Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
RS_TIR_20200324_v3
DEVELOPMENT ENGINEERING Nathan Janders 03/19/2020 SURFACE WATER UTILITY JFarah 03/23/2020 Deleted ©2018 Abossein Engineering Technical Information Report Page 5 First Ukrainian Pentecostal Church Renton, Washington SECTION I PROJECT OVERVIEW The Project is the proposed new Church Building addition located at 3811 NE 21st St on Tax parcels # 0423059237, and 307 at East side of Redmond Ave NE, South of NE 21st ST, between NE 21st St and NE 19st St in Renton, WA. A new storm pipe connection will run through parcel # 0423059068 to connect to the existing NE 21St Street drainage system. The Legal Description is: POR OF E 1/2 OF E 1/2 OF NW 1/4 OF NE 1/4 OF SE 1/4 LY N OF S LN OF LOT 4 OF ROSE HAVEN PROD E in King County Washington. The Project will meet the drainage requirements of the 2017 City of Renton Surface Water Design Manual. PREDEVELOPED SITE CONDITIONS The project site contains three lots (LOT 1 - NORTH (parcels# 04203059237), LOT 2 - EAST (parcels# 04203059307), and LOT 3 - SOUTH (parcels# 04203059068). The church building structure currently resides on the NORTH parcel and includes drive isles, parking stalls and the site extends easterly onto LOT 2- EAST Parcel. The east parcel contains asphalt pavement and gravel parking stalls, and a shed. The surface water runoff from this eastern side appears to pond on the site and after it reaches to a certain elevation, it begins to travel northwesterly. The North Lot drains northerly. It is certain that the surface water runoff from the existing parking area from both lots North and East, drains northerly to a single Catch Basin near the entrance of the Church’s property. The South Lot from the southern lot-line will drain southerly across a grass area to the existing drainage system along NE 19th street. The roof drainage from the existing building is tight lined via an enclosed pipe and it drains southerly to a CB in NE 19th street. The storm drainage system along NE 21st and NE 19th Street drains southerly to May Creek Drainage Basin, May Creek Watershed, Cedar River/Lake Washington; WRIA: Cedar- Sammamish There are no wetlands identified on the site. The site is not located in landslide, erosion hazard areas, or other environmentally sensitive areas according to King County i-Maps. DEVELOPED SITE CONDITIONS The proposed project involves construction of a new 1,708 sf building addition, 57,959 sf of new and plus replaced parking stalls and drive isles, 1,453sf covered entry addition, 638 sf on new sidewalk in NE 21st St, 946 sf of new driveway entrances, 12,724 sf of existing building remaining, 647 sf of existing covered entry, 52 sf of existing steps remaining, 1,331 sf of existing plus new replaced sidewalk along the west side of the main entrance, and 1,062 sf of new sidewalk and driveway construction (excluding the area to the home at this point until further review and discussion with the client). This will generate a total of 78, 520 sf of impervious surface area. We had allocated 7,000 sf of new lot from South lot to include the ©2018 Abossein Engineering Technical Information Report Page 6 First Ukrainian Pentecostal Church Renton, Washington existing home and amenities along NE 19th Street. This will remain a total of 140,838 SF of land available for the proposed development. Based on our calculations, 55% of Impervious surface area is achieved and dedicated to complying with the City’s Land Use Maximum Surface Area of 55% (78,520/140,838). Per figure 3A, Civil Site Plan Land Use, we have demonstrated in terms of land use a breakdown of existing and new Pervious and Impervious Surface Areas for the entire site including all the right-of-way dedication. The total new onsite impervious surface areas calculated is 72,962 sf and the total site area excluding the area for new lot and the rights- of-way is 134,385. This is 54.3 % <55% of total maximum impervious surface area allowed for this LUA per CUP Decisions. Respectively the remaining pervious area for the site is 45.7% as calculated. PARCELS Land (sf) Row dedication New Lot TOTAL (sf) LOT 1 - North (04203059237) 65,340 3,265 sf 62,077 LOT 2 -East (04203059307) 43,560 43,560 LOT 3 - South (04203059068 38,471 2,344 sf 8,250 sf 27,877 TOTAL LOT AREA 147,371 Total lot area after adjustments 133,514 In terms of parking stalls and compliance with the Land Use requirements, we have added 78 stalls on top of existing 90 stalls for a total of 168 parking stall. Out of 168 stalls, 47 stalls are dedicated for compact vehicles. This will provide 28% of the site area. Maximum compact stalls allowed is 30% (refer to Figure 3A). Since this project proposes to add or replaces more than 2000 sf of impervious surface area and the land disturbance activities is more than 7,000 SF, and the project results in no more than 50-acres of new impervious surface within our sub-basin or multiple sub-basins of May Creek Watershed that are hydraulically connected, per Figure 1.1.2.A, a Full Drainage Review is required for this development per 1.1.2.4 of the 2017 Renton SWDM (see next page for flow chart). Therefore, all nine core requirements in Section 1.2 and all six special requirements in Section 1.3. ©2018 Abossein Engineering Technical Information Report Page 7 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 8 First Ukrainian Pentecostal Church Renton, Washington The proposed site is larger than 22,000 sf and per Core Requirements #9 for Large Lots >22,000 sf, and section C.1.3.2, of RSWDM Large Lot BMP Requirements, a series of available BMPs were examined for this site. Full Dispersion, Full Infiltration, Limited Infiltration, Bioretention, Permeable Pavement and Basic Dispersion were examined as part of BMPS for compliance with Core requirements #3, #8 and #9. The only viable options selected for this site for water quality and quantity purposes are Compost Amended Biofiltration Swale and an Underground Shallow Detention Pipe System (Corrugated Steel Arch-Pipe) to meet water quality and quantity requirements of RSWDM. An Enhanced Basic Water quality is required for this site since this development is within the May Creek Drainage Basin. The selected BMPs will be used to the maximum extent possible to control stormwater runoff generated from the impervious surface areas. This includes additional impervious surface area from the additional roofs (3,188 SF). All other BMPs for flow control have been found to be infeasible so an underground stormwater detention pipe system from Contech is considered being the only available option for the storage of stormwater runoff from each sub-basin after it is treated. Pervious Pavement will be used only within the sub-basin #4 to reduce the volume of storage needed within this sub-basin only. All other remaining sub-basins will contain Heavy Duty Hot Mix Asphalt. In terms of FULL DISPERSION, the site does not offer any forested area availability within the threshold discharge area In terms of FULL AND LIMITED INFILTRATION, per the Geotechnical Engineer’s report, the site lies on top of glacial till with very limited infiltration. Therefore, infiltration thru the site native soils will not be possible and cause flooding of the site and damage to the subgrade and pavement material. In terms of Basic Dispersion an opportunity does exist to collect the roof runoff and discharge it to a 50’-long Gravel Filled Trench with Notch Board. The trench would be approximately 2.5’ deep situated on the south side of the building. The roof runoff will tie into a perforated pipe system within the gravel filled trench. The footing drain will connect to a clean out and will be conveyed to the trench via a solid pipe. There is a 25’ minimum vegetated path immediately downstream of the trench to disperse the flow from the trench across the South Lot during high storm events. The site is broken down into four sub-basins #1 - #4. Each sub-basin is graded in such a way that it drains to an island containing a 3’ flat bottom swale, with side-slopes varying from 1.5 to 1 (Swale #1-3) and to 2.5 to 1 (Swale #4). Each swale will consist of a layer of mulch, Bioretention Soil Mix and a grave filled media to remove the pollutants from the impervious surface area. We have employed the services of a Landscape Architect to provide additional opportunities to exceed basic requirements for a Compost Amended Biofiltration Swale (CABS). The ©2018 Abossein Engineering Technical Information Report Page 9 First Ukrainian Pentecostal Church Renton, Washington Architect recommends the installation of check dams within each island/swale to intercept the sediments by providing a depression about 6” between each dam. The boulders, rock and the vegetation along the swale’s side-slopes will provide stability against erosion. There will be curb inlet openings with 2’ wide metal frames installed along the perimeter of each island. There will be an impermeable layer installed at the bottom of each swale to keep the underground water table from entering into the bioswale as well as the detention pipe system. There will be two grate inlets provided for each swale. In case of clogging, the other inlet would be available to route the treated stormwater runoff to the underground detention pipe system. The treated stormwater runoff will then enter a series of underground CSP system to store the water from ½ two year to 50-year storm events as required by Core requirements #3, Flow Control. In terms of Hydrology, WWHM 2012 was used to provide calculations for water quality and quantity. As indicated in Attachment A, WWHM Printout, 99% of the pollutants are removed from each sub-basin and volume of storage is calculated for each sub-basin. We have worked with Contech representative for selecting a shallow-arched-pipe-size (35” x 24”) that provides the required volume of storage and would be deep enough to convey the runoff from each sub-basin. The flow from each detention pipe system would be collected via a main outflow 12” solid PVC pipe and will travel northerly to connect to the existing drainage structure on the south side of NE 21 St. ©2018 Abossein Engineering Technical Information Report Page 10 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 11 First Ukrainian Pentecostal Church Renton, Washington FIGURE 1 TIR WORKSHEET TECHNICAL INFORMATION REPORT (TIR) WORKSHEET FUPC 425-271-0058 3811 NE 21st Street Renton, WA 98056 Shawn Pourazari P.E. Abossein Engineering (425) 462-9441 FUPC Addition and Parking LUA-18-000253, ECF, CU-H 23 North 05 East 04 3811 NE 21st St, Renton, WA 98056 X X X X X April 1, 2019 X April 1, 2019 ©2018 Abossein Engineering Technical Information Report Page 12 First Ukrainian Pentecostal Church Renton, Washington N/A Summer 2019 Fall 2019 Newcastle NA May Creek Level 2 flow Control & Enhanced Basic WQ ©2018 Abossein Engineering Technical Information Report Page 13 First Ukrainian Pentecostal Church Renton, Washington Alderwood GSL Till Text 0-15% Moderate X X Level 1 None Text 2 10/11/2017 Matching forested Detention Tank, pervious pavment TBD TBD TBD TBD ©2018 Abossein Engineering Technical Information Report Page 14 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 15 First Ukrainian Pentecostal Church Renton, Washington N/A N/A N/A Text X X X X XX X X X X X X X X X X Detention Tank X Pervious Pvmt X X ©2018 Abossein Engineering Technical Information Report Page 17 First Ukrainian Pentecostal Church Renton, Washington FIGURE 2 SITE LOCATION Site Location ©2018 Abossein Engineering Technical Information Report Page 18 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 19 First Ukrainian Pentecostal Church Renton, Washington Figure 3A Civil Site Plan Land Use ©2018 Abossein Engineering Technical Information Report Page 20 First Ukrainian Pentecostal Church Renton, Washington Figure 3.1 Topographic Base Map ©2018 Abossein Engineering Technical Information Report Page 21 First Ukrainian Pentecostal Church Renton, Washington FIGURE 4 SOILS The site lies within the Puget Lowland. The lowland is part of a regional north-south trending trough that extends from southwestern British Columbia to near Eugene, Oregon. North of Olympia, Washington, this lowland is glacially carved, with a depositional and erosional history including at least four separate glacial advances/retreats. The Puget Lowland is bounded to the west by the Olympic Mountains and to the east by the Cascade Range. The lowland is filled with glacial and non-glacial sediments consisting of interbedded gravel, sand, silt, till, and peat lenses. The Geologic Map of the Renton Quadrangle indicates that the site is underlain by Vashon Glacial Till. Vashon Glacial Till is typically characterized by an unsorted, non-stratified mixture of clay, silt, sand, gravel, cobbles and boulders in variable quantities. These materials are typically dense and relatively impermeable. The poor sorting reflects the mixing of the materials as these sediments were overridden and incorporated by the glacial ice. ©2018 Abossein Engineering Technical Information Report Page 22 First Ukrainian Pentecostal Church Renton, Washington Per Cobalt Geosciences soil report, the test pit locations and soil logs are copied below: ©2018 Abossein Engineering Technical Information Report Page 23 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 24 First Ukrainian Pentecostal Church Renton, Washington SECTION II CONDITIONS AND REQUIREMENTS SUMMARY The project must comply with all nine core requirements in Section 1.2 and all six special requirements in Section 1.3 • Core Requirement #1: Discharge at Natural Location Per 1.2.1, all storm water runoff and surface water from a project must be discharged at the natural location so as not to be diverted onto or away from downstream properties. All flows on this site for the building addition from the pre and post development activities will remain unchanged and will discharge to its natural discharge location being the existing storm drainage system in NE 21st Street. Parking addition from the East parcel and the North parcel will converge at a point being less than ¼ mile downstream and it is in the same drainage basin as allowed. • Core Requirement #2: Offsite Analysis Per 1.2.2, the primary component of an offsite analysis report is the downstream analysis, which examines the drainage system within one-quarter mile downstream of the project site or farther as described in Section 1.2.2.1: Each project submittal must include at least a Level 1 downstream analysis. This is an urban area and the properties around are small and fully developed. There are no significant on or off site flows on this property. No downstream drainage problems were observed. The existing paved surfaces on this site drain to the piped drainage systems in NE 21st Street. The gravel parking area ponds on site. See Level One Downstream Analysis in section 3. • Core Requirement #3: Flow Control Facilities Per 1.2.3.1 Projects subject to Core Requirement #3 must provide flow control facilities as specified by the area-specific facility requirements. 