totals are WSDOT Contributing Funds: WSDOT portion of Sehawks 60-inch storm system: $ 126,496.77 WSDOT portion of Ripley Lane N Design: $ 57,634.19 WSDOT portion of Estimated Ripley Lane N Construction Cost: $ 494,092.28 Total WSDOT Cost Share: $ 678,223.25 Total Percentage WSDOT is to contribute to Ripley Lane N. Construction: = (WSDOT Contributing Funds Total)/(Estimated Construction) = 100x $ 678,223.25 divided by $ 1,721,575.90 39.39549% Total City of Renton Cost Share: $ 1,393,718.57 • Total Seahawks Cost Share: $ 441,556.49 Total City/WSDOT/Seahawk Project Cost: $ 2,513,498.31 H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3375 Ripley Lane North-Gypsy Creek Flooding Project\1200- Agreements\080321-CostShareFinal-WS DOT-FN W.xls Y CITY OF RENTON COUNCIL AGENDA BILL AI #: 7, ,tet, • Submitting Data: Public Works For Agenda of: Dept/Div/Board.. Utility Systems Division/Surface April 14, 2008 Water Utility Staff Contact Ron Straka(ext. 7248) Agenda Status Allen Quynn (ext. 7247) Consent X Subject: Public Hearing.. Addendum No. 1-08 to CAG-07-065, 2008 Mosquito Correspondence.. Abatement Program Ordinance Resolution Old Business Exhibits: New Business Issue Paper Study Sessions Addendum Information Recommended Action: Approvals: Council Concur Legal Dept Finance Dept X Other Fiscal Impact: 41• Expenditure Required... $43,752.60 Transfer/Amendment Amount Budgeted $50,000 Revenue Generated Total Project Budget $50,000 City Share Total Project SUMMARY OF ACTION: The Surface Water Utility requests the Council authorize the Mayor and City Clerk to execute Addendum No. 1-08 to the 2007-2008 Mosquito Abatement Program contract, in the amount of $43,752.60. The addendum would authorize Whitworth Pest Solutions, Inc. (Whitworth), sole- source provider of the 2007-2008 Mosquito Abatement Program, to apply adulticide in uplands areas east of Panther Creek Wetlands in the Talbot Hill area (Task 1). In addition, Whitworth will apply larvicide to City stormwater facilities, irrigation facilities and catch basins for the control of mosquitoes (Task 2). Addendum No. 1-08 to the 2007-2008 Mosquito Abatement Program will be funded through the approved Surface Water Utility 2008 capital improvement project budget account: The approved budget for the 2008 Mosquito Abatement Program is $50,000. STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to sign Addendum No. 1-08 to the 2007-2008 Mosquito Abatement contract with Whitworth Pest Solutions, Inc., in the amount of$43,752.60. • H:\File Sys\SWP- Surface Water Projects\SWP-27- Surface Water Projects(CP)\27-2000 Mosquito Abatement Program\2008 Program\2008 AgendaBill.doc\AQtp ti`cY O PUBLIC WORKS DEPARTMENT MEMORANDUM DATE: April 3, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: _3('1 Denis Law, Mayor FROM: Gregg Zimmerman,,,Administrator STAFF CONTACT: Ron Straka, Surface Water Utility Supervisor (ext. 7248) Allen Quynn, Surface Water Utility Engineer (ext. 7247) SUBJECT: Addendum No. 1-08 to CAG-07-065, 2008 Mosquito Abatement Program with Whitworth Pest Solutions, Inc. ISSUE: Should the Council authorize the Mayor and City Clerk to execute Addendum No. 1-08 to the 2007-2008 Mosquito Abatement Program contract (CAG-07-065), in the amount of • $43,752.60. The addendum would authorize Whitworth Pest Solutions, Inc. (Whitworth), sole-source provider of the 2008 Mosquito Abatement Program, to apply adulticide in the areas upland and east of the Panther Creek Wetlands (i.e., Talbot Hill area) and apply larvicide to City stormwater facilities, irrigation facilities, and catch basins for the control of mosquitoes? RECOMMENDATION: Approve and execute Addendum No. 1-08 to the 2007-2008 Mosquito Abatement Program contract, in the amount of$43,752.60, with Whitworth as a sole-source provider of pest control consultant services for the 2008 Mosquito Abatement Program. BACKGROUND: Whitworth Pest Solutions has been the sole-source provider of the pest control consultant services for the City of Renton Mosquito Abatement Program since 1990. This addendum is proposed for the continued use of adulticide to treat adult mosquitoes in the areas upland and east of the Panther Creek Wetlands. In addition, the contract will include the application of larvicide to City stormwater ponds and vaults, irrigation ponds, and catch basins. This is the third year the City has been using larvicide to treat City-owned irrigation and • stormwater ponds and vaults. In 2006, the City initiated the Mosquito Larvicide Program Council/Whitworth Add 1-08 CAG-07-065 April 3,2008 Page 2 of 3 under the advice of the Washington State Department of Health in response to the • anticipated arrival of the West Nile virus in our state. West Nile virus is a mosquito- borne virus that is spread to humans by the bite of an infected mosquito and not by person-to-person contact. No human cases of West Nile virus were reported in Washington State in 2007. In an effort to reduce the risk of human infection, the City has developed a response plan that includes larviciding City stormwater facilities, irrigation facilities, and catch basins, if needed, with Bacillus sphaericus. The response plan will augment the Department of Health program, which emphasizes prevention as the best protection from West Nile virus. Larvicide treatment will be conducted in accordance with the City's Aquatic Mosquito Control Permit or as directed by the Department of Health. The total expenditure required for the 2008 Mosquito Abatement Program contract is $43,752.60, and includes the following tasks: Task 1 (Treatment of Panther Creek Wetlands) Whitworth will apply an Environmental Protection Agency (EPA) registered insecticide spray to brush and other upland vegetation, using a gasoline-powered, backpack- mounted, portable fogger. The applications will be conducted at a maximum frequency of twice per week during the months of April through August. Treatment will be conducted in upland areas, away from water or wetland areas, as weather conditions • allow, and in accordance with the product label and other local, state, and federal requirements. The cost for adulticiding the areas upland and east of Panther Creek is $19,227.60 and will be funded through the approved 2008 Surface Water Utility's Mosquito Abatement Program Capital Improvement Program budget of$50,000. Task 2 (Larvicide Treatment of City Stormwater and Irrigation Facilities and Catch Basins) Larvicide treatment is scheduled to begin June 2008 and will continue for the duration of the mosquito season, which typically extends through the end of September 2008. The contract scope of work and budget covers larviciding stormwater facilities, irrigation facilities, and catch basins. These facilities and catch basins are owned and maintained by the Maintenance Division, Parks Division, Facilities Division, and the Maplewood Golf Course. However, the City must authorize targeted catch basin treatment and the decision to treat will depend on whether there is confirmation of the West Nile virus in King County. The total cost to treat City stormwater and irrigation facilities and catch basins is $24,525.00 and will be funded as follows: • H:\File Sys\SWP - Surface Water Projects\SWP-27 -Surface Water Projects(CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 Addendum Issue paper.doc\AQtp j Council/Whitworth Add 1-08 CAG-07-065 April 3,2008 Page 3 of 3 111 PW Maintenance Services Division: Larvicide treatment to be funded through the approved Surface Water Utility 2008 Capital Improvement Program budget for the 2008 Mosquito Abatement Program. The approved 2008 adjusted budget for the Mosquito Abatement Program is $50,000. The estimated cost to treat Maintenance Division stormwater facilities and catch basins with larvicide is $10,627.50. The remaining balance in the project account of$39,372.50 will be used to complete Task 1 ($19,227.60) leaving a balance of$20,144.90 for City staff time to administer both tasks as well as additional treatments if required. Maplewood Golf Course: Larvicide treatment to be funded through the Golf Course Operating Fund. The estimated cost to treat the Maplewood Golf Course irrigation pond, stormwater ponds, and catch basins with larvicide is $4,768.75. Should all ponds and catch basins need to be treated with larvicide, the estimated project cost shall not exceed $4,768.75. Parks Division: Larvicide treatment to be funded through the Repairs and Maintenance Operating Fund. The estimated cost to treat Parks Maintenance Division catch basins with larvicide is estimated not to exceed $8,311.25. This project was funded in the 2008 Parks Maintenance Operating Budget. Facilities Division: Larvicide treatment to be funded through the 2008 Repairs and • Maintenance Operating Fund. The estimated cost to treat Facilities Division stormwater facilities with larvicide is $817.50. CONCLUSION: The Public Works Department requests Council authorize the Mayor and City Clerk to execute Addendum No. 1 to the 2007-2008 Mosquito Abatement contract, in the amount of$43,752.60, authorizing Whitworth Pest Solutions, Inc., sole-source provider of the 2008 Mosquito Abatement Program, to apply adulticide in the areas upland and east of the Panther Creek Wetlands (i.e., Talbot Hill area) and apply larvicide to City stormwater facilities, irrigation facilities, and catch basins for the control of mosquitoes. Attachment cc: Lys Hornsby, Utility Systems Director Greg Stroh, Facilities Maintenance Manager Terry Flatley,Parks Maintenance Manager Kelly Beymer,Golf Course Manager File • H:\File Sys\SWP - Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 Addendum Issue paper.doc\AQtp EXHIBIT;A Q Neighborhood Detail Map/Site Plan kil — SW 16th St G©l l l� . �= L U ■ui mI • I T Alin_::: -uuuNW --`uuo MI �ra � i . ma ■■�o mom a, . � 4 ill y\l uv EIMINIII 0 Slit i=VI" 19 4 P Al %% SN 19th St 167S19thwi --Ism masin ' Isui1IIIwitS [ g- �`'„,,� �� SW 21st St ~' •i�'� S 2l sst -,:7 t: i till NEW"!ifill P'0 TECT LIMITS ... SW 23rd St III INV MEAll om ii I? j,_____ Paat- Iii k r 1111it U -ft plc ll 11 Qi N t +iiai Y o J H , plum Ll 111 i, ' w 1,, MNOiO� 11ii �wI 11 SW 27th St \ � � C��U �■,C �� I Wan el II Ill II . iS \ � ��, 4 s1 _!,, mu 11116 ��`moi A I SW Cott, Still . • r, �l NE -, 11 ... .., ., i ,, iis Vialrluilifir li 111711.11 111111 ii- II . Q f111111 IIIIId . ‘1111% 4th ti ii ui f INin Ilia mir -': :•‘="N-' ' x .. ,.... s „./1 CU la GS 1 ' t 4 pal amen - cmit S' 1 ,9c I S W 39th S t > - ��u1�7 x� i r i k- Ill M21,0 1 Mini I —mgt. Miliiirmis. mi. II Note:TREATMENT WILL NOT BE APPLIED WITHIN 100' OF WATER. TREATMENTS WILL NOT 0 1000 2000 BE PERFORMED NEAR HOMES.TREATMENT WILL ONLY BE DONE ON THE UPLAND AREA BETWEEN THE WETLAND EASTERN EDGE AND THE RESIDENTIAL AREAS.PROPERTY IESBERESSEMEREMEMERER OWNER APPROVAL REQUIRED PRIOR TO TREATMENT ON PRIVATE PROPERTY. 1 12000 Mosquito Abatement Program (2005-2009) ADDENDUM NO. 1-08 • CONSULTANT CONTRACT CAG 07-065 FOR ENTOMOLOGIST/PEST CONTROL AGENT SERVICES 2008 MOSQUITO ABATEMENT PROGRAM This Addendum is made and entered into this day of , 2008, by and between the City of Renton,hereinafter called the "City", and Whitworth Pest Solutions, Inc., whose address is 2533 Inter Ave., Puyallup, WA 98372-3428, hereinafter called the "Consultant". WITNESSETH THAT: WHEREAS, the City engaged the services of the Consultant under Consultant Agreement CAG-07-065 dated April 25, 2007, to provide entomologist/pest control agent services for the 2007- 2008 Mosquito Abatement Program; and WHEREAS,the 2007 Mosquito Abatement Program has been completed in accordance with the original agreement; and WHEREAS, the City desires that the Consultant provide the services identified in the attached Exhibit A for the 2008 Mosquito Abatement Program. NOW, THEREFORE, in accordance with Section VIII - Extra Work of the original Agreement CAG-07-065, dated April 25, 2007, it is mutually agreed upon that Consultant Agreement CAG-07-065 is amended as follows: I. The scope of work for the 2008 Mosquito Abatement Program shall be as set forth in Exhibit A of 41) this addendum. 2. Payment for the work defined in Exhibit A shall be at the rates set forth in Exhibit B of this addendum. Payment for services rendered in 2008 shall not exceed $43,752.60 without a written amendment to the contract, agreed to and signed by both parties. All other provisions of Consultant Agreement CAG-4)7-065 dated April 25, 2007, apply to this addendum. EXECUTION IN WITNESS WHEREOF,the parties have executed this Addendum No. I-08 to CONSULTANT AGREEMENT CAG-07-065 as of the day and year first above written. WHITWORTH PEST SOLUTIONS CITY OF RENTON Signature Denis Law, Mayor Date Type or Print Name Title H:\Pile Sys\SWP - Surface Water Projects\SWP-27 - Surface Water Projects (C1P)\27-2000 Mosquito Abatement Program\200S Program\2008 Addenduml.doc\AQtp EXHIBIT A • SCOPE OF WORK 2008 MOSQUITO ABATEMENT PROGRAM TASK NO. 1: TREATMENT OF PANTHER CREEK WETLANDS Treatment Methods and Materials: Land treatment applications of an ultra low volume (ULV), Environmental Protection Agency registered, insecticide will be applied to brush and other upland vegetation using a gasoline-powered, backpack-mounted, portable fogger. Treatment will be conducted in upland areas away from water or wetland areas as weather conditions allow and in accordance with the product label and other federal and state regulations. Treatment must also be conducted in accordance with the conditions of the Determination of Non-Significance-Mitigated (Application Number LUA05- 022, ECF) for the program made by the City of Renton Environmental Review Committee on April 1, 2005 and included as Exhibit D of this contract. All necessary licenses and permits shall be the responsibility of the consultant to ensure their issuance prior to treatment. The synthetic pyrethroid insecticide product to be used is Permanone or other products containing similar formulations. Area of Treatment: The treatment area, shown in Exhibit E, is adjacent to and upland of the eastern edge of the Panther Creek Wetland generally located between SR-167 on the west and Lake Avenue South/Talbot Road South on the east and extending from SW 39th Street on the south to 1-405 on the 1111 north, within the City of Renton, Washington. The project area covers approximately 60 acres to the east of the approximately 65-acre Panther Creek Wetland complex. Prior to treatment,the City will provide a highlighted copy of the map included in Exhibit D of this contract to indicate the properties within the project area for which authorization and release for access and treatment has been granted by the property owner or the owner's legal representative. The treatment application will be performed from foot trails through the project area used in the previous Mosquito Abatement Program treatment applications. The cost per treatment shall include all necessary work for clearing of the trails to allow the treatment to be applied. Frequency of Treatment: Fogging will be conducted in coordination with and at the request of the City at a maximum frequency of once per week during the months of April through August. The City may request treatments as frequent as twice per week if larger than normal mosquito populations justify more frequent treatment. The contract budget assumes a maximum number of 21 treatment applications. Coordination: Following each treatment, the consultant shall provide to the City a brief summary of the area treated and the type of chemical used, weather conditions during the treatment application, the time during which treatment was conducted, an estimate of the relative abundance and distribution of mosquitoes, and a recommendation on the scope and timing of subsequent treatment. • TASK NO. 2: TREATMENT OF CITY STORMWATER AND IRRIGATION FACILITIES AND • CATCH BASINS Treatment Methods and Materials: Water treatment applications of an Environmental Protection Agency registered larvicide will be applied to City owned stormwater/irrigation impoundment facilities using hand applied briquettes or granules. Treatment will be applied in accordance with the product label and other federal and state regulations. Larvicide treatment must also be conducted in accordance with City obtained Aquatic Mosquito Control National Pollutant Discharge Elimination System (NPDES) Waste Discharge General Permit. All necessary licenses shall be the responsibility of the consultant to ensure their issuance prior to treatment. The larvicide product to be used is Bacillus Sphaericus (BS) and is sold under the trade name VectoLex. Area of Treatment: The treatment areas consist of the following facilities: Owner Facility Name/Type Facility Location PBPW Maint. Svcs. Division Stonegate/WQ Pond NE 26th and Lyons Ave PBPW Maint. Svcs. Division NE 10th St Pond/Detention NE 10th St and Anacortes Ave PBPW Maint. Svcs. Division Talbot Ridge 2/WQ Pond S 47th St and 102nd Ave SE PBPW Maint. Svcs. Division Catch Basins Various Golf Course Hole#18 Pond/Irrigation Maplewood Golf Course (west) • Golf Course Hole#9 Pond/Irrigation Maplewood Golf Course (west-central) Golf Course Hole#7 Pond/Irrigation Maplewood Golf Course (east-central) Golf Course Hole#6 Pond/Irrigation Maplewood Golf Course(east) Golf Course Catch Basins Various Parks Maintenance Division Catch Basins Various Facilities Division City Hall/WQ Grady Way Parking Lot Frequency of Treatment: Each water impoundment facility and catch basin as described above shall be tested for the presence of mosquito larve every two weeks. If the larve count exceeds 0.3 larva per dip then larvicide shall be applied in accordance with the requirements of the City obtained Aquatic Mosquito Control NPDES Permit. H:\Pile Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects (CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 • Scope of work and budget.doc\AQtp 4 Reporting: Following each treatment, the consultant shall provide to the City a brief summary of all • stormwater/irrigation impoundment facilities tested and treated. Information to be provided for each shall include the following: 1. Date, time, and street location of facility or catch basin tested. 2. Type of Larvicide and EPA registration number. 3. Amount of larvicide in gallons or pounds that was applied. 4. The number of acres treated. 5. Name and address of person applying larvicide. 6. Larval count(larve per dip). 7. Number of manhours per facility visited (includes testing and larviciding). Notification: Maplewood Golf Course — Whitworth Pest Solutions, Inc. shall contact the Golf Course Manager 24 hours in advance of entering the Golf Course. Whitworth Pest Solutions, Inc. shall arrange with the Golf Course Manager to be escorted onto the golf course and in no circumstances shall Whitworth Pest Solutions, Inc., enter upon the golf course without one golf course employee in attendance at all times while on golf course property(this is a mandatory safety requirement). • H:\File Sys\SWP-Surface Water Projects\SWP-27 -Surface Water Projects(CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 Scope of work and budget.doc\AQtp • • EXHIBIT B TIME OF COMPLETION 2008 MOSQUITO ABATEMENT PROGRAM Upon contract execution and issuance of Notice to Proceed, adulticiding of the upland areas east of the Panther Creek Wetlands will be conducted in coordination with and at the request of the City at a frequency of once per week during the months of April through September. The City may request a treatment frequency of twice per week if larger than normal mosquito populations justify more frequent application. The project budget assumes a maximum number of 21 treatment applications. Larve concentrations for City stormwater facilities, irrigation facilities, and catch basin will be conducted at a frequency of once every two weeks from July through September. If the larve count exceeds 0.3 larva per dip then larvicide shall be applied in accordance with the requirements of the City obtained Aquatic Mosquito Control NPDES Permit. By direction from the City,testing and larviciding may begin prior to July and extend past September if recommended by King County Department of Health. • H:\File Sys\SWP-Surface Water Projects\SWP-27 -Surface Water Projects(C1P)\27-2000 Mosquito Abatement Program\2008 Program\2008 • Scope of work and budget.doc\AQtp EXHIBIT C COST ESTIMATE • 2008 MOSQUITO ABATEMENT PROGRAM TASK NO. 1: The estimated total cost of Task 1 including Washington States sales tax is $19,227.60. The cost shall include all necessary work for 21 treatments including clearing of the trails. Work conducted in performance of Task 1 will be billed at the following rates: For 12 or more total treatments: $840/treatment For 6 to 11 total treatments: $890/treatment For 1 to 5 total treatments: $990/treatment The billing rates include state sales tax. Subtotal Contract Cost: $17,640.00 State Sales Tax(9.0%) $1,587.60 Total Cost Task 1: $19,227.60 • TASK NO. 2: The estimated total cost of Task 2 including Washington States sales tax is $24,525.00. The cost shall be based on a rate of$125.00 per manhour, which includes labor, materials, and equipment required to apply larvicide as specified in the scope of work and shall include but not be limited to the following: 1. Transportation costs associated with transit from the consultant's office to the stormwater/irrigation facilities, and transit between facilities including catch basins. 2. Material costs for larvicide. 3. Equipment necessary to test and apply larvicide including sampling cups, protective gloves, and respirators, etc. At the City's discretion, facilities listed under"Areas of Treatment" above may be eliminated or treatment frequency reduced and other facilities added depending on mosquito levels and recommendations from the Public Health Department. Catch basins will only be treated when requested in writing by the City. H:\f ile Sys\SWP- Surface Water Projects\SWP-27 -Surface Water Projects(C1P)\27-2000 Mosquito Abatement Program\2008 Program\2008 Scope of work and budeet.doc\AQtp 1111 1 ., A minimum scheduled trip charge from the consultant's office to the stormwater/irrigation facilities of III $375.00 shall apply. Below is the estimated contract cost for the three City divisions, based on the billing rate of$125.00 per manhour for a total of 180 manhours: PBPW Maintenance Services Division Costs Stormwater facilities: 3 Total number of treatments per stormwater facility: 8 Total manhours per stormwater facility(including travel time): 0.75 hrs Total stormwater facility manhours: 18 hrs Subtotal cost for stormwater facilities: $2,250.00 Sales Tax(9.0%): $202.50 Total cost for stormwater facilities: $2,452.50 Total manhours available for catch basin treatment: 60 hrs Total cost for catch basin treatment: $7,500.00 Sales Tax(9.0%): $675.00 Total cost for catch basin treatment: $8,175.00 Total manhours (stormwater facilities+catch basins): 78 hrs Subtotal cost(stormwater facilities+catch basins): $9,750.00 Sales Tax(9.0%): $877.50 Total cost(stormwater facilities +catch basins): $10,627.50 0 Golf Course Costs Irrigation facilities: 4 Total number of treatments per facility: 8 Total manhours per irrigation facility(including travel time): 1 hr Total irrigation facility manhours: 32 hrs Subtotal cost for irrigation facilities: $4,000.00 Sales Tax(9.0%): $360.00 Total cost for irrigation facilities: $4,360.00 Total manhours available for catch basin treatment: 3 hrs Subtotal cost for catch basin treatment: $375.00 Sales Tax(9.0%): $33.75 Total cost for catch basin treatment: $408.75 Total manhours (irrigation facilities+catch basins): 35 hrs Subtotal cost(stormwater facilities+catch basins): $4,375.00 Sales Tax(9.0%): $393.75 Total cost(stormwater facilities +catch basins): $4,768.75 H:\Pile Sys\SWP -Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 0 Scope of work and budget.doc\AQtp Parks Division Costs • Irrigation facilities: 0 Total manhours available for catch basin treatment: 61 hrs. Subtotal cost for catch basin treatment: $7,625.00 Sales Tax (9.0%): $686.25 Total cost for catch basin treatment: $8,311.25 Total manhours (irrigation facilities +catch basins): 61 hrs Subtotal cost(stormwater facilities+ catch basins): $7,625.00 Sales Tax(9.0%): $686.25 Total cost(stormwater facilities+catch basins): $8,311.25 Facilities Division Costs Stormwater facilities: 1 Total number of treatments per facility: 8 Total manhours per stormwater facility(including travel time): 0.75 hrs Total stormwater facility manhours: 6 hrs Subtotal cost for stormwater facilities: $750.00 Sales Tax (9.0%): $67.50 Total cost stormwater facilities: $817.50 Catch Basin: 0 • Total manhours (stormwater facilities+ catch basins): 6 hrs Subtotal cost(stormwater facilities+ catch basins): $750.00 Sales Tax(9.0%): $67.50 Total cost: $817.50 Total Contract Cost for all Divisions: $22,500.00 State Sales Tax(9.0%): $2,025.00 Total Cost Task 2: $24,525.00 Total Contract Cost (Task 1 +Task 2): $43,752.60 Invoicing Whitworth Pest Solutions, Inc. shall submit a separate invoice to the City of Renton Surface Water Utility Section, Parks Maintenance Division, Maplewood Golf Course, and Facilities Division for any services it provides under this project. Payment cannot be authorized or payment may be delayed until separate invoices are received. H:\File Sys\SWP-Surface Water Projects\SWP-27 - Surface Water Projects(CIP)\27-2000 Mosquito Abatement Program\2008 Program\2008 Scope of work and budget.doc\AQtp • CITY OF RENTON COUNCIL AGENDA BILL AI #: ---7d n • Submitting Data: Public Works For Agenda of: Dept/Div/Board.. Utility Systems Division/Surface April 14, 2008 Water Utility Staff Contact Ron Straka, ext. 7248 Agenda Status Allen Quynn, ext. 7247 Consent X Subject: Public Hearing.. Emergency Declaration for Carr Road and Panther Correspondence.. Creek Culvert Damage Ordinance Resolution Old Business Exhibits: New Business Issue Paper Study Sessions Resolution Information Recommended Action: Approvals: Council Concur Legal Dept X Finance Dept X Other Fiscal Impact:ii N/A Expenditure Required... Transfer/Amendment Amount Budgeted Revenue Generated Total Project Budget City Share Total Project SUMMARY OF ACTION: The Public Works Department requests the Council declare an emergency on behalf of the City of Renton for the purposes of hiring contractors and taking other action or measures necessary to repair the damaged culvert crossing at Carr Road and Panther Creek in an expeditious manner and without the delay involved with the public bid process. If the damaged culvert section is not repaired in a timely manner, the north embankment above the culvert could fail potentially resulting in the loss of the sidewalk and a portion of Carr Road. The approved Surface Water Utility Capital Improvement Program Budget has $50,000 in its Misc./Emergency Project budget account to conduct an initial assessment of the damaged culvert. The cost of the repair or replacement of the culvert is anticipated to exceed this amount. A separate request will be made to the Council'requesting additional funds once the assessment is complete and the cost of the repair/replacement is determined. STAFF RECOMMENDATION: Approve a resolution declaring an emergency on behalf of the City for the damaged culvert at the crossing of Carr Road and Panther Creek permitting the City to hire contractors to repair damage to its property where immediate repairs are necessary, without the necessity of the delay involved with the public bid process. • H:\File Sys\SWP - Surface Water Projects\SWP-27- Surface Water Projects(CIP)\27-3440 Carr Road-Panther Creek Culvert Replacement Project\1003 City Correspondence\Emergency Declaration AgendaBill.doc\AQtp i ti`SY O� PUBLIC WORKS DEPARTMENT „ MEMORANDUM cm, DATE: April 4, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: Denis Law, Mayor `J FROM: Gregg Zimmermankk ministrator STAFF CONTACT: Ron Straka, Surface Water Utility Supervisor (ext. 7248) Allen Quynn, Surface Water Utility Engineer (ext. 7247) SUBJECT: Emergency Declaration for Damaged Culvert at Carr Road and Panther Creek ISSUE: Should the Council approve a resolution declaring an emergency on behalf of the City of Renton for the purposes of hiring contractors and taking other action or measures • necessary to repair the damaged culvert crossing at Carr Road and Panther Creek in an expeditious manner and without the delay involved with the public bid process? RECOMMENDATION: Approve a resolution declaring an emergency on behalf of the City