1. Flow Control Duration Standard – Matching Forested site conditions for areas draining to streams and subject to flow-related water quality problems such as erosion or sedimentation. The project is required to match forested site conditions per the flow control duration standard. A detention pipe system is provided and will provide flow control as required for the new and replaced impervious and pervious surfaces. The site is required to match the flow duration of pre-developed rates for forested (historic) site conditions over the range of flows extending from 50% of the 2-year up to the full 50-year flow and match ©2018 Abossein Engineering Technical Information Report Page 25 First Ukrainian Pentecostal Church Renton, Washington peaks for the 2-, 10- and 100-year return periods. Approximately 4,000 LF of 35” x 24” CSP arched detention pipe system is provided to control flows from all pervious and impervious surface areas of new plus replaced parking lot and drive isles. Buoyancy Analysis: Abossein Engineering has contacted Contech Engineered Solutions to perform buoyancy calculations. This is to ensure that the drainage detention pipe system will not float since the ground water is higher than the invert of the proposed piped system. Contech has performed the analysis for several different sizes of Corrugated Steel Pipe (CSP) to demonstrate that the uplifting water pressure (buoyancy force) will not cause any movement of the CSPs. Thus, indicating that the total resisting force provided will supersede the applied buoyancy force. Contech’s computations are added to the Attachment C of TIR for reference. • Core Requirement #4: Conveyance System Per 1.2.4, the proposed projects are analyzed, designed, and constructed to provide a minimum level of protection against overtopping, flooding, erosion, and structural failure as specified per “Conveyance Requirements for Existing Systems,” Section 1.2.4.2 All the flows on this site are dispersed and intercepted after treated. There is a conveyance system needed to collect the flows from the outlet of each sub-basin control structure via a 12” PVC outlet pipe. The outlet pipes will be connected and tie into the existing CB on the south Side of NE 21st Street. The 12" PVC Main Outflow Pipe has been determined to be capable of conveying the 100-year peak storm without overtopping any structures. Peak 100 yr flows from all four basins = 0.04 cfs per WWHM computations (refer to Attachment “P” for WWHM Flow Frequency Return Periods for Mitigated Condition at the Point of Compliance). The 12-inch outlet pipe can pass over 3.85cfs see manning’s formula below for full flow capacity: Manning’s Formula for 12"Ø Pipe at 0.5% slope WETTED PERIMETR= 3.14 FEET HYDRAULIC RADIUS = 0.25 DEPTH OF FLOW = 1 FT SLOPE = 0.005 FT/FT n VALUE= 0.012 AREA = 0.785 SF ©2018 Abossein Engineering Technical Information Report Page 26 First Ukrainian Pentecostal Church Renton, Washington VELOCITY = 4.914329 FPS = (1.486/(n))*(R)^0.667)*((S)^0.5) FLOW QUANTITY = 3.857748 CFS (VELOCITY* AREA) In terms of spill control, we have provided a temporary washout area on our site as indicated on Sheet C2.0 of construction plans. This wash out area can be used for any oil spill from the construction vehicles operating or entering the site in case of an emergency. Additionally, we have provided a 2’ sump at the bottom of each control and catch basin structure that will intercept any oil spillage entering into the drainage system. • Core Requirement #5: Construction Stormwater Pollution Prevention Per 1.2.5, all proposed projects that will clear, grade, or otherwise disturb the site must provide erosion and sediment controls to prevent, to the maximum extent practicable, the transport of sediment from the project site to downstream drainage facilities, water resources, and adjacent properties. To prevent sediment transport and pollutant discharges as well as other impacts related to land-disturbing and construction activities, Erosion and Sediment Control (ESC) measures and Stormwater Pollution Prevention and Spill Control (SWPPS) measures that are appropriate to the project site must be applied through a comprehensive Construction Stormwater Pollution Prevention (CSWPP) plan as described in Sections 1.2.5.1 and 1.2.5.3 and shall perform as described in Section 1.2.5.2. Temporary ESC measures will be required as there will be disturbance of the soil to construct the additional parking and building addition, and clearing of the site. All of the flows from the driveway and house will flow onto the lot so no adjacent properties will be affected. A construction entrance should be provided at a minimum. No special requirements are needed In order to prevent erosion and trap sediment within the project site, the following BMPs will be used approximately as shown on the ESC plan: Clearing limits will be marked by fencing or other means on the ground; extra excavated soil will be removed from the site or spread on site; a rocked construction entrance will be placed at the location of the driveway throughout construction; runoff will not be allowed to concentrate and no water will be allowed to point discharge; mulch will be spread all over cleared areas of the site when they are not being worked; mulch will consist of air-dried straw and chipped vegetation. See Section VIII for details. • Core Requirement #6: Maintenance & Operations Per 1.2.6, maintenance and operation of all drainage facilities is the responsibility of the applicant or property owner, except those facilities for which the City assumes maintenance and operation as described below and in RMC 4-6-030.M. Drainage facilities must be maintained and operated in accordance with the maintenance ©2018 Abossein Engineering Technical Information Report Page 27 First Ukrainian Pentecostal Church Renton, Washington standards in Appendix A of this Manual, or other maintenance standards as approved by the City. The Pervious Concrete Pavement and the detention arched piped system will require little maintenance. The property owner will be responsible for this little maintenance. See attached Maintenance requirements. • Core Requirement #7: Financial Guarantees & Liability Per 1.2.7, In accordance with RMC 4-6-030, CED shall require all persons constructing any surface water facilities (including flow control/water quality facilities, conveyance systems, erosion control, and road drainage), to post with the City of Renton a bond, assignment of funds or certified check. The applicant must also maintain liability insurance as described in this Core Requirement #7 The property owner will be responsible for certified check and liability insurance, and the owner insures that the project is constructed to the approved plans and that the drainage does not cause any problems. See Section IX for details. • Core Requirement #8: Water Quality Facilities Per 1.2.8, all proposed projects, including redevelopment projects, must provide water quality (WQ) facilities to treat the runoff from those new and replaced pollution- generating impervious surfaces and new pollution-generating pervious surfaces targeted for treatment as specified in the following sections. These facilities shall be selected from a menu of water quality facility options specified by the area-specific facility requirements in Section 1.2.8.1 and implemented according to the applicable WQ implementation requirements in Section 1.2.8.2. The project is required to provide Enhanced Basic Water quality treatment per section 1.2.8.A. A Compost Amended Biofiltration Swale System is provided per Figure 6.1.A (See next sheet), Water Quality Treatment Facility Selection Flow Chart for treatment of stormwater runoff ONLY (Enhanced Basic GULD) prior to entering into the detention pipe system. ©2018 Abossein Engineering Technical Information Report Page 28 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 29 First Ukrainian Pentecostal Church Renton, Washington • Core Requirement #9: On-site BMPs Per 1.2.9, on-site BMPs must be selected and applied according to the basic requirements, procedures, and provisions detailed in this section and the design specifications for each BMP in Appendix C, Section C.2. Refer to Attachment R for the Declaration of Covenant. The project is required to provide on-site BMPs to mitigate the impacts of storm and surface water runoff generated by new impervious surface, new pervious surface, existing impervious surfaces and replaced impervious surface targeted for mitigation. The project is on a site that is more than 22,000sf; it has been determined, using the order of preference outlined in Section 1.2.9.2.2 Large Lot BMP Requirements of the 2017 Renton SWDM, that Stormwater Detention as described previously under the Developed Condition is the only feasible option to meet the on-site flow control requirements as no other BMPs are feasible. Full Dispersion is not feasible as there is not a 100 foot natural vegetated flow path Full infiltration is not feasible due to till soils per Geotech report. Limited infiltration is not feasible due to high winter ground water table and till soil per Geotech report. Bioretention is not feasible due to Bioretention Infeasibility Criteria List per C.2.6. Infiltration is not used due to till soils per Geotech report, and the area is pre-existing road or parking lot surfaces. As indicated in the Geotech’s report, there is not a 3’ vertical separation from the bottom of the trench to the seasonal high-water table. Permeable Concrete or Porous Pavement is proposed for the proposed parking area in subbasin #4 ONLY. 1,665 SY of Porous Concrete Pavement will be provided. This is light duty overflow parking for the church so pervious concrete should work adequately. See WWHM printout for sizing and the credit provided for using porous concrete pavement. See Cobalt Geotechnical Report on Soils dated May 15, 2018 with letter of June 26, 2018. Cobalt provided 3 holes and found groundwater at 3-3.5 depth below the ground. The proposed pervious pavement will be placed on top of the 18” to 24” of clean rock. 1’ minimum separation required for pervious pavement to high water table and it will be maintained. Per C.1.3.2 Pervious Pavement is required to be used if possible and we have adequately permeable soil within the top layers and an adequate amount of permeable soil above the ground water table which are the only two applicable criteria. Per RSWDM, Figure C.2.7.1.A, Schematic Representation of Permeable Concrete, and Std Plan-261.10, for Porous/Pervious Concrete, we are proposing to use 6” thick sand layer on top of the native subgrade. This is in lieu of conducting site specific testing to determine Cation Exchange Capacity of 5 Meq per 100 Grams of soil. A note has been ©2018 Abossein Engineering Technical Information Report Page 30 First Ukrainian Pentecostal Church Renton, Washington added to the Plan Sheet C8.4 to address the required thicknesses of sand, free draining aggregate base and concrete for the construction of pervious concrete. Additionally, we have designed an underdrain pipe system (6’’ perforated PVC) under the pervious/porous concrete pavement to intercept high ground water table and route it to the onsite main outflow enclosed piped system. This underdrain system is required since there is not a minimum vertical separation of three (3) feet between the bottom of the pavement subgrade and the underground water table. We have also provided a Bioretention/Biofiltration Swale that will provide Enhanced Basic Water quality for the treatment of pollutants generated from the impervious surface of parking and driving areas. A 12-15” soil layer of Bioretention Soil Mix (BSM) underlies 3” layer of mulch. These layers will intercept and remove the pollutants entering each island and allow the treated water to enter the gravel media below the bottom of BSM. The flows from the gravel media enter the perforated pipe system so that it could be directed towards the detention piped system. WWHM computation indicates for each sub-basin draining to the Bioretention Swale that 99% of the volume of the pollutants is removed and filtered thru the biofiltration process as described above. Basic dispersion is feasible due to the ability to achieve 25 feet of vegetated flow path for the building roof dispersion area. Per RSWDM, Section 1.2.9.2.2, Item 5, BMPs must be implemented at minimum for impervious surface area generated by this development project. The Target Impervious Surface Area Mitigation required for this development site is calculated to be 35% (50- 1.5(55-45) = 35). In other words, the proposed impervious surface area coverage of 55% for the referenced site results in a requirement of on-site BMPs to be applied to 35% of impervious surfaces added. Per attached, Added Parking Area Exhibit (Refer to Attachment T), this development generates, a total of 3,161 SF of added new building and covered entry, and new parking surface area of 23, 274 SF. Total Onsite Added New Impervious Surface Area is 26, 435 SF (3,161 +23,274). The project has provided mitigation for the building and parking addition thru basic dispersion, biofiltration swale and an underground stormwater detention piped system, respectively. This results in 36.23% of mitigation (26,435/72,962) provided which exceeds the 35% required minimum target impervious surface area. Therefore, this site complies with the requirements as set forth in RSWDM, 1.2.9.2.2, Large Lot BMP Requirements. Abossein Engineering had previously considered other alternatives such as; Reduced Impervious Surface Credit, Native Growth Retention Credit & Tree Retention Credit in case of not meeting the 35% target BMP for the impervious area coverage. None of these BMPs are applicable for this site. The added impervious surface area is used to the ©2018 Abossein Engineering Technical Information Report Page 31 First Ukrainian Pentecostal Church Renton, Washington maximum extent allowed with no possibility for reduction, there is no native vegetated growth nor any trees available on this site that can be retained. In fact, the developer had to provide onsite landscaping in order to obtain Land Use approval. • Special Requirement #1: Other Adopted Area-Specific Requirements, section 1.3.1 None known. • Special Requirement #2: Flood Hazard Area Delineation, section 1.3.2 Site is not in a flood plain. • Special Requirement #3: Flood Protection Facilities, section 1.3.3 No flood protection facilities are required. • Special Requirement #4: Source Control, section 1.3.4 The site is a commercial site, but no additional impervious pollution generating surface is being added, so no source control is required. • Special Requirement #5: Oil Control, section 1.3.5 This is not a high use site so oil control is not required. • Special Requirement #6: Aquifer Protection Areas, section 1.3.6 This site is not in an aquifer protection area. ©2018 Abossein Engineering Technical Information Report Page 32 First Ukrainian Pentecostal Church Renton, Washington SECTION III OFFSITE ANALYSIS Level One Downstream Analysis Task 1: Define and map the study area The properties to the north of this site are small single family residences, and do not discharge any significant amount of runoff onto this site. 21st has curbs and drainage system and Frontage of site will be developed to construct curbs and walkway which does not drain any significant run off to site. South side NE 19th St and properties are lower than site; do not discharge any significant amount of runoff onto this site. East and West side properties small single-family residences and fully developed, do not discharge any significant amount of runoff onto this site. Please refer to Attachment Q for the Study Area Map provided. Task 2: Review all available information on the study area Using the King County iMap interactive tool, it was found that there are no immediate critical areas upstream or downstream of the property. Task 3: Field Inspect the study area There are no reported problems to be investigated. The amount of space and soil types present on the property clearly support the flow control BMPs being implemented. There will not be any destruction of aquatic habitat on-site or downstream. The Site was visited on October 11, 2017 and a 1/4 mile downstream investigation was made. As there are no signs of surface flow no problems were identified. The piped drainage systems flow west. Task 4: Describe the drainage system, and its existing and predicted drainage and water quality problems For this site, permeable pavement with a detention pipe system will be used. The building addition will use the dispersion trench. Detention of the stormwater from the new addition using the gravel filled trench will prevent any flooding problems on-site or downstream. NE 21st Street and NE 19th Street both have piped drainage systems that appear to be functioning properly. There are no other significant on or off-site flows. The existing church and parking drain to on-site catch basins which drain to the NE 21st Street Drainage System. ©2018 Abossein Engineering Technical Information Report Page 33 First Ukrainian Pentecostal Church Renton, Washington There will not be any predicted problems associated with the water quality facilities (CABS) as long as they are regularly maintained, and sediments and debris are removed from the depression areas along the swale between check dams. Upstream Analysis Upstream of the site are single-family houses in Northeast of the site. Per King county Imap, there is no critical areas upstream and downstream problem for the houses in this area. There is stormwater facility in the northeast of the site, next to the existing parking area. There are no significant flows on this site. No upstream drainage problems were found. See the attached existing site map and the City of Renton Utilities map. ©2018 Abossein Engineering Technical Information Report Page 34 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 35 First Ukrainian Pentecostal Church Renton, Washington Mitigation of Existing or Potential Problems There are no known existing or potential drainage problems and / or water quality problems. ©2018 Abossein Engineering Technical Information Report Page 36 First Ukrainian Pentecostal Church Renton, Washington SECTION IV FLOW CONTROL, LOW IMPACT DEVELOPMENT (LID) AND WATER QUALITY FACILITY ANALYSIS AND DESIGN Existing Site Hydrology The site is currently developed with the church building and asphalt and gravel parking. The Church building and asphalt parking drain to an existing catch basin in the parking lot near NE 21st Street which drains to the NE 21st Street piped drainage system. The gravel parking area infiltrates into the ground. The existing land cover is modeled as 0.54 acres of C, Forest, Flat in WWHM. Developed Site Hydrology The existing church building and asphalt parking will continue to drain as they do now. The new 1,708sf Church addition will drain to a dispersion trench which will disperse overland to the south to the NE 19th Street storm system. The developed land cover is modeled in WWHM2012 for various subbasins 1-4, for Lawn- Pervious and Asphalt-Impervious, Flat. See the WWHM 2012 prints out of the model (refer to Figure 