for the damaged culvert at the crossing of Carr Road and Panther Creek permitting the City to hire contractors to repair damage to its property where immediate repairs are necessary, without the necessity of the delay involved with the public bid process. BACKGROUND: On March 21, 2008, Transportation Systems Division Design Section staff conducted a survey of major creek crossings underneath various streets in the Benson Hill annexation area to determine if any structures existed that need to be included in the Bridge Inspection Program. Transportation staff discovered damage to the 78" corrugated metal pipe culvert crossing for Panther Creek at Carr Road. Approximately 15 feet of the bottom segment of the culvert starting from the outfall of the pipe had rusted away. The underlying soil had been completely scoured away with pieces of wood and other debris lodged in the rusted sections of the pipe (Photos 1 and 2 attached). There were also indications of a sinkhole developing in the north embankment, adjacent to Carr Road, immediately above the area of the culvert that appeared to be collapsing. Council/Emergency Declaration Carr Road April 4,2008 Page 2 of 2 Subsequently, staff from the Surface Water Utility and Maintenance Services inspected • the culvert on March 24 to assess the extent of the damage to the culvert. Just above the culvert outlet along the road embankment, a sinkhole had formed approximately 2-3 feet deep (Photo 3). Staff walked the length of the culvert beginning at the upstream end. As shown in Photos 4 and 5, the majority of the inside of the culvert from the upstream end appears to be in good condition. However, approximately 35 feet from the outlet, a pipe joint had separated. The section of pipe downstream of the failed joint was deformed and twisted with the top 2-3 feet of the collapsed pipe exposing the soil above (Photo 6). The failed joint appears to be at the same location as the sinkhole observed above the outlet. Portions of the rubber gasket that sealed the joint were visible on the bottom of the culvert and the steel band used to secure the joint was visible at the top of the non- deformed section of pipe (Photo 7 and 8). Although the section of culvert upstream of the separated joint does not appear to be in imminent danger of collapse, the section of pipe downstream of the failed joint could completely fail at anytime resulting in failure of the north embankment supporting Carr Road. This could result in the loss of the sidewalk and outside lane of Carr Road. If the slope were to fail and block the culvert outlet, the high velocity flows from Panther Creek would continue to erode and weaken the stability of the embankment under Carr Road and ultimately result in the closure of Carr Road. The failure of this culvert is very similar to the failure of WSDOT's culvert underneath I-405, behind Sam's Club. The City will retain the services of a consultant to evaluate the damaged culvert and • provide recommendations for repair or replacement of the culvert. The approved Surface Water Utility Capital Improvement Program Budget has $50,000 in its Misc./Emergency Project budget account to conduct as initial assessment of the damaged culvert. The cost of the repair/replacement of the damaged culvert will likely exceed this amount; therefore, a separate request will be made to the Council requesting funds at the completion of the assessment and the cost of the repair/replacement is determined. CONCLUSION: The Public Works Department requests the Council declare an emergency on behalf of the City of Renton for the purposes of hiring contractors and taking other action or measures necessary to repair the damaged culvert crossing at Carr Road and Panther Creek in an expeditious manner and without the necessity of delay involved with the public bid process. Attachment cc: Peter Hahn,Deputy PW Administrator-Transportation Lys Hornsby,Utility Systems Director Mike Stenhouse,Maintenance Services Director Deborah Needham,Emergency Management Director Bob Hanson,Transportation Design Supervisor File • H:\File Sys\SWP-Surface Water Projects\SWP-27-Surface Water Projects(CIP)\27-3440 Carr Road-Panther Creek Culvert Replacement Project\1003 City Correspondence\Emergency declaration Issue paper Final.doc\AQtp , . . , Ire,.,..4.7";-,;;::; *-44.-"--",lteg,„„ - 4. ,,•,.-4 "07 , ,-:."? , \, '.",c::-.,-.1,- ''.'4.1.c.t4-.: ., *c.,,i-u-1.---:'„:"?"/L: '''"*•-- ,l''. S ..------ -'4,4t---, - .4..., • ..,..;c1,,..0.- T...#„,, „t„..4,:-.-44.11, .,,,,.;.,:p A..,4,x.'„,. , ?, _ ,4,,,,, .t: ,N.- - - .---,' -Ai., . , ' --, r- - -.... 1 oit ,-,--k; „,„ -. -...,,,,A.,,,....„.... -,,,_ , $, .,,,,--,r . •. ,•it A. -\, • ..----!--f -.„.. . , -,-,•,,-,.-.1.-N,t .1,- --•.. -,-,..... ;- - • Ai% tliiwi 1/11" • .-_, ; 1- ,,,,, • , zii.,3,.. ..„.. ..„, , .-, ,_".„.. :4,r4;.47,_ ,, • : ,m1,...'. I t• . ',',-•,.. .-i. -,,•-,•:', ,,,'_.,I i, ••,•4 '.'''.t,,,,_•.k..•-,',,.. •-• , ..,..4.'r:.. is ...d 491 ..,.- * , , , .1 /4,,.•: 4.;;',. - ii.:•41„.,,," i'.".,' ••.:'-Wt''. -.. '''' ;tit'r VI., r..., _. .0.4. .a:_N',It•-7,-^',..- _ --4,- .!: iti-ii.; ; ...,,,'j• :,,,.,,, .; ,,T 1! ..),: ...,., ,,,,,,,,-„ , .,,,,,,,rn: t...01;i1, ‘,.......-,,,,,, . --,-- .- ., '.t..'-' i . 1 14,1 ; . t# i r*, .." • "...'17-Z cl'-,,, . l'I/ '144,:, - -i.'. 1 ,,,,,,,I, •A.,•_::--k-,,,...' 'i I .• ..1. ' . • . #.4.'• .• j'-, S.`1:;41:'•t.:!. .i„., . r l'iii.. ".„.,,tet.:a4 tt..ri ri--'111.''''; -.;"'`, ; 1.?„',.:.. It! ii ' • r 4/'. . '' :ik*-' 'r—-'‘.V- Vtk• A)' ,. , ., A • 1 i •44,4P-',L, 'i ! ' .- •se/r-:' - ,., ., 7 ..-.4...,..1,• v - 41--• -'' /4.1•._,J12'. i,,d' _ .-., , . - ,... -, ,`." ij,.),,±;4,1 r• ..:i.s.,'- - -.7..- '..)",ir.1.,•".•Y Ar•. '7"r'. .. • 2...?7 A',.7y.. „:",.j A4,,,, ,,V4t..,..,,,..-._„4,..0,7-i, , ". :; i",,,,,,,, .471../ V ?-/r2C' f'.'4!'-ft •/..).1"-,t-", .rf"7.,..41a"..1,erri‘ -_"!' :. ...••-•.7•.- 4..--.... ..., ..'"-' •,<.*,' ' f4V 4.4:,f,,-- "4".„in-fit/11:e ' ,'--;''/' .--'''''''•'' ,,,,,,4...-----. ,-...--• 5,;.,--›•.,...s. - •,„,'4/ ., • ---i,,_. c....t.„,:_ ,„,, 4-,,,,t,„:„...,,,,„,„. _ //4_,.;• t-p. ,,f---..A.1 .,...-.1-.-,.-.. .-.11.-,'•-•:17:4P-1 .-,:--, .-1,,,i •, . ..,r- --:"-..-470,7151,,Z4, .....i • -- ...4-P.;/- -- "--/1/1 " -,.3r,..y.'.3f,..77"A. .:.,.,:,_ .:,:ltk _',A,........4efArt,l....,:. •.Z.;,.. •14,1•••.'-_of-•,t,',i"71‘..g.''.'l.i...1, .' %." ..7: A.,,i V , . ..••'I, '.-''' . ' -* i-,'", ,..._,...-47...$4. .3'"1 igt• "1:••., •-t:14- 7.-4-0!,:czii. -1 - i . ....,,,,,... . .„ -_,,..,,,, _ ,t, ,,-,_.. .. •_--. _.----,-. „,„L,1.--- .---,,,..,";:,.„-_ 1.. ..k. ' ,'-:- . 4,7,:l.t,,- - -,_-., •_,1-1,..- •-• ' . ---A:=:-•• ' --_,4,--•:>4.--`'"21,`A‘' .faxi•k:''';'>-- ",.f./. .. _'''.': - .,/.,..,, -',:,i'T:.p. .-1-. - .•••''"'" -.:.:1--,• ,-.[,..,t-,7e-,-;$ 0q,.,-!,-;'..-ror,..,- ;744,i'r-,. '1/4eN 1 -46.-____..-__, -.Ct'-'''-. •'--::.,, --''' " . , ., .-''-'2'. .;.,,,'-.A/otr--e'43V,. .. .-----.:,-.. --•:._4*".6:4't774.: '.• ' ' • *V114rtre • .40.,•W•-'..-1/r-'i,"•`..3,t!.:'• ...A..7.i•.‘7, ,,:,.;' ••• •• •- ''',.• ' .. , q• V,.A .,..ft. . .e. ..k ,,4 ,,,, `.'.7...-'. '-'41 :7,7-: -.L. ' .."?''''''',ic'".."-.""''' -L' '4.15. _ ';-':—-.,4- - '','!," i 4 t:..-,.;,,..,-*,- / Aff- •'a 4.7 I---.:,-_, • - - - • -.- .., - ---f- tNi....--,-4-*--- 4-*,.!' ,-Is --- 4. i --.-41-1 v. .„ v,P '',`,‘•-,s----- ,..,-.:...--c,• • .„ ,,.- -,41,'''''"Air,;,‘,,mj,1„.. ...v.r,--.4.:.\'Tr.. ..,:41,21 C'''W-..-tt-' Iv i.-,,,' ''''_-.,----.2'''. :- ''':,•/.-Alr--,..1_ =----,,c-4.11kr,_-11.-:-., -.. ,.. . -. -y.,-,,,,-..-..-.--...,- , i. .-::,4,,. ;,...,:s.„ , ,.17- - -. _.::-..•.'....7' ,A'....:?r?1,f_,C,Aerar7' '-'' "-• - . ...:,-. 44).? ..2%,--.,i ti., -' ---4'.:-,,^ "-...4V--,'..,?-.. -:•-•,!-- -... -t.... - . orpot..„7-9,7.;,,.-!•,„--v.s,r, Ej.a. "„.: - -• 1-.001Via.,.,trr:aapie.;:lt?"--t,.;` „h„.--w-7,-...al. • •,- --"-----a.-' -4,. .-, . ' —..,j e'''.01,.-*'....ZE:7'....;.-......,,PS:-.--- . - • - '- Photo 1: Culvert Outlet 1 - - i Pii.f.';'45iV*-.. • ' L' ''-''' .:''-'' -.1' 0 .,-4. .. . t. . ; 1, • , A'. 1 ""a",?,,,,,,-.1.2. - - ., ,,• ,.' --- -a- . - et ..4 -%•-:14-',.:,,,-i • , .1 •,- -k..-...t. .I. . n',90.741e•1,„,',:f7„--,f--. • - ..' .z-T- ,,,r,-..% ; -• f . ,.• ' ' •'...*If 4,.. .-•„_ ,. -,. , - ... ,.... „.,..,,-;,:.--.4,.. . .. ,,Al'...• . • '''''' --` ' . ' Z‘..• • I • , .,c.',..' ',--7-. ... i . • . , i - , • .. .• '-4, - ..t .....7 . .f.,•4 • 7 -.•• •- 0% ti" • r %-?-, .• : ..• - ,-. . ..... ,. . '.., , ' . .,.., • ' ,' .„ •'••• -.... " •.0" • ,:''''':•••• .'*- %Pk , .:. f .-. •• ; . it ... " - ' . '•'-.t. '• 1.- ,;....• 44' . ' . ,,' • ' j, ' . .-w t•:,,, ._ . ' ..--'\• .i:' ..,-, _:...-•`-'. ;' '''',-*•. • ,- . - -- - - ,,..,:;:.• . ... .. .:,„..-. ' '''' • . - :'':.;•1'. ' .-- '-- ' '.i ''"Z...I i.': .:-, , • ,10.. '. . ,...,, . ' .. ' ',iv"'. •' i,-",!,,, \ 0.f.ii;,,. ' aa., ..'. ' . it.. :.-..:-...,, ,. - Pi:;,...l• • ' .... . , • ..: . :.: ". 4,-. ; ,-,;',,?--;•"*"..„;•-:`.... . . ,..• , -Art,, - - ..:.,. -. .• • - • - --, ..--, , •- t .i, V.* -' ** k. ....., .,......_:::„....... .,: ..- . . . . .- . .,- .,‘ •,• .•••.:7„:-:.- ,.„,./.. ,....- .... • , 1,- .4 .-Vr ' ,*:.: -. . . .• ' - -N...- -•• ,- '034-5 .--.- - • - .. ..,.. .,.. -tit.,•,.-,„.. . ;-..,e-17 % -,. .... • • -,:w.,:--,.-..-, .--.: . -- :';,-. • ..:. • --,-- .. . .,.. - .0,- ,... . - -- . —"N.V.: ....", ", ..v, ..Ap.':1' ,.-11,.. •1 • ,,,.. % , . ,,,r,:r1/4,..,:- ..;.-e•? ... ...7'.N.,- ';''%.,....' -'" '' • •,:•-, •"... • ..:..k„ ("1`.'•Al, . _ 1. Photo 2: Bottom of Culvert at Outlet 0 ..,, III"4„ts\\ ;, •14, i AVil :19;_,`I:14.,.‘,..,„:::- ;i'c''z..11,741.11176 .7,„"isr.,0.47p-tr- 7--A771 , ,, ... - ' A ' . • - -•,::,..... -4,,,,, ,,,t,,,, ,,,ip ht.--.., is N,1/4 -_,- •.--li 4' #._1/4_.1.---, ,,--4, ,••• WA ci il- 14 "... '.., ;s:t- 1 ' -.Z-i '. • .., 1 - --,t,''.,"- ,--`- i.-"‘",C• -a'‘s71.i.,.='','-;c\,.1,,,;..\t,,-;,_,1••sN,.il7',,_.,'_._,_.I,,-1A\4}„.'4-,,r;t,',,,,,„.,,m,y,!,'',1tt,_r,,.,4.'* t' '‘,.'„•,1,,%.,,c`,\--,,\A,'-'-'N,*f„iJ.A,7rr+.,2',,,-:75-'4:,A,.t.i:„-',,I.'4,,•-..4,A,.-.„,'.1,*;4!,,,,-;,i,*';1''.'1''4,EA-,‘‘;.-,,,,-.'.,'„vA.',v.;*.:..-‘,;,,,,$.y.,...„.'/,;..„..'-t4A.1,,,,.,;\„"^.‘,,-k-,‘vs 4 \`,'-'1,'-*-..,\.\.v..144-'1‘. '`,,,t.,z..\.,.;\ - f‘ ''•T.tA'V\'-ZJ,,''r,7.''t`t..:..,''\= 1'174. :ror':i'.,`:,,'::,.'.,-_•V4,:&,f,.4.,'-,,).':-.4.4.,.,,,-.-.t---'o,,.0.1zi•._4-.--1N-7-,,,.i,e,.t.,-,,-NP-t•,:,t,A.i.t1.r_ 7..l.4,i,_,\,,,4••t,-,--‘-,t'..,:, 4,,'•,,;''-;'.r'W-.-.:,.‘.1:-,1.F-',,-:1.,:.1,1,..1,i1;i:,:,'..4::-.:1-;..t...-3.41,.41i:.,.*:.,„'„,,,-'„,;,,-.,;..,:,..,;„1.,'”„5,--,.”,-,,,-.•1.:.::,:.-.'A.,„,',•;+.i,,i,:.s''„.1.:t1.g.„-'.,.--rZ,:--'6:v4s-::-:.:,1.::, , ; -k':',114,:-,`„'-1,.-:-.:;:',:,;1:4.,v”:-,f-;,._-S:.:--:.-f,,,:.',,'::‘f.-,7,'-„-2.'_''=)4::-1,/`,1,.1.1,---<'.-,,,-,:,,e,4%".,.-:.'i-p..L.;,.•4...4:K,:.:4,.-,i.;1-,4.,,::/•.1-.,.:t,.,;.,-,..-,'-:„.L,.f.4t,5-..i1.,;:.1- ::;-',':_,:“'x-,"4:-,„,-.-=-.-:-:.-.':_4:•..-::::;.''4'N'.i.'t7,:.'-::_•:\-.\.'1-.s,-,:.""I,.ii.4..'-4:'.-.-c:';7-11-.,:,,i,"r_,0,‘.s;:,:,:::,,.7. -'=: 1,..-:—t::;',,:;,:4i_,47.:f\,Al.t•1:-\.s:-1-•2_..-.7.,:'-:4--.....-::..,.\.;\.:(v-,',`„2k,;,%l11 : , : :: .‘ , -,.., ,,. . — ' iik„.* . il= 4-x _,.'-' ,N,..‘'.1/4J-,t,,',e,,W.,,..t . '''.1;0141k6;•---'''-'' d r-''\'-.--`"+'''' , 141011111.11WW:hoto 3: Sink Hole • ) , , III .. . 1 f t 1,...• Q „Ars". i v i, . ..- • IIIIR 0 ., , ;;',0 If.ri Lk:v.el:.. ‘ . .., ,.+• 4. • I" 1. 42': ori'.,,,,z,.: • , C.\\\ ‘,.:',..„>;,., ,.. ..t.E• ' . . , •- t 'AN, • ...„ I It ••••:.44.1001.,:......, , - •-•.= ' .40 . ' ., ''',' .r.•i!t", '1%. ‘,..., 'Vt. 1.5.... , . . -<!..7"X-•.,,!......45. t."' .' i t ':// t 1 Spolo,44, t -s711,11K1 t"\+. stowar - •••.A..X'. ..,1A 4" ' 7 ' ir,,,, - - 0,..,?,..„,.... . ... . • -,,, -;;.. ,, ,.. x..,17,,,•, v, , • , At,e4 - , --, , •• .,* - - , ,_ *.: ' , ..i 4:"14' :r4..--."L4 alko- - 'A-1,- ,. ... .•- . % :,..~."• ::3 i.."..'5, , A\ 4." - 1 , -''''-'s :r.,- .,..• '-' ' `•'`./.. ••' :@ 3 2,_..{.4' 210 CI 8 '1 '-‘42 i . '- ' '•.'.4- • ' r., " .... - 1' ''' ‘- 'c'y / .0- * Are•r '", ". '. - , ••. ,„'s•-.."--7 -4.,,,,,-;"4„...- , , 7 `. z:1 . '.° • . 4-4 Photo 4: Culvert Inlet Looking Down- 0 I , .._ .0"--• - -.-‘v„,„'.- . .. . , ...., . . , . ,ogy • o • , . s o '' • ' • 1 ''• ' I • / 1 ' e• ' c , . . 1 . ` - „ . , 1. • a4 4, ' 1' • a . \ • , i- 4 NI k I1# \ 3 ..,s , 13 ' •: 1 ik. A. 4., / ...k•'' '1/ !.‘ 'N-•, - , \ \ ' ' •• i'''' ... ,... _ ,_,. . n \ \ , •11. ti.' 4 . 03. 24. 2008 A' 4-• - ‘ A. - , I , •.,,,, , — I N •' ‘ , . . , f. • • Photo 5: Looking Upstream from Failed Joint • ; .., :,-.--- '-, .1.!-•,.'f, A:,..;tr:, .,-:,'': -!:.•-;,--:-;•.- ---,-- *:-.,: i:.,.:..-'-'--'•' . -- -,, - ,-:..- - .,•:* f' -0.&:.;‘,"--- .---: ,, ,--1 - - . • ):/;', -'- , ...: „„ri.-: ,:‘,...,m_17,1o,,,,_- ., , -. ,-;..-"pz?. .,-..------- -....---.-- `._-_-..-- - - -...-J"--$,--- • 4,.: . • ....,.. .,..,, .., //---- _ ... //,../A.- ...-6,.-•:.;:. ,,,,5.4 .` /;(,/- /,- , • -It. _„_. ' , . 'I''ft11,,,, - ,,,: ' '•: IV""• le-'' ' '''‘I i' , '-'a.% ' ri 1 /7"/ ./ i ' ; I/ : . • - 4 t I 4;_liormzsg•-er,,,..... , .. , . —. ... . , . t.-:;.,..t.,...., , . 4.'";r''-- k N••f•-,— - t---- -. ‘.. -.., , • • -• c't 'k - . • - ..... ',,,-, 4.4- o„., • . ... , . 1 g.\,''' ,. ,...'• \- .,. . --- ' *0 3-7 2 4. 2 0 0 8 -- - , .,., ......: .. : Photo 6: 35' Section of Culvert Outlet Downstream of Failed Joint III N rt« ..r rx c 0 rt ^L'"tear z ,t l5 ,/ f- b 4� -ia :� 1 tY y ' .*:‘:'. .,' ''' '7. 'ee44.7''---..« Aa.---4.44,,:t.. ',A.,4 .,,-,..t.t4 k!,-:,.,t4t.,;\.k....-... iL-„.1 :, 1. . ; k4:A ,,,,,:.13, +,� ytk � �sv�� ```k' t � � pp �` ' � � a '� � sG - a ` �Wi� aa• r 4,,l . .-,,,,-11,-- -..- -,,, , ,,_., 1, ',,f4 4z.::,'•'.it.„.:,. ..-rw ,, Ilk-.,- \ --...-f:::-;.,:-..-iv,h.1 +SCC�Q A` ( � � .?i y�'r r `1 j rel • N4. #riy,�f ./ r ,4 i L,rj fm t ' (1.,:::4VT...3.'',',:i.:1;:.':'::::::'4.1:1;4:;',:0:3:1,,,Nif:,:2„.:4,-:. 2 'tel' .- --7 _ ., .�. sttt ,.Ai*:Y ':. i.'. 9t t, Photo 7: Top of Failed Joint Below Sinkhole • 75.4 I ,,, y i..' ,, . .{p •� f g' j ky • -3 0. .* L'1$41- : a -"vi, r ysr} s 7. .aft` 1, ',ei` «" � � ,t....16.11:1:11( � Y,7�' ,� g�, ? i�..'� �� ' 'fir -�• "# %�Y!p f. �` f Y AT t -i 4 ..� r 5 r r 1 pJf/}/�`( / [�{ t).1 ,,.4:,,, ,,:„..�+� .� z Jog 1.-,,::;_; s ;' �y k'f 1 l iP , #r f f f -��.— ; y'y L"IL IL a*r f i gfP.a- • 5 FS - ., ‘'.... **.