3, Page 16 for the developed subbasin areas and 100-year peak flow for each subbasin). Performance Standards The site is required to match forested site conditions for the pre-developed site, per the flow control duration standard. A detention pipe system proceeding downstream of a Compost Amended Biofiltration Swale will provide flow control and enhanced basic water quality treatment. The project is required to match the flow duration of pre-developed rates for forested (historic) site conditions over the range of flows extending from 50% of the 2-year up to the full 50-year flow and match peaks for the 2-, 10- and 10-year return periods. Detention tank details have been provided in the plans, and WWHM printout attached, for both water quality and quantity. Per Section 1.2.9.2.2 of the 2017 Renton SWDM, the project is required to supplement the flow mitigation provided by required flow control facilities using BMPs. It has been determined that permeable pavement, and a shallow piped detention pipe system are the most feasible option to meet the on-site BMP flow requirements. Full Dispersion is not Feasible as there is not a 100’ natural vegetated flow path Full infiltration is not feasible due to till soils per Geotech’s report. Limited infiltration is not feasible due to high winter ground water table and till soil per Geotech’s report. ©2018 Abossein Engineering Technical Information Report Page 37 First Ukrainian Pentecostal Church Renton, Washington Bioretention is not feasible due to no practical overflow connection to the city storm drain and the presence of high-water table. Permeable Pavement and piped system are provided for the proposed parking area addition. This is light duty overflow parking for the church so pervious pavement should work adequately. Underneath the parking area will be a series of pipe separated and clean gravel to store water below and above the pipe. See WWHM printout. See Cobalt Geotechnical Report on Soils dated May 15, 2018 with letter of June 26, 2018 and its supplemental letter in June of 2019. Cobalt excavated 3 holes and found groundwater between 3.0 to 3.5’ below the ground. As the proposed pervious and HMA pavement will be placed on top of the 18” to 24” of clean gravel on top of pipe. 1-foot minimum separation required for pervious pavement to water table. Per C.1.3.2 Pervious Pavement is required to be used if possible and we have adequately permeable soil and an adequate amount of permeable soil above the ground water table which are the only two applicable criteria. The use of pervious pavement reduces the size of the detention facility only in Sub-area #4 to a manageable size. Basic dispersion is feasible for the new building addition due to the ability to achieve 25 feet of vegetated flow path; however, since a detention pipe system is already required to meet flow control requirements, the building addition will utilize the dispersion trench only. Flow Control System The project will utilize a detention facility designed to control site runoff. WWHM software was used to size the facility. The WWHM printout including modeled areas and detention pipe design information are attached at the end of this document. Contech CSP Arch details and specifications are provided as part of our supporting documents. The storage volume calculations provided by WWHM are utilized and entered into the Contech’s software for sizing calculations and meeting the detention volume needed for each sub-basin. Water Quality System Per 1.2.8 of 2017 City of Renton Surface Water Design Manual, exemptions from Water Quality, the site is not in Surface Area Exemption: The PGIS surface due to the project for each subbasin is as follow: Subbasin #1= 0.39 Ac, Subbasin #2 = 0.27 Ac, Subbasin #3 = 0.32 Ac and Subbasin #4 = 0.38 Ac and a total of 0.2 acres of pervious surface area from all sub-basins (less than ¾ acre of new PGPS). Since the total area of new plus replaced impervious surface area is greater than 5,000 SF, then the project is not exempt from Core Requirement #8. Additionally, since the site is located about ½ mile upstream of May Creek Drainage Basin, and May Creek is considered a Fish Bearing Stream, Enhanced Basic Water Quality is required and thus provided by the Bioretention Facilities designed as part of compliance with CR#8. ©2018 Abossein Engineering Technical Information Report Page 38 First Ukrainian Pentecostal Church Renton, Washington Less than 5,000 square feet of non-polluted impervious surface area from the added roof areas not fully dispersed will be created. No treatment will be necessary for the PGIS runoff generated from the roof areas. Four Compost Amended Biofiltration Swales will be provided for Enhanced Basic Water Quality treatment upstream of the underground arched pipe detention system to meet the requirements of Core requirements #8, Water Quality Facilities. The Biofiltration Swales are designed and analyzed per RSWDM Section 6.3.1.1 (refer to Attachment “S”, Water Quality Design Analysis and Calculations). ©2018 Abossein Engineering Technical Information Report Page 39 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 40 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 41 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 42 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 43 First Ukrainian Pentecostal Church Renton, Washington FIGURE 5 SURFACE IDENTIFICATION ©2018 Abossein Engineering Technical Information Report Page 44 First Ukrainian Pentecostal Church Renton, Washington Section V CONVEYANCE SYSTEM ANALYSIS AND DESIGN (Per Chapter 4) Per Core Requirement #4 of the manual, the conveyance system must be analyzed and designed for the developed onsite runoff. Pipe systems shall be designed to convey the 25- year storm with a minimum of 6-inches of freeboard between the design water surface and structure grate. Pipe system structures may overtop for runoff events that exceed the 25- year design capacity provided the overflow from a 100-year runoff event does not create or aggravate a severe flooding problem or severe erosion problem. No significant conveyance system is required, as the flow will be conveyed mostly through the detention pipe system with a single connection to the NE 21st St drainage system. A 12- inch PVC pipe has been determined to be adequate. The sizing calculation is included in this report. The 100-year runoff from the site is 0.0.08 cfs and a 12” Ø pipe at 0.5% can pass 3.85 cfs. So, there should not be any concern for conveyance capacity from the total site outlet flows. The minimal amount of additional storm water can be handled by the enclosed downstream drainage system. ©2018 Abossein Engineering Technical Information Report Page 45 First Ukrainian Pentecostal Church Renton, Washington SECTION VI SPECIAL REPORTS AND STUDIES A geotechnical report has been provided by Cobalt GeoSciences, and has been attached at the end of this document. ©2018 Abossein Engineering Technical Information Report Page 46 First Ukrainian Pentecostal Church Renton, Washington SECTION VII OTHER PERMITS (Per 2.2.5) As the project disturbance = 74,323sf or 1.75 acres which is larger than 1 acre, a NPDES General Permit for construction is required (Per 1.2.5.3 F of 2017 City of Renton Surface Water Design Manual). A building permit will be required. ©2018 Abossein Engineering Technical Information Report Page 47 First Ukrainian Pentecostal Church Renton, Washington SECTION VIII CSWPP PLAN ANALYSIS AND DESIGN See Core requirement #5. Per C1.2.5 of 2017 City of Renton Surface Water Design Manual, ESC Plan Analysis and Design The Erosion Control and Sedimentation Control Design will meet the nine minimum King County requirements 1. Clearing Limits Clearing limits will be marked by fencing or other means on the ground. 2. Cover Measures Mulch will be spread over all cleared areas of the site when they are not being worked. Mulch will consist of air-dried straw and chipped vegetation. Extra excavated material will be removed from the site or spread on site. 3. Perimeter Protection Catch basin inserts will be used to filter sediment downstream of disturbed areas. 4. Traffic Area Stabilization A rocked construction entrance will be placed at the location of the driveway throughout construction. 5. Sediment Retention Surface water will sheet flow from all impervious surface areas of the site and will be routed through the bioretention facility as the first order of business prior to entering the detention tank. The bioretention facilities are designed in such a way to collect all the sediments and debris from the surface by installation of a series of weirs/check dams spaced at 18’ on-center along the center of the swale (refer to sheet C8.5 of Civil Plan Set). The dams will contain sediment deposit up to a depth of 6” and will allow for overflow over the weir to a series of downstream weirs/check dams. There will be an ample opportunity to trap sediments against the dams prior to its release to the underground piped detention facility. Therefore, water will be ponding between the dams during high seasonal water table. 6. Surface Water Collection Runoff will not be allowed to concentrate, and no water will be allowed to point discharge from the site throughout all on-site grading activities. We have added a Wash- Out-Area and a Baker-Tank on Sheet C2.0 of plans to allow for collection of surface water runoff containing sediments and debris. Contractor shall install a pump and route the flows to the baker tank. The effluent from the tank upon passing turbidity reading can then be discharged via a temporary flexible hose to the Catch Basin on NE 21St. The ©2018 Abossein Engineering Technical Information Report Page 48 First Ukrainian Pentecostal Church Renton, Washington ultimate responsibility for managing the stormwater runoff from the construction site shall be endured by the on-site contractor. We have provided a representative mechanism here in terms of how to collect and dispose sediment laden water from the site. 7. Dewatering Control A sediment trap such as a Baker-Tank is required and shall be provided by the contractor to intercept all sediments and debris generated from its trenching and grading activities. The water resulting from de-watering activities shall be routed to the Baker-Tank and must be treated prior to its discharge. As noted above, we have provided a Baker-Tank shown on Sheet C2.0 of plans to allow for collection of surface water runoff containing sediments and debris from the trenches excavated for the installation of detention pipe system and other utilities. Contractor shall install a pump and route the flows to the baker tank as needed and required. 8. Dust Control Preventative measures shall be implemented to minimize dust per Table D.2.1.8.A, Dust Control Measure for site preparation. For all grading activities, sloping, shaping, compacting the subgrade, the contractor shall apply water at a rate of 0.125 gallon per square yard of surface area at every 20 to 30 minutes during hot summer months. 9. Flow Control Surface water from disturbed areas must be routed through the project's onsite flow control facility. 10. Control Pollutants See SWPPS measures below 11. Protect Existing and Proposed Stormwater Facilities and On-site BMPs To avoid sedimentation and soil compaction that would adversely affect infiltration and contamination by other pollutants, CB protection will be provided prior to any clearing and/or grading of the site. Control erosion from surrounding land uses onto permeable pavement BMPs. 12. Maintain Protective BMPs See section X in this report. 13. Manage the project Constructors will be responsible for managing the project. ©2018 Abossein Engineering Technical Information Report Page 49 First Ukrainian Pentecostal Church Renton, Washington SWPPS Plan Design Construction activities that could contribute pollutants to surface water include the following: 1. Storage and use of chemicals Utilize source control and follow erosion control plan. Use chemicals appropriately. Set up areas for proper disposal of excess materials. Contractor shall refer to Sheet C2.0 of Plans and provide a temporary holding area for the washout of concrete and control of any chemical spills in the construction area. 2. Material delivery and storage Locate temporary storage areas away from traffic and storm drains. Supply MSDS for all materials stored. Maintenance and repair of vehicles should be conducted using proper spill prevention measures. Contractor shall use the eastern part of the east lot for the storage of material and equipment to avoid any conflicts with the entrance and exit of construction vehicles from the site. 3. Building demolition Use catch basin inserts to protect drainage system from sediment. Sidewalks, streets and gutters should be swept daily. 4. Sawcutting Slurry and cuttings should be vacuumed during the activity, and must not be allowed to remain overnight. Dispose of waste material in appropriate manner. ©2018 Abossein Engineering Technical Information Report Page 50 First Ukrainian Pentecostal Church Renton, Washington SECTION IX BOND QUANTITIES, FACILITY SUMMARIES AND DECLARATION OF COVENANT Per section 1.2.7, 2017 City of Renton Surface Water Design Manual Bond Quantities Worksheet See attachment E Flow Control and Water Quality Facility Summary Sheet and Sketch See attachment G, WWHM 2012 Print outs for Flow Control and Water Quality Facilities Analysis. Declaration of covenant The declaration of covenants to the City of Renton by the owner if required (refer to the Attachment R). ©2018 Abossein Engineering Technical Information Report Page 51 First Ukrainian Pentecostal Church Renton, Washington SECTION X OPERATIONS AND MAINTENANCE MANUAL First Ukrainian Pentecostal Church will be responsible for maintenance of the permeable pavement, detention piped system and on-site catch basins per Appendix A-Maintenance requirements for Flow Control, Conveyance, and Water Quality Facilities. ©2018 Abossein Engineering Technical Information Report Page 52 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 53 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 54 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 55 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 56 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 57 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 58 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report Page 59 First Ukrainian Pentecostal Church Renton, Washington ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment A WWHM Printout WWHM2012 PROJECT REPORT FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:13:20 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_BF SWALE #1 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:12/2/2019 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:13:20 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, 0.52 Pervious Total 0 Impervious Land Use acre Impervious Total 0 Basin Total 0 Element Flows To: Surface Interflow Groundwater Flat FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:13:20 PM Page 4 Mitigated Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.13 Pervious Total 0 Impervious Land Use acre PARKING FLAT 0.39 Impervious Total 0 Basin Total 0 Element Flows To: Surface Interflow Groundwater Surface LTN SWALE #1Surface LTN SWALE #1 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:13:20 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:13:20 PM Page 6 Mitigated Routing BIOFILTN SWALE #1 Bottom Length: 149.00 ft. Bottom Width: 3.00 ft. Material thickness of first layer: 0.25 Material type for first layer: SMMWW 12 in/hr Material thickness of second layer: 1.25 Material type for second layer: Sand Material thickness of third layer: 1.49 Material type for third layer: GRAVEL Underdrain used Underdrain Diameter (feet):0.5 Orifice Diameter (in.):6 Offset (in.):6 Flow Through Underdrain (ac-ft.):90.368 Total Outflow (ac-ft.):91.065 Percent Through Underdrain:99.23 Discharge Structure Riser Height:1 ft. Riser Diameter:12 in. Element Flows To: Outlet 1 Outlet 2 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)To Amended(cfs)Infilt(cfs) FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:15:56 PM Page 7 Surface LTN SWALE #1 Element Flows To: Outlet 1 Outlet 2 BIOFILTN SWALE #1 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:15:56 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.52 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.13 Total Impervious Area:0.39 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.021432 5 year 0.036426 10 year 0.048348 25 year 0.065686 50 year 0.080264 100 year 0.096282 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.056215 5 year 0.102291 10 year 0.146442 25 year 0.222609 50 year 0.297756 100 year 0.392209 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.031 0.044 1950 0.033 0.043 1951 0.042 0.105 1952 0.014 0.038 1953 0.012 0.040 1954 0.017 0.037 1955 0.026 0.094 1956 0.024 0.045 1957 0.021 0.046 1958 0.020 0.044 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 9 1959 0.017 0.041 1960 0.034 0.148 1961 0.016 0.041 1962 0.011 0.036 1963 0.016 0.039 