-4..'4.: "h; y% e :� yPi',t f4. k s. u3 . '' 03 24 2000 1 Photo 8: Failed Joint Looking Downstream ID I . - •,--::" " •-;•-7'.;;;,.;er''.'. ,4kKer 7 ••••iT':,.7•V:',!.=.;,"1••••.••;••4F4V.•••E•W-.''','.'',•'‘:•.•'"- ,''•' .;•, / ; " , tAx_Ei ;• •'.' '",‘ ; l'•;7;--' ,{.-•:o•.- '1 1,(, ' ' j' ' •—1'R,O--L:I:V,et-..r,,'-,;" E•.'di•i•i -k-E•'T"•-7)1-r A!• ;;'' /••1 r• i /.1,:',... '';;!:; :1,',:'',.';'1:-.:::':.„..„,..,_ ..,..,u' 41,‘; : •Oilifpt/ eti*.t.ik 1 '-''' 4 ': \ : V: ; l'• .- ,:4'-',1-;;•-•-••=';-,/ 2.•..,'=:,'-(tr' •'2,411;isf,'-'',;;,'•2. '::.",: -,i,:;' 1•••-''4,,-,- ‘,. , r-t,,,4 ,z.Qc-7--..A‘A,:"'-',-,41' '": ' • '• . ' '5" ,,/,,tE;E:',If :•'E i ''•• •.' •-• -'• ' I• ..•;'d ' ":1;JV t. :'' :;.° •//'' :•. '''''4`,.1.•"0'•T•Tkl,,,,,:E•7;:•:;. • ' • •';•,.'' CE: 4' • '•'•::.:' '7IJ:ad'''''''''r—'''''"40 =teRc la--:•:// 1,1/1•*-4:4Kt-1. C • (.1/4"1 i ‘• :•,ti„. .., . „ ;',,k-,,,' ;",,./. ..,/,•" /,-.1-.'•,..--.:- ' ‘1,-, •. '‘'.14-Feiif.: ''' ' • ,--, . • • -,v..--•,-,-...,.--.i?„•,.t:Tit 1.....7,,,,,,..,44„...,,,,,,,,,,,,-.7,,:1 6 zi„..,,,,T;;;,,,,„,4,,,,c,,,i4,,,t i a. .. Ea ) •'•.,''' ''•;• ' ' ''' '''.';','• ••'..'i•/ • • •r';":1 ' .1;SeQ''''', '•• •'''•:•'.-A.•,•• Ift- k:,;:-•-....' . •. ' .• •.4 • •...,` ,.-.,.:N,' J''''t.,..,y,:ti,,,,;•:`,...74&14#•`7 if ft I 1,1,k:.' kcitn ('tt .j ';,,,,';'.,,,,;; ; ' 4,,',t '+' 1 ,' '• ,..i';•,..' :•1'4•1,.;•C'I', .‘,',,'''‘•,'El`its',EV1ON;('• • ' '' l' • 4-''',tri.:;.4.Al'i--.,. • ill k ----'''./1'?"''74:4,,' , /"- iV, ' ,A '--r---‘7,--.--;-. 4--.....-p.,;,.;- :4_) . -,,,---1/ 4:1-:,,,,,j-,"--:';'. ''',','''''''"\-14 r."-f;,1 h. ,4:;;Z;,i /pi':Fr4.„--'-•;,-. ,;::'•':3--,:-..ik,t,;,.,:°*.••• •1 .-..:/;•‘,"--0:-.-. • 4' : . " '''4; ;''' '-"fir.,:1, '''' •--,-; --r;" i.sef//i' '""..lin;;•1! '; 1 '...,;,,,, -;-.',.,-„,'„.2„,,..•,."-!,zi::&:•q:'1,t - /- ,. , .,,,fr, --;,..---,,,:,,;.P,-'4,`Y'',i '115, ,• , ‘.',•-,./fk , •?1:1 ':1,::::V'..''',; 2.1>0:4,,E"1/y,"1,,,.:' ';:;!.049,:;K% : :',$E, ;\I E :: c ,•••:3•;'''";;E',.. ;i-P.." ''''' ''4•''J' -''''0-7g;'''5't4/7.•7.27' ; ' f*N' l''•':: .:•'',. ••••t‘•'''Eiti..•W.::?..t'.'ill: '.:, i . ,:-,.:::, .'„' ,.'-'. '',,,-1.2(.,ifi:.:.-:;4:::;z.1,1Z/_;•',/i ;,/,-''-'-;'of.',i:;?,31,.;:!,i .fifi, ..,,.....,',.i.v„s‘.:::,;.,-4:-.4,g'-;tez7...',.c--..::,,,..4.,"-i -,...!,-,. .,.,.;;:,-.:' ,..:,,i.,:,-;'&.f,,,.1,-.N.,•,---„, 44rf.-.41:..,-....1.,( , !7,0v.-k,,,,- --, ,-.;:7;',"," i,, ,,t,\ /,-,./.4*,r4...32),:f -.Y.:' ',11..,;?/1 i ? .,)", ,,,, ,-e.-• .1.:„. y-...-..'si:...,-.4„,„,„,;.-,...' ..r=., ., ,,,..fik,-;„ ;,,,.Xp;..,%.,::.„),;..,-,?,k,i...4„,:.'„t,,i1).,,,„..„,,,..:.,-,,,,,s2 •,-., %::;„;-/,,•\„,-L'..4,' ,"/,', ;"' i '-.'ii.,4.,,,.. ,'" 1)14, ,- ;.".t.`,„</tie}i§:;---• ,,o,fi -4,,e,. if.:,.:, , , ,. - .-4,--•, r:.• _."ffT,k,,,;,.:1..: ),,..:,,,.,,,„,,,,;:it..,,,,,-,,,i., ..,•1,,.. . , ,,„..v.,.,...s- .,,, ;.‘„.„-:-, ,y-,./.,,,,..„-,./.::::.Fic,.,l',:'5;. :.2, _ k 1,,," V A.,----..4„,,,,-.... .2,,..1,' (‘... ,.., g?.,,,p,. -?,-.:-:;.,,,er' . ,-..,, -., • ..-..... ( , ,,,,.. ,,,,,,t.:;-:-?:;-....T,5.-7,..,,..„:-/,',7---..i. :- . , . .:,,,,i:'...:,•:-...,. i..j.j.," ,:...., yi,o ..1 11f..(57/Tp'"':'-\., r•-..;-.'''''-:'1':::::::-:.-Ai, i 4-1,,-; )\--2),,,,,,,, ., .. v.::v.:.;.,- 1 .,'-....,',. /-..:::,::::: rt . ,:•:.. ,J2..--;,.si :-.'.----r;df I i.' V.., y „,,,:::.•'?-','-:., ‘‘`‘- • * Av --•-• "7; ",•' Lt." ir lkj..,.., -.:-.,,,...,.'imr<1,..-. 0, .• 44,re-.• ----• •- .• ,':•,.•,-,- •,., : -.. :•• . • :„-, ., , ,IT--*,?:. ...i, -., iv... : ' iviti.,,',,,-07 „, • ..., .•.. ;-. ----) fiv 1 ..1'...,..-7'.-.7',.:•''x,,,/,';',,'t,;,',;?::i'.‘ „•.,',,'/410, r'"', - , :,, ,,2,S.;./ '.'1,.:[,:-2.:."!,-"‘L" --?::' ,.. .i,,-Cavi..;-,., .1 .k ;;:-: ' .1.''ik"--'4,4-"- ,,; i..;-1,k.,.-----, i: ..:',Iiii i.o.t ( ,i‘ . -744,1,ii i-17-444i,„,---;-., ' , -,•-•:i:;.• '''. .":.';'..'-:- '' '':. •'. !*"“...-.:)••::::...‘? .•; -Ytir:.•-•'',‘:.,,- '';-, '. ..,,..,.4., . P.',:i.-...,,,7-4,_?,„otft_ ._ • i ..- ,,,,,,,?,,,,..!: ,,, ,,,.;s4„,,i.,t,,,,!..,t,,i51,4,4-.4 34,...,:„..„,-..,..7„:,...: . , ( ,.., .,'..,..,..s. •;::„...7,-,'":"."7-; -:,1 : , ; .1', ..',, 1 I',', ,-, '.."."-17,--i'';: i , -::' ^ 'Tr --titr;NT•:-,'*;-;,'':., ce :-• _ - .,,, ,,i,,t4.:1,.. --,,4•„-,.?-ff,,,,:.V:• •,-,0,-ty ,..;•,:.-,y9q,-1:PA ,--,,,t,........:•„,-,,,,,i..i.A.,, , • :•I I e.1} 11,2. 1 / }. ,It7iej -„,,.. ,,. ,7d4.4,030 " t ',.,. ' 'Wcrt0; ,-' * '';'''''-''''''•''''' '''''';;:51'''''''''' ''''' '''ritr.74-41'''. '''''' ' 7- Nei 4.1 liliiill:liliiiIATAilitlPirafialARMINgigill•-' '; 'e„.,-.,7 1 -_....: i%,.$•?' .,..1; ( - .1',., ,-,.:::-.',..<,.;. - 1),1"...,,!•.,....,',,, ,-....„,„ ,-,, .. ,f,,,,r17 , ,,,, , , lj,,ci,,,_,/, tliffiglifiC,74,1-10T&,.Olgtit,,!,,,rilit. ,o .ity:,6 ,r. ,..,:,,, .„.,„-,...4,..!„.'.., ,,•-.:.,....: • - - :,:*°„-,. •it , •fc ,,b--4/7 ,1.,./:7,',, ,,,,:t•.,,. .,./../ „,-,,,ALti y f . :::•,,1,,,„: ..1,. . ./i,,,,,,_,,, ,., , ,,,,,,.k !,,,„, r.,r,tki;;;',:,., .,' : N, ,,s,,,-.- „..„,--..:.c .•.-.-,u,,-.-:-.4,,C.' 4 -i iTA! .i,„, •.,, t, if/ • ',lv ..; V171:>,,1: c/e'; ''-,'',/ 4..,....:) I ,, '';\l'-‘ ,..Nd;7-`,;;!:9,:ii'-.V2,•,!.1„'! ..,::':•,,'.7,1!°,.),-'-',,f.. -.„„e".7• -;;:- :37: ‘: ''-,,,,, , ,'''Z'gfP'::::: ,--'47s--;',-; "4.L.:. I;(.. trac ;:i' '1.::'''i,'1:(:',/,'" 1:14:474,' "i'41. I' /,':%P/ Al—',';.*" 41 ;$'4:',;:;V/::2,4' .;, l' ; Z-s-,:tt,,'"',;;;S:',-.1.....''^ is., b„t:.-,}.:/1"/ 1,4,,i i.t.1;•:if . ,/ 0,...:,,,,..... ..' ••' - - ""\-,,,-,..-,i,..--t•• ''''•,.. • ,1: . .....44t,,,'w=•••,`:,':77-,*,•'' .—." • —P :19,:(1.:'1,.'7 • .- ''''•••/•,:".!'''› ' ". •— •''..I''. .P.' -•''''''`if i I-!it -. ''', --- . . ---- .'' -;,.--'R.... i.t.:.,,d.,• :i i pl.., (9,-oiw-..,,r„,,-,,,,,,, -.:c. ., • ,.. •-...,, .,,,,-,..:.) • ,.-•., ,. .._,..„:;• ,, ,. > ?,;,.... -- ,..,,,u,, , ,..=,.. , ,,,,, ,,::•,',.--1.-.','''% - , ., A,• .../(7',/,,,,-,-, if,?;,,',;:P.:),//:Z.k•-.,.---..,,,,4 L.....,{ ..,.-uf,,, ,,',/f_ ;',„,,=•-'f r 7- it ),:,,' ,„ -)iL.,k7 '1', J."ii,,,,-; , th.it -7.,':i. \,:,,,;--;;,..,..0,,,ici•L ‘', :" .1,(T".,(4/•---44"A; it.q.''' .1 r ip ( ,s,,,,..6,,,t.,..., .::„.77,,,..,4,-,„-,,..,,w,b,,•<.., s'.‘,,,-..,70.7.,,,,',...o. .,; .' ,,,--) :•-:/, '? ik,;- r ,r:4,i,' ui...,1'.‘.;;... ,,' ,,,,'• Asiiiik.1/4.. ...1/4,f-i./A,-;1;,,,__ .. ,,,/,,,,,,,ip IF'i, - ; '7.:. ''),'''',.•-•1 :,'' ' '.. 17'.,'}',Iltflt7C,'''1". ;--1, C'iV,,,' .140;' .: ','I::'"- i r' ;I,,i/or- t',',.;:- -,27:7,..-.7:- .--.r.::::-:-i';-141 -.-'-v 1; 1 ' 's ,..-:. •-'i„,- i••'• -,-.-,,:''', ft,', -,•''ft**4,,,'-?"1,,,,-,...\- --„t,, ,,,,,-; 1:, ,,-,,,,,,/,:l •t/' !AZ& ' ',/ .:' ..;/,‘;•-.--1/4,-,- - tA-„.„-..-tVi • 1-•-•-- ti ,,;(1)froc-s--• / ''/-1, , ! , • . ,,' i • • ,- 2;,.;-;::(.7 /-,/ '.'•-•';$,i ;;_ k"."•.,„•':, , 1^0.-.-•-:' ,/,',:::.1, •k,k ://(''' : , .i' '',t,l';',. \\.,,:, C1.:,;!,;-:"..-• ';',72,'://-'::\ '' .‘1'. :,',,c,4,-,0.;;' :4!, :;: il 4 iPit's,,:,'"-.4701L':' 1 `'';! ' '' ; .1''. ; f',.., :"' ' ':,4,'" '''':?i, ,..;'1'14'';'''-:-':-;;;VA\;( N,2'7).„ ''''‘ri,./ - 'Nil.,` ;j:':;-;•::',N;;; ;-,‘,':,,,:44:' --;„ ,//1-;:/-j l.; \\,'L',....-.,:k4:1; 0 '1111, ,',.. ) ii'; 1**7\‘treatea6;, '''',' f: , , ,,, ' 1 : ,,'k.. . • 1/4 ,•,,,.ti„..,". , ,--• ,,!4-,,,.„-c.,1,•,,„ 1/4%-s.4... ....,'?-,,,, 7:-,,,•(it1/4 .-'. . -'(r.2;.)-,i-i-,4,4_,,,,-6 ''t,-.7,, 4.,k,t...5-,,-4,,,,,.-- -.-,-,: :::- ,,.-2;'..f.:- ;;",v, 4,t.i,t,,0 . , .---;;f3,,,..,. --',' • 1:::4,.i.:1,;‘,/,,,i, ,.).... ,A,i, ...t 1 -- r, -ist-ow•sig )'•"' , .- , -- . , ?,, ,,.,,•• •— — ..••• •, •,0-:,,I.A-.'':;; ..-,..-r .):‘,''';',1: .1 ;', e (t.--. ,"'-'',,,,1 1,' .- -,•:.-'-' ;••'- '.:;p-,.'..r,''.' :• 'ty‘,„i'7-,;•.2-- ••:. -r-1" -"','i-,i,ili , ' \ •, ‘•.,1 1,,., 1..-.‘;'-‘, . 'A -• %,..t 0,-,,,: ,,,,,`,••4•••v•••,','f.' ; El,;,-• '4 •-8 • , f .,•,-i • ." ;,/ ,,,37-5-.• .-• ..-% • ,-,,,,,ii4\,.• -': '' --. ••' • - . ' ', k, s: \ • •••\.•v..':-.;.-..,','.1"..s';', c •,:.•. A ' '),',,,,,z, A. k:,, (--'2,i '• 7•• i • i $1,i( •/ ,`''''E''•Et4.-•,•;:;.. ';•C ' •' ' '.;44 E, i=•`.;•','N••., ,-.- •• ' ,i '•L--,:•-•.• ' ,Ei , • 1 ' 4 ' 1 '' V.•Vs-:- "-,SA:e•-•••,44:4:01-2.•:. ,,,v:.•\ 'k-5;. r.,-74-,-,-•,,-, I, - -------1-Wre7—' - ,, ; '. , / •• `.. ••, ,,-;;';':,•XA1-7,..-,..,• :',\''-'ktg.;a:',0*•..g; fc--,oCkiliiiia 1) • . , ' s', •:.•\Q•:.'i.i ., ',.:.: - -, ' .., ..,,'v4'417 .//,:',,,::-,"-,-„,; ;—, ",,.•;:0-''';',*eotzsz--:',-4:4; .:•,-;.a.) -/- . ' f - ,.., ,,.. .,,,' 0--: .i..:.' -'4i•-?<, •,,/ --•;;•..----\ -, '--• -•,1 ,./ - ---t' ; ,.'1 ,x . ., , - ' i., • -1,,[...•;:e,:;',74,•••., •• ,„,!•. ',•,,,K,•,:tg,,,,_,-,p,,-Az,, ,,,,-.. i• i _i- •• I. -"7,.,,,,,,,.,,p-,,,,.• -,1„s•1:-„kr.7,.„.< . ...,..,.. ; ..,' : • !,. .??,.4*.--`%- .. .2, ,,:. ,Fi;A7-. 4• :" •-•>•;'fr .' ( ;'.'. ‘i l• ,i. h. r. ': '.. ::. ".-.,',.‘,.i.• ....., 4`1 : I, if ..,- . ....- .. ' • "1 ' • ';'," '''' -ikeA`t,:v?,..it, ,,;>,.(./' •- .,--i,?. ,, :0-1-4.0,,,'; P.') .'V-P-f.".i.': ' f-i-V,ii. i, '- • L.'-'- y. ,...j,,,,,,, , ,, , i ,/(47:) c J. 1Z-litt 3"-it 90 rt '7",-,,,, ,,.., ,,,,,,,z-.--1,-4,4,e,...-,k) 0 ... • • --A• ..=x• ,( ‘ ••.•••••:\,... ,•1•'-•... ;,..-.-::; 1:• .- . = . ,e--f i ..\•,......,!,,,,,,,„,„,- , , , , , re„,,. , -.%!-,-A,..,,,,, ., r.,1 ,‘ „-...-i.„,,..w. ..,,,,_...,.. ••? --I, . ',)",•,-.'',1!)0',.. '...i',•<:?-:-,.--, - , r,i • / ,,f , , t, ,J ( ' -.• 0-->f, , 'A-4%; ,' ' ' `04,-eit'i .'•tRii,_-4 I " '', '".-!i'',--:°,stN''' -,,e.qzi,•,--7::-.k.k..'.1',, ,,,,,,,,,-.44, ;i:,,iff.'.-7/:,',•L,.. , "1 ;'atezif:.,,:1-,,,4-•--4,',- ;,...=r ---$ ...44... ,,‘• .4.fizry, ; •,.7<lz...t"tttr.L4 41,,,,,,4,-•- -1'1Y-.,-- , ' - ' "I '' I' ,,i,...' 641-..etMoL,,,1,.. .-A.2,..:-tit- . • • 0 0 • • • xoidk oo 3E1 .73 )d;(1eo SN; 0,)_top 1 .0s/ '7=7 d�') I, 9 II 7pH 71u;5 'xnddv ,0,/iv)_s'ril13 �, -V0?/ L-y -`)lv rs q 7 S' CITY OF RENTON, WASHINGTON • RESOLUTION NO. A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, DECLARING AN EMERGENCY FOR THE PURPOSES OF REPAIRING THE CULVERT AT THE CROSSING OF PANTHER CREEK AT CARR ROAD. WHEREAS, on March 21, 2008, approximately 35' of the 78" CMP culvert crossing at Can Road and Panther Creek was discovered to have been severely damaged; and WHEREAS, immediate repairs are necessary to that culvert to prevent further damage to the embankment and roadway above; and WHEREAS, such extraordinary repairs are not done in the ordinary course of business and are not being done to avoid regularly scheduled maintenance, repairs or installations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, • WASHINGTON, DOES RESOLVE AS FOLLOWS: SECTION I. The above recitals are found to be true and correct in all respects. SECTION II. An emergency is hereby declared permitting the immediate repair of damage to the Can Road and Panther Creek Culvert crossing, without the necessity of the public bid process. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. • Denis Law, Mayor 1 RESOLUTION NO. Approved as to form: Lawrence J. Warren, City Attorney RES.1334:4/7/08:scr 2 CITY OF RENTON COUNCIL AGENDA BILL AI #: —7. k. • Submitting Data: Public Works For Agenda of: Dept/Div/Board.. Utility Systems April 14, 2008 Staff Contact Abdoul Gafour, x7210 Agenda Status J.D. Wilson,x7295 Consent X Subject: Public Hearing.. Engineering Consultant Agreement with Correspondence.. HDR Engineering, Inc. for Evaluation of an Automatic Ordinance Meter Reading System Resolution Old Business Exhibits: New Business Issue Paper Study Sessions Engineering Consultant Agreement Information Recommended Action: Approvals: -Council Concur Legal Dept X f,24,m,-lb Finance Dept X Other Fiscal Impact: iiiExpenditure Required... $80,928.00 Transfer/Amendment N/A Amount Budgeted $100,000.00 (2008 budget for Revenue Generated N/A this contract-Acct.No. 425.018.5950.0034.63.u55591) Total Project Budget $200,000 (2008 budget) City Share Total Project.. 100% SUMMARY OF ACTION: The Water Utility requests approval of the Engineering Consultant Agreement with HDR, Engineering, Inc., in the amount of$80,928.00, to provide professional services to assist the City in the acquisition and implementation of an Automatic Meter Reading system. The Water Utility selected HDR Engineering, Inc., from the approved 2008 Utility Systems Annual Consultant Roster, to develop a feasibility study and cost analysis for the City's acquisition and implementation of an Automatic Meter Reading system. The Water Utility has budgeted sufficient funds in its 2008 Capital Improvement Program budget to cover the cost of the consultant contract. STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to execute the Engineering Consultant Agreement, in the amount of$80,928.00, with HDR Engineering, Inc., for the evaluation of the City's acquisition and development of an Automatic Meter Reading system. IIII H:\File Sys\WTR-Drinking Water Utility\WTR-13-Studies&Project Development\WTR-13-0103-AMR AMI MDM Selection\Consultant Contract\Agnbill_AMR.doc\AGtp Y Uti� 0 PUBLIC WORKS DEPARTMENT 1 �c MEMORANDUM DATE: April 4, 2008 TO: Marcie Palmer, Council President Members of the Renton City Council VIA: --iDenis Law, Mayor FROM: Gregg Zimmermi Zministrator STAFF CONTACT: Abdoul Gafour, Water Utility Supervisor (ext. 7210) J.D. Wilson, Water Utility Engineer (ext. 7295) SUBJECT: Engineering Consultant Agreement with HDR Engineering, Inc. for the Evaluation of an Automatic Meter Reading System ISSUE: Should Council approve an engineering consultant agreement with HDR Engineering, Inc., in the amount of$80,928.00, for consultant services to support the City's acquisition • and implementation of an Automatic Meter Reading system? RECOMMENDATION: Approve the Engineering Consultant Agreement and authorize the Mayor and City Clerk to execute the contract with HDR Engineering, Inc., in the amount of$80,928.00, for professional services related to the Automatic Meter Reading system. BACKGROUND SUMMARY: The Water Utility is beginning a multi-year effort to develop and install an Automatic Meter Reading (AMR systemfor all City's water meters. A fixed radio network AMR ) Y will provide our customers and the City with many benefits, including: • Monthlymeter readingWith the current meter reading staff, residential meters can only be read every other month. There are over 17,000 meters in the system and over 13,000 of these meters are residential accounts. Monthly metering and billing for water uses will provide our customers with more accurate and timely information regarding their water usage and billings. • Improved leak detection. The AMR will flag and alert us of unusual and high water usage and will enable staff to notify our customers to repair leaks on their service lines or on interior plumbing in a timely manner. • Immediate reads for customers' requests for starting or ending water service without field visits. • • Improved management of the City's water conservation program and of our ability to design conservation-oriented rate structures. Council/AMR Consultant Contract April 4,2008 Page 2 of 2 • Improved information for demand forecasts, water usage pattern analysis and • water system design. • Reduced operation and maintenance, worker's compensation, and fleet costs. • Deployment of meter reading personnel for higher value added services. The Water Utility is planning to deploy the system in phases, over the next five to ten years, subject to the completion of the consultant's evaluation of all costs associated with the project, and subject to Council's approval of a multi-year funding to complete the project. The first step in this effort will be to define meter reading requirements, evaluate the business case for AMR, develop a procurement strategy and document, solicit responses from qualified vendors, evaluate and select the most qualified vendor(s), and negotiate and execute a fair and equitable contract with the vendor(s) for a pilot test of the fixed network AMR system. The Water Utility selected HDR Engineering, Inc., from the approved 2008 Utility Systems Annual Consultant Roster, to develop a feasibility study and cost analysis for the City's acquisition and implementation of an Automatic Meter Reading system. HDR Engineering, Inc., has recently completed AMR studies for the City of Bellevue and the City of Olympia. Following the successful completion of the pilot test, the utility will expand the coverage of the fixed network radio meter reads to eventually include all meters served by the City's water system and a few meters used for wastewater flow measurement. The • current plan is for the water maintenance staff to purchase and install the radios at the meters. The initial pilot study will include the installation of the data collector radio receiver(s) and the data server and software, the interface to the utility billing system and some of the meter radios. The phasing of the full deployment of the system will be defined at the conclusion of the effort covered by this consultant contract. The Water Utility has budgeted sufficient funding for this consultant contract in the 2008 Capital Improvement Program budget for Automatic Meter Reading Conversion (Account # 425.018.5950.0034.63. u55591). Funding for the purchase and installation of the AMR equipment and replacement of meters will be phased in over the next five to ten years, subject to Council's approval of a multi-year budget to complete the project. CONCLUSION: In an effort to improve meter reading efficiency, to provide timely and accurate billing to our water customers, and to support the City's water conservation effort, the Water Utility needs to conduct an evaluation for the development of an Automatic Meter Reading system. Council's approval of the consultant contract with HDR Engineering, Inc., in the amount of$80,928.00, is needed for the consultant to assist the City in the procurement and implementation of the AMR system. Attachment • cc: Lys Hornsby,Utility Systems Director File H:\File Sys\WTR-Drinking Water Utility\WTR-13-Studies&Project Development\WTR-13-0103 -AMR AMI MDM Selection\Consultant Contract\Issue-Paper-contract-rev.doc\.1DWtp ENGINEERING • ANNUAL CONSULTANT AGREEMENT THIS AGREEMENT,made and entered into on this , day of , 2008,by and between the CITY OF RENTON,WASHINGTON,A MUNICIPAL CORPORATION HEREINAFTER CALLED THE "CITY," and HDR Engineering,Inc.. whose address is 626 Columbia Street NW, Suite 2-A, Olympia,WA 98507, at which work will be available for inspection,hereinafter called the "CONSULTANT." PROJECT NAME: AMR System Procurement and Assistance WHEREAS, the City has not sufficient qualified engineering employees to provide the engineering within a reasonable time and the City deems it advisable and is desirous of engaging the professional services and assistance of a qualified professional consulting firm to do the necessary engineering work for the project, and WHEREAS, the Consultant has represented and by entering into this Agreement now represents, that it is in full compliance with the statutes of the State of Washington for registration of professional engineers,has a current valid corporate certificate from the State of Washington or has a valid assumed name filing with the Secretary of State and that all personnel to be assigned to the work required under this Agreement are fully qualified to perform the work to which they will be assigned in a competent and professional manner, and that sufficient qualified personnel are on staff or readily available to Consultant to staff this Agreement. WHEREAS,the Consultant has indicated that it desires to do the work set forth in the Agreement upon the terms and conditions set forth below. NOW THEREFORE, in consideration of the terms, conditions, covenants and performances contained herein below, • the parties hereto agree as follows: I SCOPE OF WORK The Consultant shall furnish, and hereby warrants that it has,the necessary equipment,materials, and professionally trained and experienced personnel to facilitate completion of the work described in Exhibit A, Scope of Work, which is attached hereto and incorporated into this Agreement as though fully set forth herein. The Consultant shall perform all work described in this Agreement in accordance with the latest edition and amendments to local and state regulations, guidelines and policies. The Consultant shall prepare such information and studies as it may deem pertinent and necessary, in order to pass judgment in a sound engineering manner on the features of the work. The Consultant shall make such minor changes, amendments or revisions in the detail of the work as may be required by the City. This item does not constitute an "Extra Work" item as related in Section VIII of the Agreement. The work shall be verified for accuracy by a complete check by the Consultant. The Consultant will be held responsible for the accuracy of the work, even though the work has been accepted by the City. II DESIGN CRITERIA The City will designate the basic premises and criteria for the work needed. Reports and plans,to the extent feasible, shall be developed in accordance with the latest edition and amendments of local and State regulations, • guidelines, and specifications,including,but not limited to the following: Consultant Contract: AMR System Procurement and Assistance I 1. Washington State Department of Transportation/American Public Works Association(WSDOT/APWA), 0 "Standard Specifications for Road,Bridge,and Municipal Construction," as amended by Renton Standard Specification. 2. WSDOT/APWA, "Standard Plans for Road,Bridge and Municipal Construction." 3. Washington State Department of Transportation, "Highway Design Manual." 4. American Association of State Highway and Transportation Officials, "Standard Specifications for Highway Bridges." 5. Washington State Department of Transportation, "Bridge Design Manual,Volumes 1 and 2." 6. Washington State Department of Transportation, "Manual of Highways Hydraulics," except hydrologic analysis as described in item 14. 7. Washington State Department of Transportation, "Materials Laboratory Outline." 8. Transportation Research Board, "Highway Capacity Manual." 9. U.S. Department of Transportation,Federal Highway Administration, "Manual on Uniform Traffic Control Devices for Streets and Highways." 10. Washington State Department of Transportation, "Construction Manual." 11. Washington State Department of Transportation, "Local Agency Guidelines." III 12. Standard drawings prepared by the City and furnished to the Consultant shall be used as a guide in all cases where they fit design conditions. Renton Design Standards, and Renton Specifications shall be used as they pertain. 13. Metro Transit, design criteria. 14. King County Surface Water Design Manual, Sections 1.2 and 1.3 of Chapter 1,and Chapters 3,4, and 5. 15. American Association of State Highway and Transportation Officials, "A Policy on Geometric Design of Highways and Streets." III ITEMS TO BE FURNISHED TO THE CONSULTANT BY THE CITY The City will furnish the Consultant copies of documents which are available to the City that will facilitate the preparation of the plans, studies, specifications, and estimates within the limits of the assigned work. All other records needed for the study must be obtained by the Consultant. The Consultant will coordinate with other available sources to obtain data or records available to those agencies. The Consultant shall be responsible for this and any other data collection to the extent provided for in the Scope of Work. City will provide to Consultant all data in City's possession relating to Consultants services on the project. Consultant will reasonably rely upon the accuracy,timeliness, and completeness of the information provided by the City. Should field studies be needed,the Consultant will perform such work to the extent provided for in the Scope of Work. The City will not be obligated to • perform any such field studies. Consultant Contract: AMR System Procurement and Assistance 2 Sly OWNERSHIP OF PRODUCTS AND DOCUMENTS TO BE FURNISHED BY THE CONSULTANT Documents,exhibits or other presentations for the work covered by this Agreement shall be furnished by the Consultant to the City upon completion of the various phases of the work. All such material,including working documents,notes,maps,drawings,photo,photographic negatives,etc.used in the project, shall become and remain the property of the City and may be used by it without restriction. Any use of such documents by the City not directly related to the project pursuant to which the documents were prepared by the Consultant shall be without any liability whatsoever to the Consultant. All written documents and products shall be printed on recycled paper when practicable. Use of the chasing-arrow symbol identifying the recycled content of the paper shall be used whenever practicable. All documents will be printed on both sides of the recycled paper,as feasible. V TIME OF BEGINNING AND COMPLETION The work detailed in the Scope of Work will be performed according to Exhibit B,Time Schedule of Completion, attached hereto and incorporated herein as though fully set forth. It is agreed that all the Consultant's services are to be completed and all products shall be delivered by the Consultant unless there are delays due to factors that are beyond the control of the Consultant. The Consultant shall not begin work under the terms of this Agreement until authorized in writing by the City. If,after receiving Notice to Proceed,the Consultant is delayed in the performance of its services by factors that are beyond its control,the Consultant shall notify the City of the delay and shall prepare a revised estimate of the time and cost needed to complete the Project and submit the revision to the City for its . approval. Time schedules are subject to mutual agreement for any revision unless specifically described as otherwise herein. Delays attributable to or caused by one of the parties hereto amounting to 30 days or more affecting the completion of the work may be considered a cause for renegotiation or termination of this Agreement by the other party. III Consultant Contract: AMR System Procurement and Assistance 3 VI • PAYMENT The Consultant shall be paid by the City for completed work for services rendered under this Agreement as provided hereinafter as specified in Exhibit C,Cost Estimate. Such payment shall be full compensation for work performed or services rendered and for all labor,materials,supplies, equipment,and incidentals necessary to complete the work. All billings for compensation for work performed under this Agreement will list actual time(days and/or hours)and dates during which the work was performed and the compensation shall be figured using the rates in Exhibit C. Payment for this work shall not exceed$80,928.00 without a written amendment to this contract,agreed to and signed by both parties. Cost Plus Net Fee Payment for work accomplished shall be on the basis of the Consultant's actual cost plus a net fee. The actual cost includes direct salary cost,overhead,and direct non-salary cost. 1. The direct salary cost is the salary expense for professional and technical personnel and principals for the time they are productively engaged in the work necessary to fulfill the terms of this Agreement. The direct salary costs are set forth in the attached Exhibit C and by this reference made a part of this Agreement. 2. The overhead costs as identified on Exhibit C are determined as 175 percent of the direct salary cost and by this reference made a part of this Agreement. The overhead cost rate is an estimate based on currently available accounting information and shall be used for all progress payments over the period of the contract. 3. The direct non-salary costs are those costs directly incurred in fulfilling the terms of this Agreement, • including,but not limited to travel,reproduction,telephone, supplies, and fees of outside consultants. The direct non-salary costs are specified in Exhibit C,Cost Estimate. Billings for any direct non-salary costs shall be supported by copies of original bills or invoices. Reimbursement for outside consultants and services shall be on the basis of times the invoiced amount. 4. The net fee,which represents the Consultants profit shall be 15 percent of direct salary plus overhead costs. This fee is based on the Scope of Work and the estimated labor hours therein. In the event a supplemental agreement is entered into for additional work by the Consultant,the supplemental agreement will include provision for the added costs and an appropriate additional fee. The net fee will be prorated and paid monthly in proportion to the percentage of the project completed as estimated in the Consultant's monthly progress reports and approved by the City. Any portion of the net fee not previously in the monthly paments shall be included in the final payment,subject to the provisions of Section XI entitled TERMINATION OF AGREEMENT. 