1964 0.022 0.039 1965 0.017 0.043 1966 0.013 0.038 1967 0.036 0.056 1968 0.020 0.038 1969 0.019 0.043 1970 0.015 0.040 1971 0.020 0.040 1972 0.033 0.084 1973 0.015 0.039 1974 0.020 0.036 1975 0.026 0.083 1976 0.019 0.039 1977 0.008 0.037 1978 0.015 0.044 1979 0.009 0.037 1980 0.059 0.062 1981 0.013 0.040 1982 0.034 0.287 1983 0.022 0.043 1984 0.014 0.039 1985 0.008 0.042 1986 0.034 0.144 1987 0.032 0.152 1988 0.013 0.038 1989 0.009 0.035 1990 0.099 0.248 1991 0.045 0.182 1992 0.018 0.040 1993 0.016 0.040 1994 0.007 0.034 1995 0.021 0.041 1996 0.056 0.159 1997 0.040 0.134 1998 0.015 0.039 1999 0.064 0.122 2000 0.015 0.042 2001 0.004 0.037 2002 0.021 0.157 2003 0.037 0.038 2004 0.034 0.307 2005 0.024 0.066 2006 0.023 0.044 2007 0.076 0.241 2008 0.077 0.298 2009 0.033 0.097 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0990 0.3075 2 0.0771 0.2980 3 0.0759 0.2873 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 10 4 0.0636 0.2484 5 0.0585 0.2408 6 0.0558 0.1820 7 0.0452 0.1585 8 0.0420 0.1569 9 0.0399 0.1521 10 0.0365 0.1476 11 0.0365 0.1443 12 0.0343 0.1336 13 0.0342 0.1219 14 0.0340 0.1051 15 0.0336 0.0970 16 0.0334 0.0938 17 0.0330 0.0841 18 0.0327 0.0827 19 0.0317 0.0659 20 0.0312 0.0618 21 0.0263 0.0556 22 0.0258 0.0457 23 0.0243 0.0448 24 0.0236 0.0440 25 0.0232 0.0440 26 0.0224 0.0438 27 0.0219 0.0436 28 0.0213 0.0431 29 0.0213 0.0431 30 0.0211 0.0429 31 0.0202 0.0426 32 0.0202 0.0424 33 0.0199 0.0424 34 0.0197 0.0411 35 0.0189 0.0409 36 0.0187 0.0408 37 0.0178 0.0404 38 0.0171 0.0401 39 0.0167 0.0401 40 0.0166 0.0398 41 0.0162 0.0398 42 0.0159 0.0397 43 0.0158 0.0394 44 0.0155 0.0393 45 0.0152 0.0392 46 0.0152 0.0391 47 0.0151 0.0389 48 0.0151 0.0388 49 0.0140 0.0383 50 0.0137 0.0383 51 0.0134 0.0380 52 0.0132 0.0379 53 0.0131 0.0375 54 0.0118 0.0374 55 0.0110 0.0369 56 0.0090 0.0366 57 0.0087 0.0366 58 0.0080 0.0360 59 0.0079 0.0359 60 0.0068 0.0345 61 0.0039 0.0341 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 11 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 12 Duration Flows Flow(cfs)Predev Mit Percentage Pass/Fail 0.0107 16238 130258 802 Fail 0.0114 14140 124697 881 Fail 0.0121 12192 119563 980 Fail 0.0128 10515 114794 1091 Fail 0.0135 9163 110281 1203 Fail 0.0142 7974 106131 1330 Fail 0.0149 6951 102196 1470 Fail 0.0156 6145 98517 1603 Fail 0.0163 5454 95137 1744 Fail 0.0170 4864 91908 1889 Fail 0.0177 4359 88977 2041 Fail 0.0184 3918 86133 2198 Fail 0.0191 3484 83395 2393 Fail 0.0198 3091 80871 2616 Fail 0.0206 2731 78390 2870 Fail 0.0213 2417 76101 3148 Fail 0.0220 2160 73898 3421 Fail 0.0227 1933 71866 3717 Fail 0.0234 1759 69984 3978 Fail 0.0241 1597 68252 4273 Fail 0.0248 1395 66498 4766 Fail 0.0255 1246 64851 5204 Fail 0.0262 1118 63289 5660 Fail 0.0269 1035 61835 5974 Fail 0.0276 943 60316 6396 Fail 0.0283 876 58755 6707 Fail 0.0290 788 56980 7230 Fail 0.0297 713 54156 7595 Fail 0.0304 633 40681 6426 Fail 0.0311 547 31356 5732 Fail 0.0318 464 24854 5356 Fail 0.0325 391 20270 5184 Fail 0.0332 350 16827 4807 Fail 0.0339 309 13990 4527 Fail 0.0346 265 11777 4444 Fail 0.0353 218 10010 4591 Fail 0.0360 184 8718 4738 Fail 0.0367 152 7668 5044 Fail 0.0374 126 6682 5303 Fail 0.0381 113 5848 5175 Fail 0.0388 94 5056 5378 Fail 0.0395 80 4413 5516 Fail 0.0402 67 3865 5768 Fail 0.0409 60 3377 5628 Fail 0.0416 49 2937 5993 Fail 0.0423 44 2524 5736 Fail 0.0430 41 2143 5226 Fail 0.0437 34 1895 5573 Fail 0.0444 30 1663 5543 Fail 0.0451 25 1458 5832 Fail 0.0458 20 1277 6385 Fail 0.0465 18 1116 6200 Fail 0.0472 12 958 7983 Fail 0.0479 12 858 7150 Fail FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 13 0.0487 11 663 6027 Fail 0.0494 11 656 5963 Fail 0.0501 10 648 6480 Fail 0.0508 9 640 7111 Fail 0.0515 9 632 7022 Fail 0.0522 9 627 6966 Fail 0.0529 9 622 6911 Fail 0.0536 9 617 6855 Fail 0.0543 9 606 6733 Fail 0.0550 9 594 6600 Fail 0.0557 9 589 6544 Fail 0.0564 8 576 7200 Fail 0.0571 8 571 7137 Fail 0.0578 8 562 7025 Fail 0.0585 7 559 7985 Fail 0.0592 6 553 9216 Fail 0.0599 6 538 8966 Fail 0.0606 6 528 8800 Fail 0.0613 6 523 8716 Fail 0.0620 6 518 8633 Fail 0.0627 6 513 8550 Fail 0.0634 6 511 8516 Fail 0.0641 5 505 10100 Fail 0.0648 5 500 10000 Fail 0.0655 5 496 9920 Fail 0.0662 5 491 9820 Fail 0.0669 5 487 9740 Fail 0.0676 5 484 9680 Fail 0.0683 5 477 9540 Fail 0.0690 5 468 9360 Fail 0.0697 4 465 11625 Fail 0.0704 4 458 11450 Fail 0.0711 4 453 11325 Fail 0.0718 4 449 11225 Fail 0.0725 4 442 11050 Fail 0.0732 4 433 10825 Fail 0.0739 4 431 10775 Fail 0.0746 4 425 10625 Fail 0.0753 4 423 10575 Fail 0.0760 3 416 13866 Fail 0.0768 3 410 13666 Fail 0.0775 1 404 40400 Fail 0.0782 1 398 39800 Fail 0.0789 1 391 39100 Fail 0.0796 1 389 38900 Fail 0.0803 1 383 38300 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 14 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0601 acre-feet On-line facility target flow:0.0358 cfs. Adjusted for 15 min:0.0358 cfs. Off-line facility target flow:0.0265 cfs. Adjusted for 15 min:0.0265 cfs. FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:16:35 PM Page 15 LID Report FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:03 PM Page 16 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:03 PM Page 17 Appendix Predeveloped Schematic FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:04 PM Page 18 Mitigated Schematic FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:05 PM Page 19 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #1.wdm MESSU 25 PreFUPC LARGE LOT_BF SWALE #1.MES 27 PreFUPC LARGE LOT_BF SWALE #1.L61 28 PreFUPC LARGE LOT_BF SWALE #1.L62 30 POCFUPC LARGE LOT_BF SWALE #11.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 11 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 C, Forest, Mod 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 11 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 11 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:05 PM Page 20 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 11 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 11 0 4.5 0.08 400 0.1 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 11 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 11 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 11 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:05 PM Page 21 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 11 0.52 COPY 501 12 PERLND 11 0.52 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:05 PM Page 22 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:05 PM Page 23 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #1.wdm MESSU 25 MitFUPC LARGE LOT_BF SWALE #1.MES 27 MitFUPC LARGE LOT_BF SWALE #1.L61 28 MitFUPC LARGE LOT_BF SWALE #1.L62 30 POCFUPC LARGE LOT_BF SWALE #11.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 GENER 2 RCHRES 1 RCHRES 2 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Surface LTN SWALE #1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** 2 24 END OPCODE PARM # # K *** 2 0. END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 24 PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 25 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.13 RCHRES 1 2 PERLND 16 0.13 RCHRES 1 3 IMPLND 11 0.39 RCHRES 1 5 ******Routing****** PERLND 16 0.13 COPY 1 12 IMPLND 11 0.39 COPY 1 15 PERLND 16 0.13 COPY 1 13 RCHRES 1 1 RCHRES 2 8 RCHRES 2 1 COPY 501 16 RCHRES 1 1 COPY 501 17 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 GENER 2 OUTPUT TIMSER .0011111 RCHRES 1 EXTNL OUTDGT 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Surface LTN SWAL-006 3 1 1 1 28 0 1 2 BIOFILTN SWALE #-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 2 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 26 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 5 6 0 0 0 1 0 0 0 2 1 2 2 2 2 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.01 0.0 0.0 0.0 0.0 2 2 0.03 0.0 0.0 0.0 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 5.0 6.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS *** User-Defined Variable Quantity Lines *** addr *** <------> *** kwd varnam optyp opn vari s1 s2 s3 tp multiply lc ls ac as agfn *** <****> <----> <----> <-> <----><-><-><-><-><--------> <><-> <><-> <--> *** UVQUAN vol2 RCHRES 2 VOL 4 UVQUAN v2m2 GLOBAL WORKSP 1 3 UVQUAN vpo2 GLOBAL WORKSP 2 3 UVQUAN v2d2 GENER 2 K 1 3 *** User-Defined Target Variable Names *** addr or addr or *** <------> <------> *** kwd varnam ct vari s1 s2 s3 frac oper vari s1 s2 s3 frac oper <****> <----><-> <----><-><-><-> <---> <--> <----><-><-><-> <---> <--> UVNAME v2m2 1 WORKSP 1 1.0 QUAN UVNAME vpo2 1 WORKSP 2 1.0 QUAN UVNAME v2d2 1 K 1 1.0 QUAN *** opt foplop dcdts yr mo dy hr mn d t vnam s1 s2 s3 ac quantity tc ts rp <****><-><--><><-><--> <> <> <> <><><> <----><-><-><-><-><--------> <> <-><-> GENER 2 v2m2 = 754.89 *** Compute remaining available pore space GENER 2 vpo2 = v2m2 GENER 2 vpo2 -= vol2 *** Check to see if VPORA goes negative; if so set VPORA = 0.0 IF (vpo2 < 0.0) THEN GENER 2 vpo2 = 0.0 END IF *** Infiltration volume GENER 2 v2d2 = vpo2 END SPEC-ACTIONS FTABLES FTABLE 2 62 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.043409 0.000000 0.000000 0.049341 0.043063 0.000119 0.000000 0.098681 0.042487 0.000243 0.000000 0.148022 0.041912 0.000374 0.000000 0.197363 0.041337 0.000510 0.000000 0.246703 0.040764 0.000652 0.000000 0.296044 0.040192 0.000781 0.000000 0.345385 0.039620 0.000916 0.000000 0.394725 0.039050 0.001056 0.000000 0.444066 0.038481 0.001201 0.000000 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 27 0.493407 0.037912 0.001351 0.000000 0.542747 0.037345 0.001506 0.000000 0.592088 0.036779 0.001667 0.000000 0.641429 0.036213 0.001832 0.000000 0.690769 0.035649 0.002003 0.000000 0.740110 0.035086 0.002180 0.000000 0.789451 0.034523 0.002361 0.000000 0.838791 0.033962 0.002548 0.000000 0.888132 0.033402 0.002740 0.000000 0.937473 0.032843 0.002937 0.000000 0.986813 0.032284 0.003140 0.000000 1.036154 0.031727 0.003347 0.000000 1.085495 0.031171 0.003561 0.000000 1.134835 0.030616 0.003779 0.000000 1.184176 0.030061 0.004003 0.000000 1.233516 0.029508 0.004232 0.000000 1.282857 0.028956 0.004466 0.000000 1.332198 0.028405 0.004706 0.000000 1.381538 0.027854 0.004951 0.000000 1.430879 0.027305 0.005202 0.000000 1.480220 0.026757 0.005458 0.000000 1.529560 0.026210 0.005729 0.000000 1.578901 0.025664 0.006006 0.000000 1.628242 0.025118 0.006288 0.000000 1.677582 0.024574 0.006576 0.000000 1.726923 0.024031 0.006870 0.000000 1.776264 0.023489 0.007169 0.000000 1.825604 0.022948 0.007474 0.000000 1.874945 0.022408 0.007785 0.000000 1.924286 0.021868 0.008101 0.000000 1.973626 0.021330 0.008423 0.000000 2.022967 0.020793 0.008751 0.000000 2.072308 0.020257 0.009084 0.047988 2.121648 0.019722 0.009423 0.047988 2.170989 0.019188 0.009768 0.047988 2.220330 0.018655 0.010119 0.047988 2.269670 0.018123 0.010475 0.047988 2.319011 0.017591 0.010837 0.047988 2.368352 0.017061 0.011205 0.047988 2.417692 0.016532 0.011579 0.047988 2.467033 0.016004 0.011958 0.047988 2.516374 0.015477 0.012343 0.047988 2.565714 0.014951 0.012734 0.047988 2.615055 0.014426 0.013131 0.047988 2.664396 0.013902 0.013534 0.047988 2.713736 0.013379 0.013942 0.047988 2.763077 0.012857 0.014357 0.047988 2.812418 0.012336 0.014777 0.047988 2.861758 0.011816 0.015203 0.047988 2.911099 0.011297 0.015635 0.047988 2.960440 0.010779 0.016073 0.047988 2.990000 0.010262 0.017330 0.047988 END FTABLE 2 FTABLE 1 32 6 Depth Area Volume Outflow1 Outflow2 Outflow3 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (cfs) (cfs) (ft/sec) (Minutes)*** 0.000000 0.010262 0.000000 0.000000 0.000000 0.000000 0.049341 0.043987 0.002156 0.000000 0.029740 0.000000 0.098681 0.044566 0.004341 0.000000 0.030687 0.000000 0.148022 0.045146 0.006554 0.000000 0.031634 0.000000 0.197363 0.045727 0.008796 0.000000 0.032581 0.000000 0.246703 0.046309 0.011066 0.000000 0.033529 0.000000 0.296044 0.046892 0.013366 0.000000 0.034476 0.000000 0.345385 0.047476 0.015694 0.000000 0.035423 0.000000 0.394725 0.048061 0.018051 0.000000 0.036370 0.000000 0.444066 0.048647 0.020437 0.000000 0.037317 0.000000 0.493407 0.049234 0.022851 0.000000 0.038264 0.000000 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 28 0.542747 0.049822 0.025295 0.000000 0.039211 0.000000 0.592088 0.050411 0.027768 0.000000 0.040158 0.000000 0.641429 0.051001 0.030270 0.000000 0.041105 0.000000 0.690769 0.051592 0.032801 0.000000 0.042053 0.000000 0.740110 0.052184 0.035361 0.000000 0.043000 0.000000 0.789451 0.052777 0.037950 0.000000 0.043947 0.000000 0.838791 0.053372 0.040569 0.000000 0.044894 0.000000 0.888132 0.053967 0.043217 0.000000 0.045841 0.000000 0.937473 0.054563 0.045895 0.000000 0.046788 0.000000 0.986813 0.055160 0.048602 0.000000 0.047735 0.000000 1.036154 0.055758 0.051338 0.072894 0.048682 0.000000 1.085495 0.056357 0.054104 0.264183 0.049629 0.000000 1.134835 0.056957 0.056899 0.518066 0.050577 0.000000 1.184176 0.057558 0.059724 0.809872 0.051524 0.000000 1.233516 0.058160 0.062579 1.116169 0.052471 0.000000 1.282857 0.058764 0.065464 1.412987 0.053418 0.000000 1.332198 0.059368 0.068378 1.677898 0.054365 0.000000 1.381538 0.059973 0.071322 1.893756 0.055312 0.000000 1.430879 0.060579 0.074296 2.053485 0.056259 0.000000 1.480220 0.061186 0.077300 2.165704 0.057206 0.000000 1.500000 0.061430 0.078513 2.292014 0.057586 0.000000 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP WDM 2 PREC ENGL 1.167 RCHRES 1 EXTNL PREC WDM 1 EVAP ENGL 0.5 RCHRES 1 EXTNL POTEV WDM 1 EVAP ENGL 0.76 RCHRES 2 EXTNL POTEV END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 2 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 2 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1004 STAG ENGL REPL RCHRES 1 HYDR O 1 1 1 WDM 1005 FLOW ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 8 RCHRES OFLOW OVOL 2 RCHRES INFLOW IVOL END MASS-LINK 8 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 29 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 MASS-LINK 17 RCHRES OFLOW OVOL 1 COPY INPUT MEAN END MASS-LINK 17 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 30 Predeveloped HSPF Message File FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 31 Mitigated HSPF Message File FUPC LARGE LOT_BF SWALE #1 12/2/2019 6:17:06 PM Page 32 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2019; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com WWHM2012 PROJECT REPORT FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 2 General Model Information Project Name:FUPC LARGE LOT _BF SWALE #2 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:12/2/2019 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:1.167 Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, 0.29 Pervious Total 0.29 Impervious Land Use acre Impervious Total 0 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater Flat FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 4 Mitigated Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.02 Pervious Total 0.02 Impervious Land Use acre PARKING FLAT 0.27 Impervious Total 0.27 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater Surface LTN SWALE #2Surface LTN SWALE #2 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 6 Mitigated Routing BIOFILTN SWALE #2 Bottom Length: 160.00 ft. Bottom Width: 3.00 ft. Material thickness of first layer: 0.25 Material type for first layer: SMMWW 12 in/hr Material thickness of second layer: 1.25 Material type for second layer: Sand Material thickness of third layer: 1 Material type for third layer: GRAVEL Underdrain used Underdrain Diameter (feet):0.5 Orifice Diameter (in.):6 Offset (in.):6 Flow Through Underdrain (ac-ft.):55.91 Total Outflow (ac-ft.):56.17 Percent Through Underdrain:99.54 Discharge Structure Riser Height:0.59 ft. Riser Diameter:12 in. Element Flows To: Outlet 1 Outlet 2 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.0404 0.0000 0.0000 0.0000 0.0395 0.0402 0.0001 0.0000 0.0000 0.0789 0.0397 0.0002 0.0000 0.0000 0.1184 0.0392 0.0003 0.0000 0.0000 0.1578 0.0387 0.0004 0.0000 0.0000 0.1973 0.0383 0.0005 0.0000 0.0000 0.2367 0.0378 0.0007 0.0000 0.0000 0.2762 0.0373 0.0008 0.0000 0.0000 0.3156 0.0368 0.0009 0.0000 0.0000 0.3551 0.0363 0.0010 0.0000 0.0000 0.3945 0.0359 0.0011 0.0000 0.0000 0.4340 0.0354 0.0013 0.0000 0.0000 0.4734 0.0349 0.0014 0.0000 0.0000 0.5129 0.0344 0.0015 0.0000 0.0000 0.5523 0.0340 0.0016 0.0000 0.0000 0.5918 0.0335 0.0018 0.0000 0.0000 0.6312 0.0330 0.0019 0.0000 0.0000 0.6707 0.0325 0.0021 0.0000 0.0000 0.7101 0.0321 0.0022 0.0000 0.0000 0.7496 0.0316 0.0024 0.0000 0.0000 0.7890 0.0311 0.0025 0.0000 0.0000 0.8285 0.0307 0.0027 0.0000 0.0000 0.8679 0.0302 0.0029 0.0000 0.0000 0.9074 0.0297 0.0030 0.0000 0.0000 0.9468 0.0292 0.0032 0.0000 0.0000 0.9863 0.0288 0.0034 0.0000 0.0000 1.0257 0.0283 0.0035 0.0000 0.0000 1.0652 0.0278 0.0037 0.0000 0.0000 1.1046 0.0274 0.0039 0.0000 0.0000 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 7 1.1441 0.0269 0.0041 0.0000 0.0000 1.1835 0.0264 0.0043 0.0000 0.0000 1.2230 0.0260 0.0045 0.0000 0.0000 1.2624 0.0255 0.0047 0.0000 0.0000 1.3019 0.0251 0.0049 0.0000 0.0000 1.3413 0.0246 0.0051 0.0000 0.0000 1.3808 0.0241 0.0053 0.0000 0.0000 1.4202 0.0237 0.0055 0.0000 0.0000 1.4597 0.0232 0.0057 0.0000 0.0000 1.4991 0.0228 0.0060 0.0000 0.0000 1.5386 0.0223 0.0062 