5. Progress payments may be claimed monthly for direct costs actually incurred to date as supported by detailed statements, for overhead costs and for a proportionate amount of the net fee payable to the Consultant based on the estimated percentage of the completion of the services to date. Final payment of any balance due the Consultant of the gross amount earned will be made promptly upon its verification by the City after completion and acceptance by the City of the work under this Agreement. Acceptance,by the Consultant of final payment shall constitute full and final satisfaction of all amounts due or claimed to be due. Payment for extra work performed under this Agreement shall be paid as agreed to by the parties hereto in writing at the time extra work is authorized. (Section VIII "EXTRA WORK"). A short narrative progress report shall accompany each voucher for progress payment. The report shall include • discussion of any problems and potential causes for delay. Consultant Contract: AMR System Procurement and Assistance 4 . To provide a means of verifying the invoiced salary costs for consultant employees, the City may conduct employee interviews. Acceptance of such final payment by the Consultant shall constitute a release of all claims of any nature,related to this Agreement,which the Consultant may have against the City unless such claims are specifically reserved in I writing and transmitted to the City by the Consultant prior to its acceptance. Said final payment shall not,however, be a bar to any claims that the City may have against the Consultant or to any remedies the City may pursue with respect to such claims. The Consultant and its subconsultants shall keep available for inspection,by the City,for a period of three years after final payment,the cost records and accounts pertaining to this Agreement and all items related to,or bearing upon, these records. If any litigation,claim or audit is started before the expiration of the three-year retention period,the records shall be retained until all litigation, claims or audit findings involving the records have been resolved. The three-year retention period starts when the Consultant receives final payment. VII CHANGES IN WORK The Consultant shall make all such revisions and changes in the completed work of this Agreement as are necessary to correct errors appearing therein,when required to do so by the City,without additional compensation. Should the City find it desirable for its own purposes to have previously satisfactorily completed work or parts thereof revised,the Consultant shall make such revisions,if requested and as directed by the City in writing. This work shall be considered as Extra Work and will be paid for as provided in Section VIII. VIII III EXTRA WORK The City may desire to have the Consultant perform work or render services in connection with the Project in addition to or other than work provided for by the expressed intent of the Scope of Work. Such work will be considered as Extra Work and will be specified in a written supplement which will set forth the nature and scope thereof. Work under a supplement shall not proceed until authorized in writing by the City. Any dispute as to whether work is Extra Work or work already covered under this Agreement shall be resolved before the work is undertaken. Performance of the work by the Consultant prior to resolution of any such dispute shall waive any claim by the Consultant for compensation as Extra Work. IX EMPLOYMENT The Consultant warrants that it has not employed or retained any company or person,other than a bona fide employee working solely for the Consultant,to solicit or secure this contract and that he has not paid or agreed to pay any company or person, other than a bona fide employee working solely for the Consultant,any fee, commission, percentage,brokerage fee,gifts or any other consideration, contingent upon or resulting from the award or making of this contract. For breach or violation of this warranty,the City shall have the right to annul this Agreement without liability,or in its discretion to deduct from the Agreement price or consideration or otherwise recover,the full amount of such fee, commission,percentage,brokerage fee, gift or contingent fee. Any and all employees of the Consultant,while engaged in the performance of any work or services required by the Consultant under this Agreement, shall be considered employees of the Consultant only and not of the City and any j and all claims that may or might arise under the Workman's Compensation Act on behalf of said employees,while so engaged and any and all claims made by a third party as a consequence of any negligent act or omission on the part • of the Consultant's employees,while so engaged on any of the work or services provided to be rendered herein, shall be the sole obligation and responsibility of the Consultant. Consultant Contract: AMR System Procurement and Assistance 5 The Consultant shall not engage,on a full or part-time basis,or other basis,during the period of the contract,any • professional or technical personnel who are, or have been at any time during the period of this contract,in the employ of the City except regularly retired employees,without written consent of the City. If during the time period of this Agreement, the Consultant finds it necessary to increase its professional, technical,or clerical staff as a result of this work,the Consultant will actively solicit minorities through their advertisement and interview process. X NONDISCRIMINATION The Consultant agrees not to discriminate against any client,employee or applicant for employment or for services because of race,creed,color,national origin,marital status,sexual orientation,sex, age or handicap except for a bona fide occupational qualification with regard to,but not limited to the following: employment upgrading; demotion or transfer; recruitment or any recruitment advertising; layoff or termination's;rates of pay or other forms of compensation;selection for training;rendition of services. The Consultant understands and agrees that if it violates this Non-Discrimination provision,this Agreement may be terminated by the City and further that the Consultant shall be barred from performing any services for the City now or in the future,unless a showing is made satisfactory to the City that discriminatory practices have terminated and that recurrence of such action is unlikely. XI TERMINATION OF AGREEMENT A. The City reserves the right to terminate this Agreement at any time upon not less than ten(10)days written notice to the Consultant, subject to the City's obligation to pay Consultant in accordance with subparagraphs C and D below. • B. In the event of the death of a member,partner or officer of the Consultant, or any of its supervisory personnel assigned to the project,the surviving members of the Consultant hereby agree to complete the work under the terms of this Agreement,if requested to do so by the City. This section shall not be a bar to renegotiations of this Agreement between surviving members of the Consultant and the City,if the City so chooses. In the event of the death of any of the parties listed in the previous paragraph,should the surviving members of the Consultant,with the City's concurrence,desire to terminate this Agreement,payment shall be made as set forth in Subsection C of this section. Consultant Contract: AMR System Procurement and Assistance 6 • C. In the event this Agreement is terminated by the City other than for fault on the part of the Consultant, a final payment shall be made to the Consultant for actual cost for the work complete at the time of termination of the Agreement,plus the following described portion of the net fee. The portion of the net fee for which the Consultant shall be paid shall be the same ratio to the total net fee as the work complete is to the total work required by the Agreement. In addition,the Consultant shall be paid on the same basis as above for any authorized extra work completed. No payment shall be made for any work completed after ten(10)days following receipt by the Consultant of the Notice to Terminate. If the accumulated payment made to the Consultant prior to Notice of Termination exceeds the total amount that would be due as set forth herein above,then no final payment shall be due and the Consultant shall immediately reimburse the City for any excess paid. D. In the event the services of the Consultant are terminated by the City for fault on the part of the Consultant,the above stated formula for payment shall not apply. In such an event the amount to be paid shall be determined by the City with consideration given to the actual costs incurred by the Consultant in performing the work to the date of termination,the amount of work originally required which was satisfactorily completed to date of termination,whether that work is in a form or of a type which is usable to the City at the time of termination,the cost to the City of employing another firm to complete the work required and the time which may be required to do so,and other factors which affect the value to the City of the work performed at the time of termination. Under no circumstances shall payment made under this subsection exceed the amount which would have been made if the formula set forth in subsection C above had been applied. E. In the event this Agreement is terminated prior to completion of the work,the original copies of all Engineering plans,reports and documents prepared by the Consultant prior to termination shall become the property of the City for its use without restriction. Such unrestricted use not occurring as a part of this • project,shall be without liability or legal exposure to the Consultant. F. Payment for any part of the work by the City shall not constitute a waiver by the City of any remedies of any type it may have against the Consultant for any breach of this Agreement by the Consultant, or for failure of the Consultant to perform work required of it by the City. Forbearance of any rights under the Agreement will not constitute waiver of entitlement to exercise those rights with respect to any future act or omission by the Consultant. XII DISPUTES Any dispute concerning questions of facts in connection with work not disposed of by agreement between the Consultant and the City shall be referred for determination to the Director of Planning/Building/Public Works or his/her successors and delegees,whose decision in the matter shall be final and conclusive on the parties to this Agreement. In the event that either party is required to institute legal action or proceedings to enforce any of its rights in this Agreement,both parties agree that any such action shall be brought in the Superior Court of the State of Washington, situated in King County. XIII LEGAL RELATIONS The Consultant shall comply with all Federal Government, State and local laws and ordinances applicable to the work to be done under this Agreement. This contract shall be interpreted and construed in accordance with the laws of Washington. • The Consultant agrees to indemnify,defend and hold the City and its officers and employees harmless from and shall process and defend at its own expense all claims,demands or suits at law or equity arising in whole or part from the Consultant Contract: AMR System Procurement and Assistance 7 Consultant's errors,omissions, or negligent acts under this Agreement provided that nothing herein shall require the • Consultant to indemnify the City against and hold harmless the City from claims,demands or suits based upon the conduct of the City,its officers or employees and provided further that if the claims or suits are caused by or result from the concurrent negligence of(a)the Consultant's agents or employees and(b)the City, its agents, officers and employees,this provision with respect to claims or suits based upon such concurrent negligence shall be valid and enforceable only to the extent of the Consultant's negligence or the negligence of the Consultant's agents or employees except as limited below. The Consultant shall secure general liability,property damage,auto liability,and professional liability coverage in the amount of$1.0 million,with a General Aggregate in the amount of$2.0 million,unless waived or reduced by the City. The Consultant shall submit a completed City of Renton Insurance Information Form,and the Standard Acord Certification Form prior to the execution of the contract. The City of Renton will be named as Additional Insured(s)on(CONTRACTOR'S)policy,with that coverage being primary and non-contributory with any other policy(ies)available to the City. A copy of the endorsement shall be provided to the City. The limits of said insurance shall not,however,limit the liability of Consultant hereunder. All coverages provided by the Consultant shall be in a form,and underwritten by a company acceptable to the City. The City will normally require carriers to have minimum A.M. Best rating of A XII. The Consultant shall keep all required coverages in full force and effect during the life of this project,and a minimum of forty five days'written notice shall be given to the City prior to the cancellation of any policy. The Consultant shall also submit copies of the declarations pages of relevant insurance policies to the City within 30 days of contract acceptance if requested. The Certification and Declaration page(s) shall be in a form as approved by • the City. If the City's Risk Manager has the Declaration page(s)on file from a previous contract and no changes in insurance coverage has occurred,only the Certification Form will be required. The Consultant shall verify,when submitting first payment invoice and annually thereafter,possession of a current City of Renton business license while conducting work for the City. The Consultant shall require, and provide verification upon request,that all subconsultants participating in a City project