0.0000 0.0000 1.5780 0.0218 0.0064 0.0000 0.0000 1.6175 0.0214 0.0067 0.0000 0.0000 1.6569 0.0209 0.0069 0.0000 0.0000 1.6964 0.0205 0.0072 0.0000 0.0000 1.7358 0.0200 0.0074 0.0000 0.0000 1.7753 0.0195 0.0077 0.0000 0.0000 1.8147 0.0191 0.0079 0.0000 0.0000 1.8542 0.0186 0.0082 0.0000 0.0000 1.8936 0.0182 0.0085 0.0000 0.0000 1.9331 0.0177 0.0087 0.0000 0.0000 1.9725 0.0173 0.0090 0.0000 0.0000 2.0120 0.0168 0.0093 0.0000 0.0000 2.0514 0.0164 0.0096 0.0431 0.0000 2.0909 0.0159 0.0099 0.0431 0.0000 2.1303 0.0155 0.0102 0.0431 0.0000 2.1698 0.0150 0.0105 0.0431 0.0000 2.2092 0.0146 0.0108 0.0431 0.0000 2.2487 0.0141 0.0111 0.0431 0.0000 2.2881 0.0137 0.0114 0.0431 0.0000 2.3276 0.0132 0.0117 0.0431 0.0000 2.3670 0.0128 0.0120 0.0431 0.0000 2.4065 0.0124 0.0123 0.0431 0.0000 2.4459 0.0119 0.0126 0.0431 0.0000 2.4854 0.0115 0.0130 0.0431 0.0000 2.5000 0.0110 0.0131 0.0431 0.0000 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)To Amended(cfs)Infilt(cfs) 2.5000 0.0404 0.0131 0.0000 0.0317 0.0000 2.5395 0.0409 0.0147 0.0000 0.0317 0.0000 2.5789 0.0413 0.0163 0.0000 0.0325 0.0000 2.6184 0.0418 0.0179 0.0000 0.0334 0.0000 2.6578 0.0423 0.0196 0.0000 0.0342 0.0000 2.6973 0.0428 0.0213 0.0000 0.0350 0.0000 2.7367 0.0433 0.0230 0.0000 0.0358 0.0000 2.7762 0.0438 0.0247 0.0000 0.0366 0.0000 2.8156 0.0443 0.0264 0.0000 0.0374 0.0000 2.8551 0.0448 0.0282 0.0000 0.0382 0.0000 2.8945 0.0452 0.0300 0.0000 0.0391 0.0000 2.9340 0.0457 0.0318 0.0000 0.0399 0.0000 2.9734 0.0462 0.0336 0.0000 0.0407 0.0000 3.0129 0.0467 0.0354 0.0000 0.0415 0.0000 3.0523 0.0472 0.0373 0.0000 0.0423 0.0000 3.0918 0.0477 0.0391 0.0008 0.0431 0.0000 3.1312 0.0482 0.0410 0.0887 0.0439 0.0000 3.1707 0.0487 0.0429 0.2422 0.0447 0.0000 3.2101 0.0492 0.0449 0.4373 0.0456 0.0000 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 8 3.2496 0.0497 0.0468 0.6610 0.0464 0.0000 3.2890 0.0502 0.0488 0.9015 0.0472 0.0000 3.3285 0.0507 0.0508 1.1467 0.0480 0.0000 3.3679 0.0512 0.0528 1.3843 0.0488 0.0000 3.4074 0.0517 0.0548 1.6028 0.0496 0.0000 3.4468 0.0522 0.0569 1.7925 0.0504 0.0000 3.4863 0.0527 0.0589 1.9473 0.0512 0.0000 3.5257 0.0532 0.0610 2.0663 0.0521 0.0000 3.5652 0.0537 0.0631 2.1557 0.0529 0.0000 3.5900 0.0540 0.0645 2.2594 0.0534 0.0000 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 9 Surface LTN SWALE #2 Element Flows To: Outlet 1 Outlet 2 BIOFILTN SWALE #2 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:19:22 PM Page 10 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.29 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.02 Total Impervious Area:0.27 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.011952 5 year 0.020314 10 year 0.026964 25 year 0.036633 50 year 0.044763 100 year 0.053696 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.045743 5 year 0.072547 10 year 0.096131 25 year 0.134003 50 year 0.169093 100 year 0.211029 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.017 0.041 1950 0.019 0.039 1951 0.023 0.071 1952 0.008 0.036 1953 0.007 0.036 1954 0.010 0.036 1955 0.015 0.063 1956 0.014 0.038 1957 0.012 0.042 1958 0.011 0.039 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 11 1959 0.009 0.037 1960 0.019 0.095 1961 0.009 0.036 1962 0.006 0.035 1963 0.009 0.035 1964 0.012 0.037 1965 0.009 0.036 1966 0.007 0.036 1967 0.020 0.041 1968 0.011 0.037 1969 0.011 0.038 1970 0.008 0.037 1971 0.011 0.037 1972 0.018 0.044 1973 0.008 0.037 1974 0.011 0.035 1975 0.014 0.043 1976 0.010 0.036 1977 0.004 0.036 1978 0.009 0.041 1979 0.005 0.036 1980 0.033 0.041 1981 0.007 0.038 1982 0.019 0.173 1983 0.012 0.040 1984 0.008 0.036 1985 0.004 0.038 1986 0.019 0.093 1987 0.018 0.095 1988 0.007 0.036 1989 0.005 0.034 1990 0.055 0.158 1991 0.025 0.117 1992 0.010 0.038 1993 0.009 0.034 1994 0.004 0.034 1995 0.012 0.038 1996 0.031 0.086 1997 0.022 0.090 1998 0.009 0.036 1999 0.035 0.077 2000 0.008 0.040 2001 0.002 0.035 2002 0.012 0.091 2003 0.020 0.036 2004 0.019 0.209 2005 0.013 0.044 2006 0.013 0.038 2007 0.042 0.161 2008 0.043 0.195 2009 0.018 0.043 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0552 0.2085 2 0.0430 0.1954 3 0.0423 0.1727 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 12 4 0.0354 0.1606 5 0.0326 0.1577 6 0.0311 0.1165 7 0.0252 0.0951 8 0.0235 0.0950 9 0.0222 0.0928 10 0.0204 0.0909 11 0.0203 0.0897 12 0.0191 0.0857 13 0.0191 0.0767 14 0.0190 0.0709 15 0.0187 0.0633 16 0.0186 0.0438 17 0.0184 0.0436 18 0.0183 0.0433 19 0.0177 0.0432 20 0.0174 0.0416 21 0.0147 0.0414 22 0.0144 0.0406 23 0.0135 0.0405 24 0.0132 0.0405 25 0.0129 0.0401 26 0.0125 0.0397 27 0.0122 0.0390 28 0.0119 0.0386 29 0.0119 0.0382 30 0.0118 0.0382 31 0.0113 0.0379 32 0.0112 0.0377 33 0.0111 0.0377 34 0.0110 0.0377 35 0.0106 0.0376 36 0.0105 0.0371 37 0.0099 0.0370 38 0.0095 0.0370 39 0.0093 0.0368 40 0.0092 0.0367 41 0.0090 0.0365 42 0.0088 0.0365 43 0.0088 0.0365 44 0.0086 0.0364 45 0.0085 0.0362 46 0.0085 0.0360 47 0.0084 0.0360 48 0.0084 0.0360 49 0.0078 0.0359 50 0.0076 0.0356 51 0.0075 0.0356 52 0.0074 0.0356 53 0.0073 0.0355 54 0.0066 0.0355 55 0.0061 0.0353 56 0.0050 0.0349 57 0.0048 0.0347 58 0.0045 0.0346 59 0.0044 0.0343 60 0.0038 0.0341 61 0.0022 0.0340 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 13 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 14 Duration Flows Flow(cfs)Predev Mit Percentage Pass/Fail 0.0060 16206 128868 795 Fail 0.0064 14121 123606 875 Fail 0.0068 12192 118644 973 Fail 0.0072 10504 114088 1086 Fail 0.0075 9161 109725 1197 Fail 0.0079 7963 105746 1327 Fail 0.0083 6951 101918 1466 Fail 0.0087 6141 98260 1600 Fail 0.0091 5450 94752 1738 Fail 0.0095 4860 91394 1880 Fail 0.0099 4359 88314 2026 Fail 0.0103 3921 85384 2177 Fail 0.0107 3491 82454 2361 Fail 0.0111 3095 79631 2572 Fail 0.0115 2731 76957 2817 Fail 0.0119 2417 74390 3077 Fail 0.0122 2160 72037 3335 Fail 0.0126 1935 69813 3607 Fail 0.0130 1762 67610 3837 Fail 0.0134 1600 65493 4093 Fail 0.0138 1393 63418 4552 Fail 0.0142 1246 61536 4938 Fail 0.0146 1122 59653 5316 Fail 0.0150 1036 57793 5578 Fail 0.0154 944 56146 5947 Fail 0.0158 875 54456 6223 Fail 0.0162 788 52895 6712 Fail 0.0166 713 51376 7205 Fail 0.0169 633 49879 7879 Fail 0.0173 548 48553 8860 Fail 0.0177 466 47226 10134 Fail 0.0181 391 45922 11744 Fail 0.0185 350 44703 12772 Fail 0.0189 309 43548 14093 Fail 0.0193 265 42328 15972 Fail 0.0197 219 41195 18810 Fail 0.0201 184 40083 21784 Fail 0.0205 152 39056 25694 Fail 0.0209 126 38093 30232 Fail 0.0213 113 37152 32877 Fail 0.0216 94 36254 38568 Fail 0.0220 80 35398 44247 Fail 0.0224 67 34543 51556 Fail 0.0228 60 33773 56288 Fail 0.0232 49 32982 67310 Fail 0.0236 44 32233 73256 Fail 0.0240 41 31548 76946 Fail 0.0244 34 30757 90461 Fail 0.0248 30 30094 100313 Fail 0.0252 25 29452 117807 Fail 0.0256 20 28789 143945 Fail 0.0260 18 28148 156377 Fail 0.0263 12 27570 229750 Fail 0.0267 12 27014 225116 Fail FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 15 0.0271 11 26501 240918 Fail 0.0275 11 25987 236245 Fail 0.0279 10 25453 254530 Fail 0.0283 9 24961 277344 Fail 0.0287 9 24512 272355 Fail 0.0291 9 24062 267355 Fail 0.0295 9 23570 261888 Fail 0.0299 9 23057 256188 Fail 0.0303 9 22544 250488 Fail 0.0307 9 22009 244544 Fail 0.0311 9 21432 238133 Fail 0.0314 8 20664 258300 Fail 0.0318 8 18662 233275 Fail 0.0322 8 14726 184075 Fail 0.0326 7 11944 170628 Fail 0.0330 6 9939 165650 Fail 0.0334 6 8429 140483 Fail 0.0338 6 7202 120033 Fail 0.0342 6 6190 103166 Fail 0.0346 6 5403 90050 Fail 0.0350 6 4744 79066 Fail 0.0354 6 4186 69766 Fail 0.0358 5 3711 74220 Fail 0.0361 5 3322 66440 Fail 0.0365 5 2971 59420 Fail 0.0369 5 2646 52920 Fail 0.0373 5 2391 47820 Fail 0.0377 5 2118 42360 Fail 0.0381 5 1900 38000 Fail 0.0385 5 1745 34900 Fail 0.0389 4 1593 39825 Fail 0.0393 4 1463 36575 Fail 0.0397 4 1317 32925 Fail 0.0401 4 1189 29725 Fail 0.0405 4 1053 26325 Fail 0.0408 4 927 23175 Fail 0.0412 4 810 20250 Fail 0.0416 4 711 17775 Fail 0.0420 4 649 16225 Fail 0.0424 3 601 20033 Fail 0.0428 3 563 18766 Fail 0.0432 1 464 46400 Fail 0.0436 1 395 39500 Fail 0.0440 1 325 32500 Fail 0.0444 1 324 32400 Fail 0.0448 1 320 32000 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 16 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0421 acre-feet On-line facility target flow:0.0341 cfs. Adjusted for 15 min:0.0341 cfs. Off-line facility target flow:0.0244 cfs. Adjusted for 15 min:0.0244 cfs. FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:00 PM Page 17 LID Report FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:43 PM Page 18 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:43 PM Page 19 Appendix Predeveloped Schematic FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:44 PM Page 20 Mitigated Schematic FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 21 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT _BF SWALE #2.wdm MESSU 25 PreFUPC LARGE LOT _BF SWALE #2.MES 27 PreFUPC LARGE LOT _BF SWALE #2.L61 28 PreFUPC LARGE LOT _BF SWALE #2.L62 30 POCFUPC LARGE LOT _BF SWALE #21.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 11 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 C, Forest, Mod 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 11 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 11 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 22 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 11 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 11 0 4.5 0.08 400 0.1 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 11 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 11 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 11 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 23 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 11 0.29 COPY 501 12 PERLND 11 0.29 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 24 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 25 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT _BF SWALE #2.wdm MESSU 25 MitFUPC LARGE LOT _BF SWALE #2.MES 27 MitFUPC LARGE LOT _BF SWALE #2.L61 28 MitFUPC LARGE LOT _BF SWALE #2.L62 30 POCFUPC LARGE LOT _BF SWALE #21.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 GENER 2 RCHRES 1 RCHRES 2 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Surface LTN SWALE #2 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** 2 24 END OPCODE PARM # # K *** 2 0. END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 26 PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 27 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.02 RCHRES 1 2 PERLND 16 0.02 RCHRES 1 3 IMPLND 11 0.27 RCHRES 1 5 ******Routing****** PERLND 16 0.02 COPY 1 12 IMPLND 11 0.27 COPY 1 15 PERLND 16 0.02 COPY 1 13 RCHRES 1 1 RCHRES 2 8 RCHRES 2 1 COPY 501 16 RCHRES 1 1 COPY 501 17 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 GENER 2 OUTPUT TIMSER .0011111 RCHRES 1 EXTNL OUTDGT 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Surface LTN SWAL-006 3 1 1 1 28 0 1 2 BIOFILTN SWALE #-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 2 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 28 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 5 6 0 0 0 1 0 0 0 2 1 2 2 2 2 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.01 0.0 0.0 0.0 0.0 2 2 0.03 0.0 0.0 0.0 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 5.0 6.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS *** User-Defined Variable Quantity Lines *** addr *** <------> *** kwd varnam optyp opn vari s1 s2 s3 tp multiply lc ls ac as agfn *** <****> <----> <----> <-> <----><-><-><-><-><--------> <><-> <><-> <--> *** UVQUAN vol2 RCHRES 2 VOL 4 UVQUAN v2m2 GLOBAL WORKSP 1 3 UVQUAN vpo2 GLOBAL WORKSP 2 3 UVQUAN v2d2 GENER 2 K 1 3 *** User-Defined Target Variable Names *** addr or addr or *** <------> <------> *** kwd varnam ct vari s1 s2 s3 frac oper vari s1 s2 s3 frac oper <****> <----><-> <----><-><-><-> <---> <--> <----><-><-><-> <---> <--> UVNAME v2m2 1 WORKSP 1 1.0 QUAN UVNAME vpo2 1 WORKSP 2 1.0 QUAN UVNAME v2d2 1 K 1 1.0 QUAN *** opt foplop dcdts yr mo dy hr mn d t vnam s1 s2 s3 ac quantity tc ts rp <****><-><--><><-><--> <> <> <> <><><> <----><-><-><-><-><--------> <> <-><-> GENER 2 v2m2 = 608.64 *** Compute remaining available pore space GENER 2 vpo2 = v2m2 GENER 2 vpo2 -= vol2 *** Check to see if VPORA goes negative; if so set VPORA = 0.0 IF (vpo2 < 0.0) THEN GENER 2 vpo2 = 0.0 END IF *** Infiltration volume GENER 2 v2d2 = vpo2 END SPEC-ACTIONS FTABLES FTABLE 2 65 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.040375 0.000000 0.000000 0.039451 0.040196 0.000101 0.000000 0.078901 0.039713 0.000207 0.000000 0.118352 0.039231 0.000316 0.000000 0.157802 0.038749 0.000430 0.000000 0.197253 0.038268 0.000547 0.000000 0.236703 0.037787 0.000669 0.000000 0.276154 0.037307 0.000778 0.000000 0.315604 0.036828 0.000892 0.000000 0.355055 0.036350 0.001008 0.000000 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 29 0.394505 0.035872 0.001129 0.000000 0.433956 0.035395 0.001253 0.000000 0.473407 0.034918 0.001380 0.000000 0.512857 0.034442 0.001511 0.000000 0.552308 0.033967 0.001646 0.000000 0.591758 0.033492 0.001784 0.000000 0.631209 0.033018 0.001926 0.000000 0.670659 0.032544 0.002071 0.000000 0.710110 0.032072 0.002220 0.000000 0.749560 0.031599 0.002372 0.000000 0.789011 0.031128 0.002528 0.000000 0.828462 0.030657 0.002688 0.000000 0.867912 0.030187 0.002851 0.000000 0.907363 0.029717 0.003018 0.000000 0.946813 0.029248 0.003188 0.000000 0.986264 0.028780 0.003363 0.000000 1.025714 0.028313 0.003540 0.000000 1.065165 0.027846 0.003722 0.000000 1.104615 0.027379 0.003907 0.000000 1.144066 0.026914 0.004095 0.000000 1.183516 0.026449 0.004287 0.000000 1.222967 0.025984 0.004483 0.000000 1.262418 0.025520 0.004683 0.000000 1.301868 0.025057 0.004886 0.000000 1.341319 0.024595 0.005093 0.000000 1.380769 0.024133 0.005303 0.000000 1.420220 0.023672 0.005517 0.000000 1.459670 0.023211 0.005735 0.000000 1.499121 0.022751 0.005957 0.000000 1.538571 0.022292 0.006191 0.000000 1.578022 0.021833 0.006428 0.000000 1.617473 0.021375 0.006669 0.000000 1.656923 0.020918 0.006915 0.000000 1.696374 0.020461 0.007164 0.000000 1.735824 0.020005 0.007417 0.000000 1.775275 0.019550 0.007673 0.000000 1.814725 0.019095 0.007934 0.000000 1.854176 0.018641 0.008198 0.000000 1.893626 0.018187 0.008467 0.000000 1.933077 0.017735 0.008739 0.000000 1.972527 0.017282 0.009015 0.000000 2.011978 0.016831 0.009295 0.000000 2.051429 0.016380 0.009579 0.043080 2.090879 0.015930 0.009867 0.043080 2.130330 0.015480 0.010158 0.043080 2.169780 0.015031 0.010454 0.043080 2.209231 0.014583 0.010754 0.043080 2.248681 0.014135 0.011057 0.043080 2.288132 0.013688 0.011364 0.043080 2.327582 0.013242 0.011676 0.043080 2.367033 0.012796 0.011991 0.043080 2.406484 0.012351 0.012310 0.043080 2.445934 0.011906 0.012633 0.043080 2.485385 0.011462 0.012960 0.043080 2.500000 0.011019 0.013972 0.043080 END FTABLE 2 FTABLE 1 29 6 Depth Area Volume Outflow1 Outflow2 Outflow3 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (cfs) (cfs) (ft/sec) (Minutes)*** 0.000000 0.011019 0.000000 0.000000 0.000000 0.000000 0.039451 0.040859 0.001602 0.000000 0.031732 0.000000 0.078901 0.041344 0.003224 0.000000 0.032545 0.000000 0.118352 0.041829 0.004864 0.000000 0.033358 0.000000 0.157802 0.042315 0.006524 0.000000 0.034171 0.000000 0.197253 0.042801 0.008203 0.000000 0.034985 0.000000 0.236703 0.043289 0.009901 0.000000 0.035798 0.000000 0.276154 0.043776 0.011619 0.000000 0.036611 0.000000 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 30 0.315604 0.044265 0.013355 0.000000 0.037424 0.000000 0.355055 0.044754 0.015111 0.000000 0.038237 0.000000 0.394505 0.045244 0.016887 0.000000 0.039050 0.000000 0.433956 0.045734 0.018681 0.000000 0.039864 0.000000 0.473407 0.046225 0.020495 0.000000 0.040677 0.000000 0.512857 0.046717 0.022328 0.000000 0.041490 0.000000 0.552308 0.047209 0.024181 0.000000 0.042303 0.000000 0.591758 0.047702 0.026053 0.000783 0.043116 0.000000 0.631209 0.048196 0.027945 0.088687 0.043929 0.000000 0.670659 0.048690 0.029856 0.242221 0.044743 0.000000 0.710110 0.049185 0.031786 0.437283 0.045556 0.000000 0.749560 0.049680 0.033737 0.660999 0.046369 0.000000 0.789011 0.050176 0.035706 0.901535 0.047182 0.000000 0.828462 0.050673 0.037696 1.146738 0.047995 0.000000 0.867912 0.051171 0.039704 1.384334 0.048808 0.000000 0.907363 0.051669 0.041733 1.602772 0.049622 0.000000 0.946813 0.052168 0.043781 1.792458 0.050435 0.000000 0.986264 0.052667 0.045849 1.947267 0.051248 0.000000 1.025714 0.053167 0.047937 2.066277 0.052061 0.000000 1.065165 0.053668 0.050044 2.155708 0.052874 0.000000 1.090000 0.053983 0.051381 2.259441 0.053386 0.000000 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP WDM 2 PREC ENGL 1.167 RCHRES 1 EXTNL PREC WDM 1 EVAP ENGL 0.5 RCHRES 1 EXTNL POTEV WDM 1 EVAP ENGL 0.76 RCHRES 2 EXTNL POTEV END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 2 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 2 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1004 STAG ENGL REPL RCHRES 1 HYDR O 1 1 1 WDM 1005 FLOW ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 8 RCHRES OFLOW OVOL 2 RCHRES INFLOW IVOL END MASS-LINK 8 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 31 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 MASS-LINK 17 RCHRES OFLOW OVOL 1 COPY INPUT MEAN END MASS-LINK 17 END MASS-LINK END RUN FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 32 Predeveloped HSPF Message File FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 33 Mitigated HSPF Message File FUPC LARGE LOT _BF SWALE #2 12/2/2019 6:20:46 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2019; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com WWHM2012 PROJECT REPORT FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_BF SWALE #3 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:12/2/2019 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:1.167 Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.35 Pervious Total 0.35 Impervious Land Use acre Impervious Total 0 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 4 Mitigated Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.03 Pervious Total 0.03 Impervious Land Use acre PARKING FLAT 0.32 Impervious Total 0.32 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater Surface LTN SWALE #3Surface LTN SWALE #3 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 6 Mitigated Routing BIOFILTN SWALE #3 Bottom Length: 207.00 ft. Bottom Width: 3.00 ft. Material thickness of first layer: 0.25 Material type for first layer: SMMWW 12 in/hr Material thickness of second layer: 1.25 Material type for second layer: Sand Material thickness of third layer: 0.98 Material type for third layer: GRAVEL Underdrain used Underdrain Diameter (feet):0.5 Orifice Diameter (in.):6 Offset (in.):6 Flow Through Underdrain (ac-ft.):67.082 Total Outflow (ac-ft.):67.412 Percent Through Underdrain:99.51 Discharge Structure Riser Height:0.5 ft. Riser Diameter:12 in. Element Flows To: Outlet 1 Outlet 2 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.0514 0.0000 0.0000 0.0000 0.0382 0.0509 0.0001 0.0000 0.0000 0.0765 0.0503 0.0003 0.0000 0.0000 0.1147 0.0497 0.0004 0.0000 0.0000 0.1530 0.0491 0.0005 0.0000 0.0000 0.1912 0.0485 0.0007 0.0000 0.0000 0.2295 0.0479 0.0008 0.0000 0.0000 0.2677 0.0474 0.0010 0.0000 0.0000 0.3059 0.0468 0.0011 0.0000 0.0000 0.3442 0.0462 0.0013 0.0000 0.0000 0.3824 0.0456 0.0014 0.0000 0.0000 0.4207 0.0450 0.0016 0.0000 0.0000 0.4589 0.0444 0.0017 0.0000 0.0000 0.4971 0.0438 0.0019 0.0000 0.0000 0.5354 0.0432 0.0020 0.0000 0.0000 0.5736 0.0427 0.0022 0.0000 0.0000 0.6119 0.0421 0.0024 0.0000 0.0000 0.6501 0.0415 0.0026 0.0000 0.0000 0.6884 0.0409 0.0028 0.0000 0.0000 0.7266 0.0403 0.0029 0.0000 0.0000 0.7648 0.0398 0.0031 0.0000 0.0000 0.8031 0.0392 0.0033 0.0000 0.0000 0.8413 0.0386 0.0035 0.0000 0.0000 0.8796 0.0380 0.0037 0.0000 0.0000 0.9178 0.0374 0.0040 0.0000 0.0000 0.9560 0.0369 0.0042 0.0000 0.0000 0.9943 0.0363 0.0044 0.0000 0.0000 1.0325 0.0357 0.0046 0.0000 0.0000 1.0708 0.0351 0.0048 0.0000 0.0000 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 7 1.1090 0.0346 0.0051 0.0000 0.0000 1.1473 0.0340 0.0053 0.0000 0.0000 1.1855 0.0334 0.0055 0.0000 0.0000 1.2237 0.0328 0.0058 0.0000 0.0000 1.2620 0.0323 0.0060 0.0000 0.0000 1.3002 0.0317 0.0063 0.0000 0.0000 1.3385 0.0311 0.0065 0.0000 0.0000 1.3767 0.0305 0.0068 0.0000 0.0000 1.4149 0.0300 0.0071 0.0000 0.0000 1.4532 0.0294 0.0073 0.0000 0.0000 1.4914 0.0288 0.0076 0.0000 0.0000 1.5297 0.0283 0.0079 0.0000 0.0000 1.5679 0.0277 0.0082 0.0000 0.0000 1.6062 0.0271 0.0085 0.0000 0.0000 1.6444 0.0266 0.0088 0.0000 0.0000 1.6826 0.0260 0.0091 0.0000 0.0000 1.7209 0.0254 0.0094 0.0000 0.0000 1.7591 0.0249 0.0097 0.0000 0.0000 1.7974 0.0243 0.0101 0.0000 0.0000 1.8356 0.0237 0.0104 0.0000 0.0000 1.8738 0.0232 0.0107 0.0000 0.0000 1.9121 0.0226 0.0111 0.0000 0.0000 1.9503 0.0221 0.0114 0.0000 0.0000 1.9886 0.0215 0.0118 0.0000 0.0000 2.0268 0.0209 0.0121 0.0000 0.0000 2.0651 0.0204 0.0125 0.0533 0.0000 2.1033 0.0198 0.0128 0.0533 0.0000 2.1415 0.0193 0.0132 0.0533 0.0000 2.1798 0.0187 0.0135 0.0533 0.0000 2.2180 0.0181 0.0139 0.0533 0.0000 2.2563 0.0176 0.0143 0.0533 0.0000 2.2945 0.0170 0.0147 0.0533 0.0000 2.3327 0.0165 0.0151 0.0533 0.0000 2.3710 0.0159 0.0155 0.0533 0.0000 2.4092 0.0154 0.0159 0.0533 0.0000 2.4475 0.0148 0.0163 0.0533 0.0000 2.4800 0.0143 0.0166 0.0533 0.0000 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)To Amended(cfs)Infilt(cfs) 2.4800 0.0514 0.0166 0.0000 0.0410 0.0000 2.5182 0.0520 0.0186 0.0000 0.0410 0.0000 2.5565 0.0526 0.0206 0.0000 0.0420 0.0000 2.5947 0.0532 0.0226 0.0000 0.0431 0.0000 2.6330 0.0538 0.0246 0.0000 0.0441 0.0000 2.6712 0.0544 0.0267 0.0000 0.0451 0.0000 2.7095 0.0550 0.0288 0.0000 0.0461 0.0000 2.7477 0.0556 0.0309 0.0000 0.0471 0.0000 2.7859 0.0562 0.0331 0.0000 0.0482 0.0000 2.8242 0.0567 0.0352 0.0000 0.0492 0.0000 2.8624 0.0573 0.0374 0.0000 0.0502 0.0000 2.9007 0.0579 0.0396 0.0000 0.0512 0.0000 2.9389 0.0585 0.0418 0.0000 0.0522 0.0000 2.9771 0.0591 0.0441 0.0000 0.0533 0.0000 3.0154 0.0597 0.0464 0.0706 0.0543 0.0000 3.0536 0.0603 0.0486 0.2114 0.0553 0.0000 3.0919 0.0609 0.0510 0.3938 0.0563 0.0000 3.1301 0.0616 0.0533 0.6054 0.0573 0.0000 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 8 3.1684 0.0622 0.0557 0.8356 0.0584 0.0000 3.2066 0.0628 0.0581 1.0732 0.0594 0.0000 3.2448 0.0634 0.0605 1.3072 0.0604 0.0000 3.2831 0.0640 0.0629 1.5265 0.0614 0.0000 3.3213 0.0646 0.0654 1.7219 0.0624 0.0000 3.3596 0.0652 0.0678 1.8862 0.0635 0.0000 3.3978 0.0658 0.0704 2.0165 0.0645 0.0000 3.4360 0.0664 0.0729 2.1153 0.0655 0.0000 3.4743 0.0670 0.0754 2.1926 0.0665 0.0000 3.4800 0.0671 0.0758 2.2984 0.0667 0.0000 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 9 Surface LTN SWALE #3 Element Flows To: Outlet 1 Outlet 2 BIOFILTN SWALE #3 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:08:25 PM Page 10 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.35 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.03 Total Impervious Area:0.32 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.013673 5 year 0.022542 10 year 0.029275 25 year 0.038684 50 year 0.046314 100 year 0.054456 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.058481 5 year 0.089999 10 year 0.116535 25 year 0.157554 50 year 0.194266 100 year 0.2369 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.017 0.051 1950 0.020 0.049 1951 0.028 0.083 1952 0.009 0.046 1953 0.008 0.046 1954 0.011 0.045 1955 0.018 0.081 1956 0.014 0.048 1957 0.013 0.052 1958 0.013 0.049 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 11 1959 0.011 0.046 1960 0.022 0.099 1961 0.011 0.046 1962 0.007 0.044 1963 0.011 0.044 1964 0.013 0.047 1965 0.010 0.045 1966 0.009 0.045 1967 0.021 0.052 1968 0.012 0.047 1969 0.012 0.047 1970 0.010 0.046 1971 0.012 0.047 1972 0.021 0.071 1973 0.010 0.047 1974 0.011 0.044 1975 0.016 0.062 1976 0.012 0.045 1977 0.004 0.045 1978 0.010 0.051 1979 0.006 0.047 1980 0.031 0.051 1981 0.009 0.048 1982 0.021 0.194 1983 0.015 0.051 1984 0.009 0.045 1985 0.005 0.048 1986 0.023 0.114 1987 0.021 0.107 1988 0.009 0.045 1989 0.006 0.044 1990 0.059 0.189 1991 0.026 0.142 1992 0.011 0.048 1993 0.011 0.043 1994 0.004 0.043 1995 0.014 0.048 1996 0.033 0.111 1997 0.026 0.104 1998 0.009 0.046 1999 0.036 0.095 2000 0.010 0.050 2001 0.003 0.045 2002 0.014 0.106 2003 0.019 0.046 2004 0.023 0.239 2005 0.015 0.072 2006 0.015 0.047 2007 0.043 0.190 2008 0.046 0.231 2009 0.021 0.071 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0586 0.2390 2 0.0460 0.2314 3 0.0433 0.1940 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 12 4 0.0365 0.1903 5 0.0334 0.1886 6 0.0306 0.1416 7 0.0281 0.1142 8 0.0264 0.1107 9 0.0264 0.1070 10 0.0229 0.1056 11 0.0226 0.1043 12 0.0218 0.0987 13 0.0215 0.0954 14 0.0212 0.0833 15 0.0210 0.0809 16 0.0208 0.0720 17 0.0207 0.0713 18 0.0195 0.0709 19 0.0195 0.0616 20 0.0177 0.0524 21 0.0167 0.0518 22 0.0163 0.0513 23 0.0154 0.0511 24 0.0148 0.0510 25 0.0146 0.0506 26 0.0145 0.0502 27 0.0142 0.0491 28 0.0142 0.0489 29 0.0134 0.0483 30 0.0132 0.0481 31 0.0131 0.0480 32 0.0125 0.0477 33 0.0121 0.0477 34 0.0117 0.0473 35 0.0116 0.0473 36 0.0115 0.0471 37 0.0114 0.0471 38 0.0113 0.0468 39 0.0110 0.0467 40 0.0109 0.0465 41 0.0107 0.0462 42 0.0106 0.0462 43 0.0102 0.0460 44 0.0101 0.0459 45 0.0100 0.0458 46 0.0098 0.0457 47 0.0097 0.0457 48 0.0094 0.0455 49 0.0094 0.0454 50 0.0092 0.0453 51 0.0090 0.0452 52 0.0089 0.0452 53 0.0089 0.0451 54 0.0079 0.0449 55 0.0074 0.0449 56 0.0061 0.0444 57 0.0057 0.0444 58 0.0054 0.0442 59 0.0043 0.0438 60 0.0040 0.0435 61 0.0026 0.0434 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 13 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 14 Duration Flows Flow(cfs)Predev Mit Percentage Pass/Fail 0.0068 18448 131456 712 Fail 0.0072 16091 126836 788 Fail 0.0076 14316 122301 854 Fail 0.0080 12694 118088 930 Fail 0.0084 11178 114109 1020 Fail 0.0088 9882 110281 1115 Fail 0.0092 8812 106773 1211 Fail 0.0096 7835 103415 1319 Fail 0.0100 7013 100249 1429 Fail 0.0104 6299 97127 1541 Fail 0.0108 5679 94132 1657 Fail 0.0112 5172 91223 1763 Fail 0.0116 4697 88443 1882 Fail 0.0120 4278 85876 2007 Fail 0.0124 3912 83480 2133 Fail 0.0128 3527 80978 2295 Fail 0.0132 3189 78476 2460 Fail 0.0136 2866 76187 2658 Fail 0.0140 2594 74048 2854 Fail 0.0144 2353 71931 3056 Fail 0.0148 2138 69984 3273 Fail 0.0152 1951 68081 3489 Fail 0.0156 1797 66198 3683 Fail 0.0160 1670 64380 3855 Fail 0.0164 1518 62605 4124 Fail 0.0168 1344 61044 4541 Fail 0.0172 1223 59375 4854 Fail 0.0176 1123 57771 5144 Fail 0.0180 1042 56253 5398 Fail 0.0184 969 54713 5646 Fail 0.0188 910 53322 5859 Fail 0.0192 839 51975 6194 Fail 0.0196 766 50713 6620 Fail 0.0200 705 49430 7011 Fail 0.0204 635 48210 7592 Fail 0.0208 570 47013 8247 Fail 0.0212 488 45900 9405 Fail 0.0216 425 44810 10543 Fail 0.0220 378 43740 11571 Fail 0.0224 341 42735 12532 Fail 0.0228 307 41708 13585 Fail 0.0232 271 40639 14995 Fail 0.0236 235 39698 16892 Fail 0.0240 196 38692 19740 Fail 0.0244 171 37837 22126 Fail 0.0248 145 36960 25489 Fail 0.0252 125 36168 28934 Fail 0.0256 107 35377 33062 Fail 0.0260 95 34650 36473 Fail 0.0264 84 33901 40358 Fail 0.0268 71 33174 46723 Fail 0.0272 61 32425 53155 Fail 0.0276 55 31784 57789 Fail 0.0280 45 31121 69157 Fail FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 15 0.0284 40 30458 76145 Fail 0.0288 37 29837 80640 Fail 0.0292 35 29196 83417 Fail 0.0296 29 28640 98758 Fail 0.0300 25 28062 112248 Fail 0.0304 22 27463 124831 Fail 0.0308 17 26928 158400 Fail 0.0312 15 26330 175533 Fail 0.0316 11 25859 235081 Fail 0.0320 9 25389 282100 Fail 0.0324 8 24918 311475 Fail 0.0328 8 24469 305862 Fail 0.0332 8 24020 300250 Fail 0.0336 7 23592 337028 Fail 0.0340 7 23185 331214 Fail 0.0344 7 22800 325714 Fail 0.0347 7 22437 320528 Fail 0.0351 7 22073 315328 Fail 0.0355 7 21710 310142 Fail 0.0359 7 21355 305071 Fail 0.0363 6 20991 349850 Fail 0.0367 5 20647 412940 Fail 0.0371 5 20326 406520 Fail 0.0375 5 19975 399500 Fail 0.0379 4 19671 491775 Fail 0.0383 4 19340 483500 Fail 0.0387 4 18983 474575 Fail 0.0391 4 18640 466000 Fail 0.0395 4 18294 457350 Fail 0.0399 4 17909 447725 Fail 0.0403 4 17458 436450 Fail 0.0407 4 16852 421300 Fail 0.0411 4 15385 384625 Fail 0.0415 4 12688 317200 Fail 0.0419 3 10549 351633 Fail 0.0423 3 8994 299800 Fail 0.0427 3 7743 258100 Fail 0.0431 3 6750 225000 Fail 0.0435 2 5929 296450 Fail 0.0439 2 5217 260850 Fail 0.0443 2 4584 229200 Fail 0.0447 2 4096 204800 Fail 0.0451 2 3720 186000 Fail 0.0455 2 3367 168350 Fail 0.0459 2 3031 151550 Fail 0.0463 1 2731 273100 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 16 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0515 acre-feet On-line facility target flow:0.0435 cfs. Adjusted for 15 min:0.0435 cfs. Off-line facility target flow:0.0303 cfs. Adjusted for 15 min:0.0303 cfs. FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:02 PM Page 17 LID Report FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:43 PM Page 18 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:43 PM Page 19 Appendix Predeveloped Schematic FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:45 PM Page 20 Mitigated Schematic FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 21 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #3.wdm MESSU 25 PreFUPC LARGE LOT_BF SWALE #3.MES 27 PreFUPC LARGE LOT_BF SWALE #3.L61 28 PreFUPC LARGE LOT_BF SWALE #3.L62 30 POCFUPC LARGE LOT_BF SWALE #31.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 22 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 23 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 10 0.35 COPY 501 12 PERLND 10 0.35 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 24 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 25 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #3.wdm MESSU 25 MitFUPC LARGE LOT_BF SWALE #3.MES 27 MitFUPC LARGE LOT_BF SWALE #3.L61 28 MitFUPC LARGE LOT_BF SWALE #3.L62 30 POCFUPC LARGE LOT_BF SWALE #31.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 GENER 2 RCHRES 1 RCHRES 2 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Surface LTN SWALE #3 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** 2 24 END OPCODE PARM # # K *** 2 0. END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 26 PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 27 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.03 RCHRES 1 2 PERLND 16 0.03 RCHRES 1 3 IMPLND 11 0.32 RCHRES 1 5 ******Routing****** PERLND 16 0.03 COPY 1 12 IMPLND 11 0.32 COPY 1 15 PERLND 16 0.03 COPY 1 13 RCHRES 1 1 RCHRES 2 8 RCHRES 2 1 COPY 501 16 RCHRES 1 1 COPY 501 17 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 GENER 2 OUTPUT TIMSER .0011111 RCHRES 1 EXTNL OUTDGT 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Surface LTN SWAL-006 3 1 1 1 28 0 1 2 BIOFILTN SWALE #-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 2 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 28 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 5 6 0 0 0 1 0 0 0 2 1 2 2 2 2 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.01 0.0 0.0 0.0 0.0 2 2 0.04 0.0 0.0 0.0 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 5.0 6.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS *** User-Defined Variable Quantity Lines *** addr *** <------> *** kwd varnam optyp opn vari s1 s2 s3 tp multiply lc ls ac as agfn *** <****> <----> <----> <-> <----><-><-><-><-><--------> <><-> <><-> <--> *** UVQUAN vol2 RCHRES 2 VOL 4 UVQUAN v2m2 GLOBAL WORKSP 1 3 UVQUAN vpo2 GLOBAL WORKSP 2 3 UVQUAN v2d2 GENER 2 K 1 3 *** User-Defined Target Variable Names *** addr or addr or *** <------> <------> *** kwd varnam ct vari s1 s2 s3 frac oper vari s1 s2 s3 frac oper <****> <----><-> <----><-><-><-> <---> <--> <----><-><-><-> <---> <--> UVNAME v2m2 1 WORKSP 1 1.0 QUAN UVNAME vpo2 1 WORKSP 2 1.0 QUAN UVNAME v2d2 1 K 1 1.0 QUAN *** opt foplop dcdts yr mo dy hr mn d t vnam s1 s2 s3 ac quantity tc ts rp <****><-><--><><-><--> <> <> <> <><><> <----><-><-><-><-><--------> <> <-><-> GENER 2 v2m2 = 771.35 *** Compute remaining available pore space GENER 2 vpo2 = v2m2 GENER 2 vpo2 -= vol2 *** Check to see if VPORA goes negative; if so set VPORA = 0.0 IF (vpo2 < 0.0) THEN GENER 2 vpo2 = 0.0 END IF *** Infiltration volume GENER 2 v2d2 = vpo2 END SPEC-ACTIONS FTABLES FTABLE 2 66 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.051395 0.000000 0.000000 0.038242 0.050891 0.000127 0.000000 0.076484 0.050300 0.000259 0.000000 0.114725 0.049709 0.000396 0.000000 0.152967 0.049119 0.000537 0.000000 0.191209 0.048529 0.000684 0.000000 0.229451 0.047940 0.000835 0.000000 0.267692 0.047351 0.000972 0.000000 0.305934 0.046764 0.001113 0.000000 0.344176 0.046176 0.001258 0.000000 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 29 0.382418 0.045590 0.001407 0.000000 0.420659 0.045004 0.001561 0.000000 0.458901 0.044418 0.001719 0.000000 0.497143 0.043834 0.001881 0.000000 0.535385 0.043249 0.002048 0.000000 0.573626 0.042666 0.002219 0.000000 0.611868 0.042083 0.002394 0.000000 0.650110 0.041500 0.002573 0.000000 0.688352 0.040919 0.002757 0.000000 0.726593 0.040337 0.002945 0.000000 0.764835 0.039757 0.003138 0.000000 0.803077 0.039177 0.003334 0.000000 0.841319 0.038597 0.003535 0.000000 0.879560 0.038019 0.003741 0.000000 0.917802 0.037441 0.003950 0.000000 0.956044 0.036863 0.004165 0.000000 0.994286 0.036286 0.004383 0.000000 1.032527 0.035710 0.004606 0.000000 1.070769 0.035134 0.004833 0.000000 1.109011 0.034559 0.005064 0.000000 1.147253 0.033984 0.005300 0.000000 1.185495 0.033410 0.005540 0.000000 1.223736 0.032837 0.005785 0.000000 1.261978 0.032264 0.006034 0.000000 1.300220 0.031692 0.006287 0.000000 1.338462 0.031121 0.006545 0.000000 1.376703 0.030550 0.006807 0.000000 1.414945 0.029979 0.007074 0.000000 1.453187 0.029410 0.007345 0.000000 1.491429 0.028841 0.007620 0.000000 1.529670 0.028272 0.007910 0.000000 1.567912 0.027704 0.008205 0.000000 1.606154 0.027137 0.008504 0.000000 1.644396 0.026570 0.008808 0.000000 1.682637 0.026004 0.009117 0.000000 1.720879 0.025439 0.009430 0.000000 1.759121 0.024874 0.009748 0.000000 1.797363 0.024310 0.010070 0.000000 1.835604 0.023746 0.010397 0.000000 1.873846 0.023183 0.010729 0.000000 1.912088 0.022620 0.011065 0.000000 1.950330 0.022059 0.011406 0.000000 1.988571 0.021497 0.011751 0.000000 2.026813 0.020937 0.012102 0.000000 2.065055 0.020377 0.012456 0.053335 2.103297 0.019817 0.012816 0.053335 2.141538 0.019258 0.013180 0.053335 2.179780 0.018700 0.013549 0.053335 2.218022 