possess a current City of Renton business license. The Consultant shall provide,and obtain City approval of,a traffic control plan prior to conducting work in City right-of-way. The Consultant's relation to the City shall be at all times as an independent contractor. It is further specifically and expressly understood that the indemnification provided herein constitute the Consultant's waiver of immunity under the Industrial Insurance Act, Title 51 RCW, solely for the purposes of this indemnification. This waiver has been mutually negotiated by the parties. The provisions of this section shall survive the expiration or termination of this agreement. XIV SUBLETTING OR ASSIGNING OF CONTRACTS The Consultant shall not sublet or assign any of the work covered by this Agreement without the express consent of the City. XV ENDORSEMENT OF PLANS The Consultant shall place their certification on all plans,specifications,estimates or any other engineering data furnished by them in accordance with RCW 18.43.070. • Consultant Contract: AMR System Procurement and Assistance 8 • XVI COMPLETE AGREEMENT This document and referenced attachments contain all covenants, stipulations,and provisions agreed upon by the parties. Any supplements to this Agreement will be in writing and executed and will become part of this Agreement. No agent,or representative of either party has authority to make,and the parties shall not be bound by or be liable for,any statement,representation,promise,or agreement not set forth herein. No changes,amendments,or modifications of the terms hereof shall be valid unless reduced to writing and signed by the parties as an amendment to this Agreement. The invalidity or unenforceability of any provision in this Agreement shall not affect the other provisions hereof,and this Agreement shall be construed in all respects as if such invalid or unenforceable provision were omitted. XVII EXECUTION AND ACCEPTANCE This Agreement may be simultaneously executed in several counterparts, each of which shall be deemed to be an original having identical legal effect. The Consultant does hereby ratify and adopt all statements,representations, warranties,covenants,and agreements contained in the Request for Qualifications, and the supporting materials submitted by the Consultant,and does hereby accept the Agreement and agrees to all of the terms and conditions thereof. IN WITNESS WHEREOF,the parties hereto have executed this Agreement as of the day and year first above written. CONSULTANT CITY OF RENTON Signature Date Denis Law,Mayor Date David R. Skinner ATTEST: HDR Vice President/Assist.Dept. Manager Bonnie I. Walton,City Clerk • Consultant Contract: AMR System Procurement and Assistance 9 March 17, 2008 Exhibit A — Scope of Work City of Renton AMR System Procurement and Assistance Scope of Services Objective and Approach The City of Renton (City) has elected to pursue implementation of a fixed network Automated Meter-Reading (AMR, or AMR/AMI) system for its water utility. The City has selected HDR Engineering, Inc. (HDR) to provide assistance to the City with regard to procurement and implementation of such a system. The approach to this project consists of three primary tasks: 1) defining procurement requirements; 2) performing procurement; and, 3) implementing a "pilot" or initial phase of AMR deployment. The following detailed scope of services pertains to the first two tasks of the project. It is anticipated that further definition of the pilot or initial implementation phase will be developed dud ng the course of the first two tasks, and that a detailed scope and budget for the third task will be prepared at the conclusion of the first two tasks. • TASK 100 — DEFINE PROCUREMENT REQUIREMENTS Task 110 — Define Meter-Reading Requirements Objective: 1. Identify and clarify the City's issues, needs, and requirements regarding metering. Consultant Services: 1. Provide detailed data request to City. 2. Conduct interviews with City staff from various departments that are associated with, or impacted by, meter reading. 3. Review current meter-reading practices and procedures. City Responsibilities: 1. Identify appropriate staff to be present duri ng interviews. 2. Provide data identified in data request. Exhibit A • Cityyof Renton AMR System Procurement and Assistance Scope of Services March 17, 2008 • Assumptions: 1. One day of interviews will be sufficient for HDR staff to gain a solid understanding of the City's current meter-reading practices/procedures and needs/desires regarding the future system. Deliverables: 1. None. Task 120 — Evaluate the Business Case for AMR Objective: 1. Determine the financial impacts of transitioning to AMR. Consultant Services: 1. Develop total life cycle costs and operational savings projected for up to three AMR implementation scenarios, considering different implementation time periods and/or deployment methods. 2. Prepare a cost/benefit analysis of the current meter-reading program versus implementation of the scenarios described above. City Responsibilities: • 1. Review and provide comments on cost/benefit analysis within two weeks of receipt. Assumptions: 1. HDR will utilize an existing spreadsheet cost model developed for similar previous projects with other utilities. 2. Data obtained in Task 110 will be used in development of the cost model. 3. Up to three different AMR implementation scenarios will be evaluated. Deliverables: 1. Brief technical memorandum summarizing the results of the cost/benefit analysis. Task 130 — Develop Procurement Strategy Objective: 1. Identify the procurement strategy best suited to meet the City's needs. Consultant Services: 1. Identify key elements to be included in the procurement process. This will include identification of installation, support and training, warranty, and Exhibit A • City of Renton AMR System Procurement and Assistance Scope of Services March 17, 2008 maintenance requirements that will be recommended for inclusion in the • procurement document. 2. Identify new or modified business processes and operating procedures that will be needed to support AMR implementation. 3. Define the key procurement activities and the roles/responsibilities throughout the process for City staff, HDR, and the vendor(s). City Responsibilities: 1. Review and provide comments on recommended procurement strategy within two weeks of receipt. Assumptions: 1. The estimated duration of Task 100 (inclusive of Tasks 110 and 120) is four-six weeks. Deliverables: 1. Technical memorandum describing the recommended procurement strategy and providing a timeline of milestone events from the point of contract award through installation. TASK 200 -PROCUREMENT PROCESS MANAGEMENT • Task 210 — Develop Procurement Document Objective: 1. Prepare technical and bidding specifications for procurement of an AMR system. Consultant Services: 1. Develop the technical requirements of the bid package. This will include: procurement rules and guidelines, instructions to bidders, project description including present meter and meter-reading requirements, minimum qualifications, technical and business requirements of the vendor(s), evaluation criteria, and selection methodology. 2. Assist the City in preparing the overall bid package so that it conforms to City requirements. City Responsibilities: 1. Identify appropriate staff to serve on a Selection Committee, which will be involved throughout the procurement process and ultimately select the preferred vendor(s). It is suggested that the Selection Committee be limited to no more than seven people, including representatives from Account Services and Billing, Exhibit A • City of Renton AMR System Procurement and Assistance Scope of Services March 17, 2008 • Meter Maintenance, Meter Reading, and Customer Service. Throughout the procurement process, HDR will act as an advisor to the committee. 2. Provide comments on the technical specifications withi n two weeks of receipt. 3. Incorporate the technical specifications developed by HDR i nto City-standard bidding forms and requirements (e.g., insurance requirements, affirmative action, equal employment opportunity, etc.) to develop a complete bid package. Assumptions: 1. One meeting between the Selection Committee and HDR (two staff) is anticipated to discuss the d raft bidding docum ents. Deliverables: 1. Draft and final technical bidding specifications. Task 220 — Solicit Responses from Qualified Vendors Objective: 1. Facilitate proposal process. Consultant Services: 1. Conduct a pre-proposal conference. This will include preparing a summary of 1111 the City's objectives and requirements, scheduling and logistics for the conference, and responding to any questions and data requests presented at the conference. 2. Support the City in responding to questions and data requests. It is suggested that a master list of any requests be maintained in a database in or der to ensure that all responses are addressed and that all respondents have received the response. During the proposal phase HDR will respond in writing to questions from prospective bidders. City Responsibilities: 1. Arrange for a meeting room in which to hold the pre-proposal conference. Assumptions: 1. Two HDR staff will facilitate the pre-proposal conference. Deliverables: 1. Written responses to bidder questi ons. Task 230 — Evaluate and Select the Most Qualified Vendor(s) Objective: 1. Identify the preferred AMR vendor(s). • Exhibit A City of Renton AMR System Procurement and Assistance Scope of Services March 17, 2008 Consultant Services: 1111 1. Develop a matrix that can be used as a checklist of subm ission requirements, and measurement of the respondent's ability to address meter and meter reading requirements. This matrix will allow the Selection Committee to rank the respondents in the major aspects of the proposal review, including submittal requirements, technical capability, knowledge of metering and AMR, water utility business acumen, and price. 2. Prepare a technical memorandum summarizing the features and benefits included in the proposals, and recommend up to three firms that will be invited for vendor presentations. 3. Assist with respondent interviews for up to three selected vendors, including scheduling interviews, establishing interview guidelines, developing a presentation script, and moderating the process. 4. Assist with reference checks of the highest ranked respondents. Reference checks will be thorough and corn prehensive as it is through this process that the truly outstanding firms and systems are made apparent. HD R will conduct due diligence on the selected vendors' financials, experience and qualifications. A list of questions will be developed and we will attempt to contact three current customers. 5. Arrange for site visits with selected references to confirm a respondent's capabilities through observation and open dialog with other utilities using vendors' equipment. We will schedule and attend up to three site visits with the City staff of other utilities currently using the system. 6. Prepare a technical memorandum to summarize the evaluation and selection process. While this summary will be drafted by HDR, it is the Selection Committee that will rank the proposals and recom mend a preferred vendor. City Responsibilities: 1. Review and provide comments, within two weeks of receipt, on technical memorandum summarizing proposals. 2. Select up to three vendors for interviews. 3. Attend vendor interviews. 4. Attend site visits. 5. Review and provide comments, within two weeks of receipt, on technical memorandum summarizing the evaluation and selection process. 6. Provide final ranking of proposals and select a preferred vendor. Assumptions: 1. Up to two days will be needed for vendor interviews. Two H DR staff will be present to facilitate each interview. 2. Up to three site visits will be arranged. One HDR staff will be present to facilitate each site visit. Exhibit A City • Cityyof Renton AMR System Procurement and Assistance Scope of Services March 17, 2008 • Deliverables: 1. Technical memorandum describing the AMR proposals received. 2. Evaluation matrix. 3. Technical memorandum describing the evaluation and selection proces s. Task 240 — Negotiate and Execute a Fair and Equitable a g q Contract Objective: 1. Execute a contract with the selected AMR vendor(s). Consultant Services: 1. Advise the City during contract negotiations. This will include developing a negotiation schedule, a ssisting in development of a draft contract, and serving as a liason between the lead responden t and the City. 2. Assist the City in a presentation to City Council, should one be required to gain final contract approval. City Responsibilities: 1. While HDR will facilitate the negotiation process, and provide advice to the City, the City will take the lead in developing a contract with the selected AM R vendor(s). Assumptions: 1. One presentation to City Council is included in the budget for this task item. Deliverables: 1. Negotiation schedule. 