0.018143 0.013922 0.053335 2.256264 0.017586 0.014300 0.053335 2.294505 0.017029 0.014683 0.053335 2.332747 0.016473 0.015070 0.053335 2.370989 0.015918 0.015462 0.053335 2.409231 0.015364 0.015859 0.053335 2.447473 0.014810 0.016261 0.053335 2.480000 0.014256 0.017708 0.053335 END FTABLE 2 FTABLE 1 28 6 Depth Area Volume Outflow1 Outflow2 Outflow3 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (cfs) (cfs) (ft/sec) (Minutes)*** 0.000000 0.014256 0.000000 0.000000 0.000000 0.000000 0.038242 0.051987 0.001977 0.000000 0.041021 0.000000 0.076484 0.052580 0.003976 0.000000 0.042041 0.000000 0.114725 0.053174 0.005998 0.000000 0.043060 0.000000 0.152967 0.053769 0.008043 0.000000 0.044080 0.000000 0.191209 0.054364 0.010111 0.000000 0.045100 0.000000 0.229451 0.054959 0.012201 0.000000 0.046120 0.000000 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 30 0.267692 0.055555 0.014314 0.000000 0.047140 0.000000 0.305934 0.056152 0.016450 0.000000 0.048159 0.000000 0.344176 0.056750 0.018609 0.000000 0.049179 0.000000 0.382418 0.057348 0.020791 0.000000 0.050199 0.000000 0.420659 0.057946 0.022995 0.000000 0.051219 0.000000 0.458901 0.058545 0.025223 0.000000 0.052239 0.000000 0.497143 0.059145 0.027473 0.000000 0.053258 0.000000 0.535385 0.059746 0.029746 0.070583 0.054278 0.000000 0.573626 0.060347 0.032042 0.211385 0.055298 0.000000 0.611868 0.060948 0.034362 0.393769 0.056318 0.000000 0.650110 0.061551 0.036704 0.605426 0.057338 0.000000 0.688352 0.062154 0.039069 0.835568 0.058358 0.000000 0.726593 0.062757 0.041458 1.073217 0.059377 0.000000 0.764835 0.063361 0.043869 1.307158 0.060397 0.000000 0.803077 0.063966 0.046304 1.526548 0.061417 0.000000 0.841319 0.064571 0.048762 1.721874 0.062437 0.000000 0.879560 0.065177 0.051242 1.886178 0.063457 0.000000 0.917802 0.065783 0.053747 2.016471 0.064476 0.000000 0.956044 0.066390 0.056274 2.115324 0.065496 0.000000 0.994286 0.066998 0.058824 2.192604 0.066516 0.000000 1.000000 0.067089 0.059207 2.298426 0.066668 0.000000 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP WDM 2 PREC ENGL 1.167 RCHRES 1 EXTNL PREC WDM 1 EVAP ENGL 0.5 RCHRES 1 EXTNL POTEV WDM 1 EVAP ENGL 0.76 RCHRES 2 EXTNL POTEV END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 2 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 2 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1004 STAG ENGL REPL RCHRES 1 HYDR O 1 1 1 WDM 1005 FLOW ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 8 RCHRES OFLOW OVOL 2 RCHRES INFLOW IVOL END MASS-LINK 8 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 31 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 MASS-LINK 17 RCHRES OFLOW OVOL 1 COPY INPUT MEAN END MASS-LINK 17 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 32 Predeveloped HSPF Message File FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 33 Mitigated HSPF Message File FUPC LARGE LOT_BF SWALE #3 12/2/2019 7:09:46 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2019; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com WWHM2012 PROJECT REPORT FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_BF SWALE #4 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:12/2/2019 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:1.167 Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, 0.4 Pervious Total 0.4 Impervious Land Use acre Impervious Total 0 Basin Total 0.4 Element Flows To: Surface Interflow Groundwater Flat FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 4 Mitigated Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.21 Pervious Total 0.21 Impervious Land Use acre PARKING FLAT 0.19 Impervious Total 0.19 Basin Total 0.4 Element Flows To: Surface Interflow Groundwater Surface LTN SWALE #4Surface LTN SWALE #4 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 6 Mitigated Routing BIOFILTN SWALE #4 Bottom Length: 114.00 ft. Bottom Width: 3.00 ft. Material thickness of first layer: 0.25 Material type for first layer: SMMWW 12 in/hr Material thickness of second layer: 1.06 Material type for second layer: Sand Material thickness of third layer: 1 Material type for third layer: GRAVEL Underdrain used Underdrain Diameter (feet):0.5 Orifice Diameter (in.):6 Offset (in.):6 Flow Through Underdrain (ac-ft.):59.56 Total Outflow (ac-ft.):60.134 Percent Through Underdrain:99.04 Discharge Structure Riser Height:0.5 ft. Riser Diameter:12 in. Element Flows To: Outlet 1 Outlet 2 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.0419 0.0000 0.0000 0.0000 0.0364 0.0416 0.0001 0.0000 0.0000 0.0727 0.0411 0.0001 0.0000 0.0000 0.1091 0.0405 0.0002 0.0000 0.0000 0.1455 0.0399 0.0003 0.0000 0.0000 0.1819 0.0393 0.0004 0.0000 0.0000 0.2182 0.0387 0.0005 0.0000 0.0000 0.2546 0.0382 0.0005 0.0000 0.0000 0.2910 0.0376 0.0006 0.0000 0.0000 0.3274 0.0370 0.0007 0.0000 0.0000 0.3637 0.0364 0.0008 0.0000 0.0000 0.4001 0.0359 0.0009 0.0000 0.0000 0.4365 0.0353 0.0010 0.0000 0.0000 0.4729 0.0347 0.0011 0.0000 0.0000 0.5092 0.0342 0.0012 0.0000 0.0000 0.5456 0.0336 0.0013 0.0000 0.0000 0.5820 0.0330 0.0014 0.0000 0.0000 0.6184 0.0325 0.0016 0.0000 0.0000 0.6547 0.0319 0.0017 0.0000 0.0000 0.6911 0.0314 0.0018 0.0000 0.0000 0.7275 0.0308 0.0019 0.0000 0.0000 0.7638 0.0303 0.0021 0.0000 0.0000 0.8002 0.0297 0.0022 0.0000 0.0000 0.8366 0.0292 0.0023 0.0000 0.0000 0.8730 0.0286 0.0025 0.0000 0.0000 0.9093 0.0281 0.0026 0.0000 0.0000 0.9457 0.0275 0.0028 0.0000 0.0000 0.9821 0.0270 0.0029 0.0000 0.0000 1.0185 0.0264 0.0031 0.0000 0.0000 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 7 1.0548 0.0259 0.0033 0.0000 0.0000 1.0912 0.0253 0.0034 0.0000 0.0000 1.1276 0.0248 0.0036 0.0000 0.0000 1.1640 0.0243 0.0038 0.0000 0.0000 1.2003 0.0237 0.0039 0.0000 0.0000 1.2367 0.0232 0.0041 0.0000 0.0000 1.2731 0.0227 0.0043 0.0000 0.0000 1.3095 0.0221 0.0045 0.0000 0.0000 1.3458 0.0216 0.0047 0.0000 0.0000 1.3822 0.0211 0.0049 0.0000 0.0000 1.4186 0.0205 0.0051 0.0000 0.0000 1.4549 0.0200 0.0053 0.0000 0.0000 1.4913 0.0195 0.0056 0.0000 0.0000 1.5277 0.0190 0.0058 0.0000 0.0000 1.5641 0.0184 0.0060 0.0000 0.0000 1.6004 0.0179 0.0062 0.0000 0.0000 1.6368 0.0174 0.0065 0.0000 0.0000 1.6732 0.0169 0.0067 0.0000 0.0000 1.7096 0.0164 0.0069 0.0000 0.0000 1.7459 0.0159 0.0072 0.0000 0.0000 1.7823 0.0153 0.0074 0.0000 0.0000 1.8187 0.0148 0.0077 0.0000 0.0000 1.8551 0.0143 0.0080 0.0313 0.0000 1.8914 0.0138 0.0082 0.0313 0.0000 1.9278 0.0133 0.0085 0.0313 0.0000 1.9642 0.0128 0.0088 0.0313 0.0000 2.0005 0.0123 0.0090 0.0313 0.0000 2.0369 0.0118 0.0093 0.0313 0.0000 2.0733 0.0113 0.0096 0.0313 0.0000 2.1097 0.0108 0.0099 0.0313 0.0000 2.1460 0.0103 0.0102 0.0313 0.0000 2.1824 0.0098 0.0105 0.0313 0.0000 2.2188 0.0093 0.0108 0.0313 0.0000 2.2552 0.0088 0.0111 0.0313 0.0000 2.2915 0.0083 0.0114 0.0313 0.0000 2.3100 0.0079 0.0116 0.0313 0.0000 Bioretention Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)To Amended(cfs)Infilt(cfs) 2.3100 0.0419 0.0116 0.0000 0.0233 0.0000 2.3464 0.0425 0.0131 0.0000 0.0233 0.0000 2.3827 0.0431 0.0147 0.0000 0.0239 0.0000 2.4191 0.0437 0.0163 0.0000 0.0246 0.0000 2.4555 0.0443 0.0179 0.0000 0.0252 0.0000 2.4919 0.0449 0.0195 0.0000 0.0258 0.0000 2.5282 0.0455 0.0211 0.0000 0.0265 0.0000 2.5646 0.0461 0.0228 0.0000 0.0271 0.0000 2.6010 0.0467 0.0245 0.0000 0.0277 0.0000 2.6374 0.0473 0.0262 0.0000 0.0284 0.0000 2.6737 0.0479 0.0279 0.0000 0.0290 0.0000 2.7101 0.0485 0.0297 0.0000 0.0296 0.0000 2.7465 0.0491 0.0314 0.0000 0.0302 0.0000 2.7829 0.0497 0.0332 0.0000 0.0309 0.0000 2.8192 0.0503 0.0350 0.0094 0.0315 0.0000 2.8556 0.0509 0.0369 0.1032 0.0321 0.0000 2.8920 0.0515 0.0387 0.2482 0.0328 0.0000 2.9284 0.0521 0.0406 0.4279 0.0334 0.0000 2.9647 0.0527 0.0425 0.6324 0.0340 0.0000 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 8 3.0011 0.0533 0.0445 0.8525 0.0347 0.0000 3.0375 0.0539 0.0464 1.0787 0.0353 0.0000 3.0738 0.0546 0.0484 1.3012 0.0359 0.0000 3.1102 0.0552 0.0504 1.5109 0.0365 0.0000 3.1466 0.0558 0.0524 1.6993 0.0372 0.0000 3.1830 0.0564 0.0544 1.8603 0.0378 0.0000 3.2193 0.0570 0.0565 1.9905 0.0384 0.0000 3.2557 0.0577 0.0586 2.0913 0.0391 0.0000 3.2921 0.0583 0.0607 2.1693 0.0397 0.0000 3.3100 0.0586 0.0617 2.2679 0.0400 0.0000 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 9 Surface LTN SWALE #4 Element Flows To: Outlet 1 Outlet 2 BIOFILTN SWALE #4 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:06 PM Page 10 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.4 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.21 Total Impervious Area:0.19 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.00364 5 year 0.005885 10 year 0.0074 25 year 0.009296 50 year 0.01068 100 year 0.012032 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.009427 5 year 0.015888 10 year 0.021724 25 year 0.031297 50 year 0.040331 100 year 0.051283 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.004 0.008 1950 0.008 0.007 1951 0.008 0.018 1952 0.003 0.006 1953 0.002 0.007 1954 0.003 0.007 1955 0.005 0.016 1956 0.004 0.007 1957 0.004 0.009 1958 0.004 0.008 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 11 1959 0.003 0.007 1960 0.006 0.018 1961 0.003 0.007 1962 0.002 0.006 1963 0.003 0.007 1964 0.003 0.007 1965 0.003 0.007 1966 0.003 0.007 1967 0.005 0.011 1968 0.003 0.007 1969 0.003 0.007 1970 0.003 0.007 1971 0.003 0.007 1972 0.007 0.016 1973 0.003 0.007 1974 0.003 0.006 1975 0.005 0.015 1976 0.003 0.007 1977 0.001 0.006 1978 0.003 0.007 1979 0.002 0.006 1980 0.004 0.011 1981 0.002 0.007 1982 0.006 0.033 1983 0.004 0.007 1984 0.002 0.007 1985 0.001 0.007 1986 0.006 0.023 1987 0.006 0.022 1988 0.002 0.007 1989 0.001 0.006 1990 0.009 0.036 1991 0.008 0.029 1992 0.003 0.007 1993 0.003 0.007 1994 0.001 0.006 1995 0.004 0.007 1996 0.008 0.025 1997 0.007 0.019 1998 0.002 0.007 1999 0.005 0.017 2000 0.003 0.007 2001 0.001 0.006 2002 0.004 0.021 2003 0.003 0.007 2004 0.008 0.043 2005 0.004 0.012 2006 0.005 0.007 2007 0.014 0.032 2008 0.010 0.034 2009 0.005 0.016 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0136 0.0432 2 0.0102 0.0358 3 0.0091 0.0335 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 12 4 0.0084 0.0330 5 0.0079 0.0321 6 0.0076 0.0294 7 0.0075 0.0253 8 0.0075 0.0233 9 0.0072 0.0225 10 0.0066 0.0213 11 0.0063 0.0186 12 0.0059 0.0183 13 0.0059 0.0180 14 0.0058 0.0173 15 0.0054 0.0164 16 0.0052 0.0161 17 0.0051 0.0156 18 0.0049 0.0148 19 0.0047 0.0120 20 0.0046 0.0111 21 0.0045 0.0110 22 0.0043 0.0090 23 0.0039 0.0076 24 0.0039 0.0075 25 0.0039 0.0075 26 0.0039 0.0075 27 0.0038 0.0074 28 0.0038 0.0074 29 0.0036 0.0074 30 0.0032 0.0073 31 0.0032 0.0073 32 0.0031 0.0072 33 0.0031 0.0071 34 0.0031 0.0071 35 0.0030 0.0070 36 0.0030 0.0070 37 0.0030 0.0070 38 0.0029 0.0069 39 0.0029 0.0069 40 0.0029 0.0068 41 0.0028 0.0068 42 0.0028 0.0068 43 0.0028 0.0068 44 0.0028 0.0068 45 0.0028 0.0067 46 0.0028 0.0067 47 0.0026 0.0067 48 0.0026 0.0067 49 0.0025 0.0067 50 0.0025 0.0066 51 0.0024 0.0066 52 0.0023 0.0066 53 0.0021 0.0065 54 0.0019 0.0065 55 0.0019 0.0065 56 0.0016 0.0064 57 0.0014 0.0064 58 0.0014 0.0064 59 0.0010 0.0063 60 0.0006 0.0063 61 0.0006 0.0062 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 13 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 14 Duration Flows Flow(cfs)Predev Mit Percentage Pass/Fail 0.0018 18121 112141 618 Fail 0.0019 16260 106944 657 Fail 0.0020 14775 102260 692 Fail 0.0021 13424 97533 726 Fail 0.0022 12048 93512 776 Fail 0.0023 10951 89555 817 Fail 0.0024 10040 85748 854 Fail 0.0024 9157 82069 896 Fail 0.0025 8367 78925 943 Fail 0.0026 7621 75845 995 Fail 0.0027 6964 73021 1048 Fail 0.0028 6391 69920 1094 Fail 0.0029 5916 67503 1141 Fail 0.0030 5439 64958 1194 Fail 0.0031 5052 62840 1243 Fail 0.0032 4656 60680 1303 Fail 0.0033 4321 58498 1353 Fail 0.0033 3991 56488 1415 Fail 0.0034 3715 54670 1471 Fail 0.0035 3412 52895 1550 Fail 0.0036 3163 51119 1616 Fail 0.0037 2941 49472 1682 Fail 0.0038 2757 47975 1740 Fail 0.0039 2532 46414 1833 Fail 0.0040 2340 44959 1921 Fail 0.0041 2156 43697 2026 Fail 0.0041 2036 42478 2086 Fail 0.0042 1912 41366 2163 Fail 0.0043 1796 40168 2236 Fail 0.0044 1672 39035 2334 Fail 0.0045 1528 37922 2481 Fail 0.0046 1396 37024 2652 Fail 0.0047 1304 36062 2765 Fail 0.0048 1216 35185 2893 Fail 0.0049 1152 34286 2976 Fail 0.0050 1080 33388 3091 Fail 0.0050 1032 32682 3166 Fail 0.0051 968 31805 3285 Fail 0.0052 924 31078 3363 Fail 0.0053 876 30436 3474 Fail 0.0054 828 29752 3593 Fail 0.0055 768 29067 3784 Fail 0.0056 700 28105 4015 Fail 0.0057 648 26950 4158 Fail 0.0058 608 25602 4210 Fail 0.0058 560 23271 4155 Fail 0.0059 512 18963 3703 Fail 0.0060 452 15721 3478 Fail 0.0061 420 13096 3118 Fail 0.0062 372 11236 3020 Fail 0.0063 356 9681 2719 Fail 0.0064 320 8468 2646 Fail 0.0065 304 7593 2497 Fail 0.0066 260 6675 2567 Fail FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 15 0.0067 248 5935 2393 Fail 0.0067 220 5227 2375 Fail 0.0068 204 4592 2250 Fail 0.0069 192 4124 2147 Fail 0.0070 168 3645 2169 Fail 0.0071 160 3268 2042 Fail 0.0072 148 2864 1935 Fail 0.0073 136 2515 1849 Fail 0.0074 132 2235 1693 Fail 0.0075 108 1912 1770 Fail 0.0075 88 1696 1927 Fail 0.0076 76 1516 1994 Fail 0.0077 76 1380 1815 Fail 0.0078 64 1348 2106 Fail 0.0079 64 1196 1868 Fail 0.0080 56 1160 2071 Fail 0.0081 52 1148 2207 Fail 0.0082 52 1128 2169 Fail 0.0083 44 1100 2500 Fail 0.0084 36 1080 3000 Fail 0.0084 28 1060 3785 Fail 0.0085 28 1028 3671 Fail 0.0086 20 1016 5080 Fail 0.0087 20 992 4960 Fail 0.0088 20 980 4900 Fail 0.0089 20 952 4760 Fail 0.0090 20 940 4700 Fail 0.0091 16 920 5750 Fail 0.0092 12 896 7466 Fail 0.0092 8 888 11100 Fail 0.0093 8 840 10500 Fail 0.0094 8 824 10300 Fail 0.0095 8 792 9900 Fail 0.0096 8 772 9650 Fail 0.0097 8 748 9350 Fail 0.0098 8 744 9300 Fail 0.0099 8 716 8950 Fail 0.0100 8 688 8600 Fail 0.0101 8 680 8500 Fail 0.0101 8 660 8250 Fail 0.0102 4 648 16200 Fail 0.0103 4 640 16000 Fail 0.0104 4 628 15700 Fail 0.0105 4 624 15600 Fail 0.0106 4 612 15300 Fail 0.0107 4 604 15100 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 16 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.04 acre-feet On-line facility target flow:0.0255 cfs. Adjusted for 15 min:0.0271 cfs. Off-line facility target flow:0.0176 cfs. Adjusted for 15 min:0.0187 cfs. FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:23 PM Page 17 LID Report FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:37 PM Page 18 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:37 PM Page 19 Appendix Predeveloped Schematic FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:38 PM Page 20 Mitigated Schematic FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 21 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #4.wdm MESSU 25 PreFUPC LARGE LOT_BF SWALE #4.MES 27 PreFUPC LARGE LOT_BF SWALE #4.L61 28 PreFUPC LARGE LOT_BF SWALE #4.L62 30 POCFUPC LARGE LOT_BF SWALE #41.dat END FILES OPN SEQUENCE INGRP INDELT 00:60 PERLND 11 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 C, Forest, Mod 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 11 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 11 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 22 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 11 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 11 0 4.5 0.08 400 0.1 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 11 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 11 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 11 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 23 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 11 0.4 COPY 501 12 PERLND 11 0.4 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 12.1 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 SUM PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 SUM IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 24 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 12.1 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 25 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_BF SWALE #4.wdm MESSU 25 MitFUPC LARGE LOT_BF SWALE #4.MES 27 MitFUPC LARGE LOT_BF SWALE #4.L61 28 MitFUPC LARGE LOT_BF SWALE #4.L62 30 POCFUPC LARGE LOT_BF SWALE #41.dat END FILES OPN SEQUENCE INGRP INDELT 00:60 PERLND 16 IMPLND 11 GENER 2 RCHRES 1 RCHRES 2 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Surface LTN SWALE #4 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** 2 24 END OPCODE PARM # # K *** 2 0. END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 26 PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 27 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.21 RCHRES 1 2 PERLND 16 0.21 RCHRES 1 3 IMPLND 11 0.19 RCHRES 1 5 ******Routing****** PERLND 16 0.21 COPY 1 12 IMPLND 11 0.19 COPY 1 15 PERLND 16 0.21 COPY 1 13 RCHRES 1 1 RCHRES 2 8 RCHRES 2 1 COPY 501 16 RCHRES 1 1 COPY 501 17 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 12.1 DISPLY 1 INPUT TIMSER 1 GENER 2 OUTPUT TIMSER .0002778 RCHRES 1 EXTNL OUTDGT 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Surface LTN SWAL-006 3 1 1 1 28 0 1 2 BIOFILTN SWALE #-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 2 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 28 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 5 6 0 0 0 1 0 0 0 2 1 2 2 2 2 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.01 0.0 0.0 0.0 0.0 2 2 0.02 0.0 0.0 0.0 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 5.0 6.