2. Written comments on draft contract. TASK 300 - PILOT IMPLEMENTATION AND ADMINISTRATION Detailed scope and fee to be determined at the conclusion of Task 200. • Exhibit A City of Renton AMR System Procurement and Assistance Scope of Services EXHIBIT B • AMR System Procurement and Assistance SCHEDULE • Task Estimated Start Estimated Completion 110—Define Meter-Reading At NTP 3 weeks from NTP Requirements 120—Evaluate the Business 2 weeks from NTP 5 weeks from NTP Case for AMR 130—Develop Procurement 3 weeks from NTP 6 weeks from NTP Strategy 210—Develop Procurement 6 weeks from NTP 12 weeks from NTP Document 220—Solicit Responses from 12 weeks from NTP 14 weeks from NTP Qualified Vendors 230—Evaluate and Select the 14 weeks from NTP 18 weeks from NTP Most Qualified Vendor(s) 240—Negotiate and Execute 18 weeks from NTP 22 weeks from NTP Contract Ncr mkt sh ANDECl ii S w 31)2005 • • • EXHIBIT C COST PLUS NET FEE DETERMINATION DIRECT SALARY COST: Classification Hourly Rate Project Manager $42.00 Program Manager $70.00 Project Principal $60.60 Sr. Eng—QA/QC $49.28 Sr. Engineer $48.00 Project Engineer $24.00 Project Controller $20.50 Admin. Support $20.25 Net Fee: 12% of direct salary cost plus overhead DIRECT NON-SALARY COST: Cost Element Unit Cost Cost Element Unit Cost In-house copies No cost Mileage $0.445/mile • Telephone/Fax No cost Computer&Technology $3.70/MH Other direct expenses, including postage and supplies, are charged at cost. The direct salary costs set forth in Exhibit C reflect the Consultant's 2008 salary rates. i • EXHIBIT C cont. • SUMMARY OF FEE FOR ENGINEERING SERVICES BREAKDOWN OF OVERHEAD COST Administrative Salaries 38.96% Holiday, Sick&Vacation Pay 14.03% Bid&Proposal Costs 7.47% Advertising Costs 0.00% Staff Bonus 17.47% Payroll Taxes 14.93% 401(k) 5.20% Employee Insurance&Benefits 12.78% Recruiting 0.37% Insurance 3.31% Dues& Professional Meetings 0.41% Publications 1.11% Rent 17.21% Office Supplies&Postage 6.57% Training& Education 0.92% Trade, Business, Technical&Professional Activities 1.53% Computer Expense 3.29% Telephone 4.41% • Equipment Maintenance&Depreciation 9.13% Professional Services 5.42% State B&O taxes and other Business taxes 7.27% Travel&Auto Expense 3.21% TOTAL 175.00% SUMMARY OF COSTS Direct Salary Cost $23,548.00 Overhead Cost(including payroll additives) 175.00% $41,208.00 Subtotal $64,756.00 Net Fee 12% $7,771.00 Direct Non-Salary Costs a. Technology charge,postage,mileage,etc. $8,402.00 b. Subconsultants $0 Subtotal $8,402.00 GRAND TOTAL $80,928.00 • • 0 0 . Table C-1 AMR System Procurement and Assistance Prepared: 3/17/2008 Budget and Fee Breakdown HOURS FOR EACH TASK Task 100-Define Procurement Rqmts Task 200-Procurement Process Mc,mt Labor Subtotal Subtotal Total HDR Labor Rate 110 120 130 100 210 220 230 240 :200 Hours Cost J.Hansen 42.00 20 24 12 56 30 20 40 20 110 166 $6,972 T.Jakubowski 70.00 20 24 8 52 50 20 40 20 130 182 $12,740 G.Pierson 60.60 1 1 1 3 1 1 1 1 4 7 $424 D.Bell 48.00 0 16 16 16 $768 T.Hume 49.28 0 6 6 6 $296 E.Habermeyer 24.00 30 30 0 30 $720 S.Cody 20.25 2 8 4 14 20 2 8 4 34 48 $972 S.Voss 20.50 4 4 4 12_ 4 6 6 4 20 32 $656 Total Hours 47 91 29 167_ 127 49 95 49 320 487 $23,548 Subtotal Direct Labor $2,423 $3,713 $1,288 $7,423 $6,371 $2,464 $4,826 $2,464 $16,125 -,"` " $23,548 Overhead @ 1.75 $4,240 $6,497 $2,253 $12,990 $11,150 $4,312 $8,445 $4,311 $28,218 ", $41,208 HDR Salary Cost $6,663 $10,210 $3,541 $20,413 $17,521 $6,776 $13,271 $6,775 $44,343 ,,,,,: , it :.�< $64,756 - Net Fee @ 12% 0.12 $7,771 Total HDR Labor Cost $64,756 Direct Expenses $8,402 Total Cost $80,928 Table C-2 AMR System Procurement and Assistance Prepared: 3/17/2008 Direct Expenses Breakdown HDR Technology Task Cost HDR Travel Total 110 $173.90 $1,050 $1,224 120 $336.70 $50 $387 130 $107.30 $50 $157 210 $469.90 $1,050 $1,520 220 $181.30 $1,050 $1,231 230 $351.50 $2,250 $2,602 240 $181.30 $1,100 $1,281 Total $1,801.90 $6,600 $8,402 • • • FINANCE COMMITTEE REPORT 01,ft,n, f : CLII "i�.00-'I4@iCEL April 14,2008 - Dat� APPROVAL OF"CLAIMS AND PAYROLL VOUCHERS The:'Finance Committee approves;for payment on April 14, 2008, claim:vouchers270646=271338. and 3 wire transfers, totaling$5,024,557:70.; and 744 direct deposits,.14.1'payroll vouchers,and 1 wire transfer, totaling_$2,500,272.17-- _ Don,Persson, ,hair , C Terri.Brier ee-Chair if - g artier, Member u r OOJNCI$ .; FINANCE COMMITTEE • COMMITTEE REPORT - . Date 14..gO°8" April14, 2008 Lease Amendment with LSI Logic.Corporation • (LAG-00-002) (Apri1.7, 20.08). > The.Finance Committee recommends concurrence in the staff recommendation-to,approve an extension of the lease with LSI Logic Corporation(formerly known as Engemo Information, Technololgies, Inc) for the third floor of the 200 Mill Building arid authorize the Mayor and City Clerk to sign the.ainendment: Don Persson,Chair // Terrk4fffere, ic711 hair King Parker;Member _cc: TenY Ifigashiyatna,Communi tyServicesAdministrator PeterR nner Facilities Director O ! by FINANCE COMMITTEE - . ' COMMITTEE REPORT bate 9-1 -AOG _ - April'144;2008 , Request to Overfill Public Works Principal Financial_and Administrative :. ' - (April',7,2008) , The Finance Committee recommends concurrence in the staff recommendation to.overfill;the ' , Public Works Principal Financial and Administrative Analyst position.for 30 days prior to the ' accepted resignation date of:: the current staff member for effective training,purposes;.which - ; would allow a projected hiring date of May 15,2008. Don.Persson, Chair". - i Te one :*air - — _ ' - - King.Parker,Member cc 'Gregg Zimmerman,Public Works Administrator: ; Eileen Flott,Interim:Hunian"Resources/Risk'Management Administrator":': ' - Milce.Bailey,'FIS Administrator Nenita Ching,Principal Financial and Administrative Analyst - CITY OF RENTON, WASHINGTON RESOLUTION NO. 3.9'!/ A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING THE MAYOR AND CITY CLERK TO EXECUTE THE FIRST AMENDMENT TO THE MEMORANDUM OF UNDERSTANDING REGARDING AIRPORT ISSUES BETWEEN THE CITY OF RENTON AND THE CITY OF MERCER ISLAND. WHEREAS, on April 9, 2007, the cities of Renton and Mercer Island signed a Memorandum of Understanding (MOU), CAG-07-068, which established a cooperative relationship in the process of updating the Airport Layout Plan, which is a major component in the 1997 Airport Master Plan; and WHEREAS, a First Amendment to the MOU has been prepared, which addresses the termination of the Request for Proposal for a jet center at the Airport and the cancellation of the Airport Noise Study; and WHEREAS, the Airport Noise Study, which was outlined in the MOU, was cancelled in early 2008, when The Boeing Company announced its intent to again lease a portion of Apron B; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DOES RESOLVE AS FOLLOWS: SECTION I. The above findings are true and correct in all respects. SECTION II. The Mayor and City Clerk are hereby authorized to execute the First Amendment to the Memorandum of Understanding Regarding Airport Issues between the City of Renton and the City of Mercer Island. 1 • RESOLUTION NO. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor Approved as to form: Lawrence J. Warren, City Attorney RES.13 31:3/26/08:scr 2 - y/y-aor CITY OF RENTON, WASHINGTON RESOLUTION NO. a9V2 A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, DECLARING AN EMERGENCY FOR THE PURPOSES OF REPAIRING THE CULVERT AT THE CROSSING OF PANTHER CREEK AT CARR ROAD. WHEREAS, on March 21, 2008, approximately 35' of the 78" CMP culvert crossing at Can Road and Panther Creek was discovered to have been severely damaged; and WHEREAS, immediate repairs are necessary to that culvert to prevent further damage to the embankment and roadway above; and WHEREAS, such extraordinary repairs are not done in the ordinary course of business and are not being done to avoid regularly scheduled maintenance, repairs or installations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DOES RESOLVE AS FOLLOWS: SECTION I. The above recitals are found to be true and correct in all respects. SECTION II. An emergency is hereby declared permitting the immediate repair of damage to the Can Road and Panther Creek Culvert crossing, without the necessity of the public bid process. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor 1 RESOLUTION NO. Approved as to form: Lawrence J. Warren, City Attorney RES.1334:4/7/08:scr � I 2 CITY OF RENTON, WASHINGTON • ORDINANCE NO. AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, VACATING A PORTION OF ALLEY RIGHT-OF-WAY LOCATED SOUTH OF SOUTH TOBIN STREET, BETWEEN BURNETT AVENUE SOUTH AND WILLIAMS AVENUE SOUTH, (FRIEDMAN DEVELOPMENT, L.L.C.; VAC-04-004). WHEREAS, a proper petition for vacating an alley right-of-way ten feet wide and approximately 50 feet in length running north and south and approximately 115 feet in length running east and west, located south of South Tobin Street, between Burnett Avenue South and Williams Avenue South, was filed with the City Clerk on August 5, 2004, and that petition was signed by the owners representing more than two-thirds (2/3) of the property abutting upon the street or alley to be vacated; and WHEREAS, the City Council, by Resolution No. 3719, passed on September 27, 2004, • set October 25, 2004, at 7:30 p.m., in the City Council Chambers of the City of Renton as the time and place for a public hearing on this matter; and the City Clerk having given proper notice of this hearing as provided by law, and all persons having been heard who appeared to testify in favor or in opposition on this matter, and the City Council having considered all information and arguments presented to it; and WHEREAS, the Administrator of the Planning/Building/Public Works Department has considered this petition for vacation, and has found it to be in the public interest and for the public benefit, and that no injury or damage to any person or properties will result from this vacation; and WHEREAS, on April 11, 2005, City Council adopted the recommendation of the Planning and Development Committee to accept compensation at $25,500 for the alley vacation 110 1 ORDINANCE NO. • and accepted the 20-foot right-of-way dedication, appraised at $25,500, in lieu of the cash compensation; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DOES ORDAIN AS FOLLOWS: SECTION I. The following described alley right-of-way located south of South Tobin Street, between Burnett Avenue South and Williams Avenue South, to wit: (A portion of vacated right-of-way in the Northeast Quarter of Section 18, Township 23 North, Range 5 East, W.M., in the City of Renton, King County, Washington) See Exhibit "A" attached hereto and made a part hereof as if fully set forth herein is hereby vacated. SECTION II. Compensation is set in the amount of $25,500 for this alley vacation and a 20-foot right-of-way dedication has been accepted in lieu of the cash • g Y p compensation. SECTION III. This ordinance shall be effective upon its passage, approval, and five days after its publication. A certified copy of this ordinance shall be filed with the Office of Records and Elections, and as otherwise provided by law. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk 2 • f • ORDINANCE NO. APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor Approved as to form: Lawrence J. Warren, CityAttorney Y Date of Publication: ORD.1458:4/08/08:scr • 3 k EXHIBIT A LEGAL DESCRIPTION A strip of land lying within the Northeast Quarter of Section 18, Township 23 North, Range 5 East W.M., being that portion of Lots 3 and 18, Block 24, Town of Renton, according to the Plat thereof, as recorded in Volume 1 of Plats, page 135, in King County, Washington, dedicated as alley under recording numbers 2117471, 2117484, 2117478 and 7811200482 and more particularly described as follows: The east 5 feet of Lot 3; EXCEPT the north 20 feet; The north 10 feet of the south 30 feet of Lot 3; And the west 5 feet of Lot 18; EXCEPT the north 20 feet; Situate in the City of Renton, County of King, State of Washington. 1111 111 4 • EXHIBIT MAP ALLEY VACATION PLAT OF THE TOWN OF RENTON RENTON, WASHINGTON ! I _ _ I ) 1 o-, I z I 0007200096 I'd I 4I - - 0 1� N U 1 -01 N I N20 1 5' 7231502130 z E en t. Lr) — — w o "el 'f?' 't�' EXISTING 10' ALLEY„';2., "' co REC. N0. 7811200482 'n I N 0 TO BE VACATED 1I 19 7231502125 o cn 2 N8B 23'147"W w z o - 1 1\0.00' N88'23_47"W S' in 3 "W 115.13' J Nirn Lo , 0 Cr) CV N882.3.47"W 115.00' 1 Co 2 18 z 0 N 7231502120 II 5 NB8'23'47"W 115.00' 1 z Q N01'29'20"E 50.08' _ > I-- to.�o' Q It i" EXISTING 5' ALLEY, - 1 N88'2�'47"W Li ( REC. N0. 2117471U) Z 4 Sc 2117484; 7231502030 17 i CC PORTION TO BE VACATED EXISTING 5' ALLEY, :8 Q / REC. NO. 2117478; :J- 03 1\ __ 120.00' -- Z-- / TO BE VACATED W _J N88'23'47'W 16 0 W N I �1� I:v N1 m I 0 I • t z 0 120.13' i I I N88'23'47"W -- P:\PO4\04441.10\CAD\4441-EXHIBIT.dwg 10/27/2004 025655 PM POT Engineering Plonning Surveying ' Penhallegon Associates Consulting Engineers, Inc. `�;r:y_;�;;�• - 750 Sixth Street South Kirklond, WA 98033 - www.poceengrs.com PH: (425) 7-2014 1-800-945-8408 FAX: 425 827-5043 B2 ~-� Kirkland Seattle SCALE: 1" = 50' FILE:\4441-EXHIBIT.DWG DATE: 02/15/06 RLH PROJ. NO.: 04441.10 • p f CITY OF RENTON, WASHINGTON • ORDINANCE NO. AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING THE FISCAL YEAR 2008 ANNUAL BUDGET AS ADOPTED BY ORDINANCE NO. 5325 TO TRANSFER FROM FUND 303 TO FUND 316 FOR CEDAR RIVER TRAIL EXTENSION PROJECT EXPENSES, AND APPROPRIATING REVENUES IN FUND 316 AND AUTHORIZING EXPENSES IN THAT FUND IN THE NET AMOUNT OF $111,875. WHEREAS, on March 10, 2008, the City Council adopted Ordinance 5362 approving the 2008 Annual Budget; and WHEREAS, it is necessary to amend the 2008 Annual Budget to accommodate revenue and expenditures for the Cedar River Trail Extension Project (Logan Avenue North Bicycle Lane); NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, 410 WASHINGTON, DOES ORDAIN AS FOLLOWS: SECTION I. The Fiscal Year 2008 Annual Budget is hereby amended to include the following adjustment in Community Development Impact Mitigation Fund (303) to transfer to Fund 316 as listed below: Community Development Impact Mitigation Fund (303) FY 2008 REVENUES 2008 After Budget Increase Amended 2008 Budget Carry Forward Budget Funding Source Mitigation Fees 250,000 0 250,000 Investment Interest 5,000 5,000 Revenues 255,000 0 255,000 EXPENDITURES 0 Park Projects 0 111,875 111,875 Expenditures 0 111,875 111,875 Unbudgeted Ending 410 Fund Balance 255,000 -111,875 143,125 1 1 t ORDINANCE NO. SECTION IL The Fiscal Year 2008 Annual Budget is hereby amended to include • the following increased revenues transferred from Fund 303 and expenditures in Municipal CIP Fund (316) as listed below: MUNICIPAL CIP FUND (316) FY 2008 REVENUES 2008 After Budget Increase Amended 2008 Budget Carry Forward Budget Funding Source 16,869,090 New Revenues 111,875 111,875 (Transfer from Fund 303 to Fund 316) Revenues 16,869,090 111,875 16,980,965 EXPENDITURES 13,708,000 13,708,000 Park Projects 1,967,983 111,875 2,079,858 Municipal Facility 871,319 871,319 Projects Other 321,788 321,788 Expenditures 16,869,090 111,875 16,980,965 • SECTION III. This ordinance shall be effective upon its passage, approval, and 30 days after publication. PASSED BY THE CITY COUNCIL this day of , 2008. Bonnie I. Walton, City Clerk APPROVED BY THE MAYOR this day of , 2008. Denis Law, Mayor • 2 ORDINANCE NO. IPApproved as to form: Lawrence J. Warren, City Attorney Date of Publication: ORD.1456:3/27/08:scr • • 3