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS *** User-Defined Variable Quantity Lines *** addr *** <------> *** kwd varnam optyp opn vari s1 s2 s3 tp multiply lc ls ac as agfn *** <****> <----> <----> <-> <----><-><-><-><-><--------> <><-> <><-> <--> *** UVQUAN vol2 RCHRES 2 VOL 4 UVQUAN v2m2 GLOBAL WORKSP 1 3 UVQUAN vpo2 GLOBAL WORKSP 2 3 UVQUAN v2d2 GENER 2 K 1 3 *** User-Defined Target Variable Names *** addr or addr or *** <------> <------> *** kwd varnam ct vari s1 s2 s3 frac oper vari s1 s2 s3 frac oper <****> <----><-> <----><-><-><-> <---> <--> <----><-><-><-> <---> <--> UVNAME v2m2 1 WORKSP 1 1.0 QUAN UVNAME vpo2 1 WORKSP 2 1.0 QUAN UVNAME v2d2 1 K 1 1.0 QUAN *** opt foplop dcdts yr mo dy hr mn d t vnam s1 s2 s3 ac quantity tc ts rp <****><-><--><><-><--> <> <> <> <><><> <----><-><-><-><-><--------> <> <-><-> GENER 2 v2m2 = 617.24 *** Compute remaining available pore space GENER 2 vpo2 = v2m2 GENER 2 vpo2 -= vol2 *** Check to see if VPORA goes negative; if so set VPORA = 0.0 IF (vpo2 < 0.0) THEN GENER 2 vpo2 = 0.0 END IF *** Infiltration volume GENER 2 v2d2 = vpo2 END SPEC-ACTIONS FTABLES FTABLE 2 65 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.041936 0.000000 0.000000 0.036374 0.041640 0.000067 0.000000 0.072747 0.041056 0.000139 0.000000 0.109121 0.040474 0.000214 0.000000 0.145495 0.039894 0.000294 0.000000 0.181868 0.039315 0.000378 0.000000 0.218242 0.038738 0.000465 0.000000 0.254615 0.038162 0.000546 0.000000 0.290989 0.037588 0.000630 0.000000 0.327363 0.037015 0.000718 0.000000 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 29 0.363736 0.036444 0.000809 0.000000 0.400110 0.035874 0.000904 0.000000 0.436484 0.035306 0.001003 0.000000 0.472857 0.034739 0.001105 0.000000 0.509231 0.034174 0.001211 0.000000 0.545604 0.033610 0.001321 0.000000 0.581978 0.033048 0.001435 0.000000 0.618352 0.032488 0.001552 0.000000 0.654725 0.031928 0.001673 0.000000 0.691099 0.031371 0.001798 0.000000 0.727473 0.030815 0.001926 0.000000 0.763846 0.030260 0.002058 0.000000 0.800220 0.029707 0.002194 0.000000 0.836593 0.029156 0.002334 0.000000 0.872967 0.028606 0.002478 0.000000 0.909341 0.028057 0.002626 0.000000 0.945714 0.027510 0.002777 0.000000 0.982088 0.026965 0.002932 0.000000 1.018462 0.026421 0.003091 0.000000 1.054835 0.025879 0.003254 0.000000 1.091209 0.025338 0.003421 0.000000 1.127582 0.024798 0.003591 0.000000 1.163956 0.024260 0.003766 0.000000 1.200330 0.023724 0.003944 0.000000 1.236703 0.023189 0.004127 0.000000 1.273077 0.022656 0.004313 0.000000 1.309451 0.022124 0.004503 0.000000 1.345824 0.021594 0.004705 0.000000 1.382198 0.021065 0.004910 0.000000 1.418571 0.020538 0.005120 0.000000 1.454945 0.020012 0.005334 0.000000 1.491319 0.019488 0.005552 0.000000 1.527692 0.018966 0.005774 0.000000 1.564066 0.018444 0.006000 0.000000 1.600440 0.017925 0.006231 0.000000 1.636813 0.017407 0.006465 0.000000 1.673187 0.016890 0.006704 0.000000 1.709560 0.016375 0.006947 0.000000 1.745934 0.015861 0.007195 0.000000 1.782308 0.015349 0.007446 0.000000 1.818681 0.014839 0.007702 0.000000 1.855055 0.014330 0.007962 0.031347 1.891429 0.013822 0.008226 0.031347 1.927802 0.013316 0.008495 0.031347 1.964176 0.012812 0.008768 0.031347 2.000549 0.012309 0.009045 0.031347 2.036923 0.011808 0.009327 0.031347 2.073297 0.011308 0.009612 0.031347 2.109670 0.010810 0.009903 0.031347 2.146044 0.010313 0.010197 0.031347 2.182418 0.009817 0.010496 0.031347 2.218791 0.009324 0.010799 0.031347 2.255165 0.008831 0.011107 0.031347 2.291538 0.008340 0.011419 0.031347 2.310000 0.007851 0.014170 0.031347 END FTABLE 2 FTABLE 1 29 6 Depth Area Volume Outflow1 Outflow2 Outflow3 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (cfs) (cfs) (ft/sec) (Minutes)*** 0.000000 0.007851 0.000000 0.000000 0.000000 0.000000 0.036374 0.042522 0.001536 0.000000 0.023318 0.000000 0.072747 0.043109 0.003093 0.000000 0.023948 0.000000 0.109121 0.043698 0.004672 0.000000 0.024578 0.000000 0.145495 0.044288 0.006272 0.000000 0.025207 0.000000 0.181868 0.044880 0.007894 0.000000 0.025837 0.000000 0.218242 0.045473 0.009537 0.000000 0.026467 0.000000 0.254615 0.046068 0.011202 0.000000 0.027097 0.000000 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 30 0.290989 0.046665 0.012889 0.000000 0.027727 0.000000 0.327363 0.047262 0.014597 0.000000 0.028357 0.000000 0.363736 0.047862 0.016327 0.000000 0.028987 0.000000 0.400110 0.048463 0.018079 0.000000 0.029617 0.000000 0.436484 0.049065 0.019852 0.000000 0.030247 0.000000 0.472857 0.049669 0.021648 0.000000 0.030877 0.000000 0.509231 0.050274 0.023466 0.009415 0.031507 0.000000 0.545604 0.050881 0.025305 0.103229 0.032137 0.000000 0.581978 0.051490 0.027167 0.248150 0.032767 0.000000 0.618352 0.052100 0.029051 0.427892 0.033397 0.000000 0.654725 0.052711 0.030957 0.632435 0.034027 0.000000 0.691099 0.053324 0.032886 0.852524 0.034657 0.000000 0.727473 0.053939 0.034837 1.078679 0.035287 0.000000 0.763846 0.054555 0.036810 1.301247 0.035917 0.000000 0.800220 0.055173 0.038805 1.510882 0.036547 0.000000 0.836593 0.055792 0.040823 1.699309 0.037176 0.000000 0.872967 0.056412 0.042864 1.860255 0.037806 0.000000 0.909341 0.057034 0.044927 1.990542 0.038436 0.000000 0.945714 0.057658 0.047013 2.091310 0.039066 0.000000 0.982088 0.058283 0.049122 2.169344 0.039696 0.000000 1.000000 0.058592 0.050169 2.267868 0.040006 0.000000 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 SUM PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 SUM IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP WDM 2 PREC ENGL 1.167 SUM RCHRES 1 EXTNL PREC WDM 1 EVAP ENGL 0.5 RCHRES 1 EXTNL POTEV WDM 1 EVAP ENGL 0.76 RCHRES 2 EXTNL POTEV END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 2 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 2 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1004 STAG ENGL REPL RCHRES 1 HYDR O 1 1 1 WDM 1005 FLOW ENGL REPL COPY 1 OUTPUT MEAN 1 1 12.1 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 12.1 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 8 RCHRES OFLOW OVOL 2 RCHRES INFLOW IVOL END MASS-LINK 8 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 31 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 MASS-LINK 17 RCHRES OFLOW OVOL 1 COPY INPUT MEAN END MASS-LINK 17 END MASS-LINK END RUN FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 32 Predeveloped HSPF Message File FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 33 Mitigated HSPF Message File FUPC LARGE LOT_BF SWALE #4 12/2/2019 6:26:40 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2019; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com Date: Project Name: City / County: State: Designed By: Company: Telephone: Storage Volume Required (cf):10,934 Limiting Width (ft):33.00 4.38 Solid or Perforated Pipe:Perforated Shape Or Diameter (in):35x24 4.50 ft2 Pipe Area Number Of Headers:1 Spacing between Barrels (ft):1.25 Stone Width Around Perimeter of System (ft):0.625 Depth A: Porous Stone Above Pipe (in):10.68 Depth C: Porous Stone Below Pipe (in):0 Stone Porosity (0 to 40%):40 System Sizing Pipe Storage:6,583 cf Porous Stone Storage:4,420 cf 11,003 cf 100.6%Of Required Storage Barrel 12 7 barrels Barrel 11 Length per Barrel:205.0 ft Barrel 10 Length Per Header:27.9 ft Barrel 9 Rectangular Footprint (W x L):29.17 ft x 209.17 ft Barrel 8 CONTECH Materials Barrel 7 Total CMP Footage:1,463 ft Barrel 6 Approximate Total Pieces:79 pcs Barrel 5 Approximate Coupling Bands:78 bands Barrel 4 Approximate Truckloads:5 trucks Barrel 3 Construction Quantities**Barrel 2 Total Excavation:990 cy Barrel 1 Porous Stone Backfill For Storage:409 cy stone Backfill to Grade Excluding Stone:337 cy fill **Construction quantities are approximate and should be verified upon final design Number Of Barrels Exceed Graph Limitations SP Project Summary 425462-9441 2/17/2020 Corrugated Metal Pipe Calculator Enter Information in Blue Cells FUPC SUBBASIN #1 FINAL RENTON ABOSSEIN WA Total Storage Provided: Number of Barrels: Invert Depth Below Asphalt (ft): System Layout 205 205 205 205 205 205 205 0 0 0 0 0 Barrel Footage (w/o headers) For design assistance, drawings, and pricing send completed worksheet to: dyods@contech-cpi.com © 2007 CONTECH Stormwater Solutions WWHM2012 PROJECT REPORT FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/18/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin SWALE #1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.52 Pervious Total 0.52 Impervious Land Use acre Impervious Total 0 Basin Total 0.52 Element Flows To: Surface Interflow Groundwater FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 4 Mitigated Land Use TANK DET #1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.13 Pervious Total 0.13 Impervious Land Use acre PARKING FLAT 0.39 Impervious Total 0.39 Basin Total 0.52 Element Flows To: Surface Interflow Groundwater Tank for Swale #1 Tank for Swale #1 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 6 Mitigated Routing Tank for Swale #1 Dimensions Depth:2.89 ft. Tank Type:Arched Width:4.17 ft. Height:2.89 ft. Length:1156 ft. Discharge Structure Riser Height:2.89 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.54 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Tank Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.000 0.000 0.000 0.000 0.0321 0.023 0.000 0.001 0.000 0.0642 0.032 0.001 0.002 0.000 0.0963 0.039 0.002 0.002 0.000 0.1284 0.045 0.003 0.002 0.000 0.1606 0.050 0.005 0.003 0.000 0.1927 0.055 0.007 0.003 0.000 0.2248 0.059 0.009 0.003 0.000 0.2569 0.063 0.011 0.004 0.000 0.2890 0.066 0.013 0.004 0.000 0.3211 0.069 0.015 0.004 0.000 0.3532 0.072 0.017 0.004 0.000 0.3853 0.075 0.019 0.004 0.000 0.4174 0.077 0.022 0.005 0.000 0.4496 0.080 0.024 0.005 0.000 0.4817 0.082 0.027 0.005 0.000 0.5138 0.084 0.030 0.005 0.000 0.5459 0.086 0.033 0.005 0.000 0.5780 0.088 0.035 0.006 0.000 0.6101 0.090 0.038 0.006 0.000 0.6422 0.092 0.041 0.006 0.000 0.6743 0.093 0.044 0.006 0.000 0.7064 0.095 0.047 0.006 0.000 0.7386 0.096 0.050 0.006 0.000 0.7707 0.097 0.053 0.006 0.000 0.8028 0.099 0.056 0.007 0.000 0.8349 0.100 0.060 0.007 0.000 0.8670 0.101 0.063 0.007 0.000 0.8991 0.102 0.066 0.007 0.000 0.9312 0.103 0.070 0.007 0.000 0.9633 0.104 0.073 0.007 0.000 0.9954 0.105 0.076 0.007 0.000 1.0276 0.105 0.080 0.008 0.000 1.0597 0.106 0.083 0.008 0.000 1.0918 0.107 0.086 0.008 0.000 1.1239 0.107 0.090 0.008 0.000 1.1560 0.108 0.093 0.008 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 7 1.1881 0.108 0.097 0.008 0.000 1.2202 0.109 0.100 0.008 0.000 1.2523 0.109 0.104 0.008 0.000 1.2844 0.110 0.107 0.009 0.000 1.3166 0.110 0.111 0.009 0.000 1.3487 0.110 0.114 0.009 0.000 1.3808 0.110 0.118 0.009 0.000 1.4129 0.110 0.122 0.009 0.000 1.4450 0.110 0.125 0.009 0.000 1.4771 0.110 0.129 0.009 0.000 1.5092 0.110 0.132 0.009 0.000 1.5413 0.110 0.136 0.009 0.000 1.5734 0.110 0.139 0.009 0.000 1.6056 0.110 0.143 0.010 0.000 1.6377 0.109 0.146 0.010 0.000 1.6698 0.109 0.150 0.010 0.000 1.7019 0.108 0.153 0.010 0.000 1.7340 0.108 0.157 0.010 0.000 1.7661 0.107 0.160 0.010 0.000 1.7982 0.107 0.164 0.010 0.000 1.8303 0.106 0.167 0.010 0.000 1.8624 0.105 0.171 0.010 0.000 1.8946 0.105 0.174 0.010 0.000 1.9267 0.104 0.177 0.011 0.000 1.9588 0.103 0.181 0.011 0.000 1.9909 0.102 0.184 0.011 0.000 2.0230 0.101 0.187 0.011 0.000 2.0551 0.100 0.191 0.011 0.000 2.0872 0.099 0.194 0.011 0.000 2.1193 0.097 0.197 0.011 0.000 2.1514 0.096 0.200 0.011 0.000 2.1836 0.095 0.203 0.011 0.000 2.2157 0.093 0.206 0.011 0.000 2.2478 0.092 0.209 0.011 0.000 2.2799 0.090 0.212 0.011 0.000 2.3120 0.088 0.215 0.012 0.000 2.3441 0.086 0.218 0.012 0.000 2.3762 0.084 0.221 0.012 0.000 2.4083 0.082 0.223 0.012 0.000 2.4404 0.080 0.226 0.012 0.000 2.4726 0.077 0.228 0.012 0.000 2.5047 0.075 0.231 0.012 0.000 2.5368 0.072 0.233 0.012 0.000 2.5689 0.069 0.235 0.012 0.000 2.6010 0.066 0.238 0.012 0.000 2.6331 0.063 0.240 0.012 0.000 2.6652 0.059 0.242 0.012 0.000 2.6973 0.055 0.244 0.013 0.000 2.7294 0.050 0.245 0.013 0.000 2.7616 0.045 0.247 0.013 0.000 2.7937 0.039 0.248 0.013 0.000 2.8258 0.032 0.249 0.013 0.000 2.8579 0.023 0.250 0.013 0.000 2.8900 0.000 0.251 0.013 0.000 2.9221 0.000 0.000 0.074 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:23:58 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.52 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.13 Total Impervious Area:0.39 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.018249 5 year 0.028673 10 year 0.036677 25 year 0.048056 50 year 0.057466 100 year 0.067687 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.009073 5 year 0.010187 10 year 0.01085 25 year 0.011628 50 year 0.012174 100 year 0.012695 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.025 0.008 1950 0.029 0.009 1951 0.042 0.012 1952 0.014 0.007 1953 0.012 0.009 1954 0.017 0.009 1955 0.026 0.009 1956 0.021 0.010 1957 0.019 0.009 1958 0.020 0.009 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 9 1959 0.017 0.008 1960 0.032 0.011 1961 0.016 0.010 1962 0.011 0.007 1963 0.016 0.009 1964 0.020 0.010 1965 0.015 0.010 1966 0.013 0.009 1967 0.031 0.009 1968 0.018 0.009 1969 0.017 0.009 1970 0.015 0.009 1971 0.019 0.009 1972 0.032 0.011 1973 0.015 0.010 1974 0.017 0.009 1975 0.024 0.008 1976 0.017 0.009 1977 0.006 0.008 1978 0.014 0.009 1979 0.009 0.007 1980 0.045 0.012 1981 0.013 0.009 1982 0.032 0.010 1983 0.022 0.009 1984 0.014 0.008 1985 0.008 0.008 1986 0.034 0.010 1987 0.031 0.011 1988 0.013 0.008 1989 0.008 0.008 1990 0.087 0.011 1991 0.039 0.011 1992 0.016 0.010 1993 0.016 0.008 1994 0.006 0.007 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0870 0.0123 2 0.0455 0.0120 3 0.0418 0.0113 4 0.0392 0.0112 5 0.0340 0.0112 6 0.0324 0.0109 7 0.0319 0.0107 8 0.0316 0.0105 9 0.0312 0.0104 10 0.0309 0.0104 11 0.0290 0.0103 12 0.0264 0.0098 13 0.0249 0.0098 14 0.0242 0.0096 15 0.0217 0.0095 16 0.0215 0.0095 17 0.0199 0.0094 18 0.0197 0.0093 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 10 19 0.0194 0.0092 20 0.0185 0.0091 21 0.0180 0.0091 22 0.0174 0.0091 23 0.0172 0.0091 24 0.0171 0.0091 25 0.0170 0.0089 26 0.0167 0.0089 27 0.0164 0.0089 28 0.0162 0.0088 29 0.0159 0.0088 30 0.0158 0.0087 31 0.0151 0.0087 32 0.0148 0.0087 33 0.0146 0.0085 34 0.0145 0.0085 35 0.0140 0.0084 36 0.0137 0.0082 37 0.0134 0.0081 38 0.0132 0.0081 39 0.0132 0.0081 40 0.0118 0.0080 41 0.0110 0.0077 42 0.0090 0.0077 43 0.0084 0.0074 44 0.0080 0.0074 45 0.0065 0.0071 46 0.0059 0.0071 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 11 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0091 16632 11140 66 Pass 0.0096 14557 7142 49 Pass 0.0101 12816 4455 34 Pass 0.0106 11361 2287 20 Pass 0.0111 10161 1267 12 Pass 0.0116 9168 671 7 Pass 0.0121 8147 121 1 Pass 0.0125 7229 0 0 Pass 0.0130 6410 0 0 Pass 0.0135 5750 0 0 Pass 0.0140 5150 0 0 Pass 0.0145 4599 0 0 Pass 0.0150 4127 0 0 Pass 0.0155 3745 0 0 Pass 0.0160 3375 0 0 Pass 0.0164 3091 0 0 Pass 0.0169 2836 0 0 Pass 0.0174 2611 0 0 Pass 0.0179 2379 0 0 Pass 0.0184 2179 0 0 Pass 0.0189 1980 0 0 Pass 0.0194 1818 0 0 Pass 0.0199 1674 0 0 Pass 0.0204 1541 0 0 Pass 0.0208 1410 0 0 Pass 0.0213 1302 0 0 Pass 0.0218 1217 0 0 Pass 0.0223 1125 0 0 Pass 0.0228 1035 0 0 Pass 0.0233 960 0 0 Pass 0.0238 898 0 0 Pass 0.0243 828 0 0 Pass 0.0248 754 0 0 Pass 0.0252 696 0 0 Pass 0.0257 646 0 0 Pass 0.0262 598 0 0 Pass 0.0267 559 0 0 Pass 0.0272 522 0 0 Pass 0.0277 490 0 0 Pass 0.0282 463 0 0 Pass 0.0287 425 0 0 Pass 0.0291 387 0 0 Pass 0.0296 358 0 0 Pass 0.0301 321 0 0 Pass 0.0306 290 0 0 Pass 0.0311 262 0 0 Pass 0.0316 228 0 0 Pass 0.0321 202 0 0 Pass 0.0326 178 0 0 Pass 0.0331 159 0 0 Pass 0.0335 145 0 0 Pass 0.0340 128 0 0 Pass 0.0345 112 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 12 0.0350 99 0 0 Pass 0.0355 84 0 0 Pass 0.0360 74 0 0 Pass 0.0365 59 0 0 Pass 0.0370 47 0 0 Pass 0.0374 44 0 0 Pass 0.0379 39 0 0 Pass 0.0384 34 0 0 Pass 0.0389 32 0 0 Pass 0.0394 27 0 0 Pass 0.0399 21 0 0 Pass 0.0404 15 0 0 Pass 0.0409 13 0 0 Pass 0.0414 9 0 0 Pass 0.0418 6 0 0 Pass 0.0423 4 0 0 Pass 0.0428 4 0 0 Pass 0.0433 4 0 0 Pass 0.0438 4 0 0 Pass 0.0443 4 0 0 Pass 0.0448 4 0 0 Pass 0.0453 3 0 0 Pass 0.0457 2 0 0 Pass 0.0462 2 0 0 Pass 0.0467 2 0 0 Pass 0.0472 2 0 0 Pass 0.0477 2 0 0 Pass 0.0482 2 0 0 Pass 0.0487 2 0 0 Pass 0.0492 2 0 0 Pass 0.0497 2 0 0 Pass 0.0501 2 0 0 Pass 0.0506 2 0 0 Pass 0.0511 2 0 0 Pass 0.0516 2 0 0 Pass 0.0521 2 0 0 Pass 0.0526 2 0 0 Pass 0.0531 2 0 0 Pass 0.0536 2 0 0 Pass 0.0540 2 0 0 Pass 0.0545 2 0 0 Pass 0.0550 2 0 0 Pass 0.0555 2 0 0 Pass 0.0560 2 0 0 Pass 0.0565 2 0 0 Pass 0.0570 2 0 0 Pass 0.0575 2 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 13 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:30 PM Page 14 LID Report FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:53 PM Page 15 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:53 PM Page 16 Appendix Predeveloped Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:55 PM Page 17 Mitigated Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 18 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.wdm MESSU 25 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.MES 27 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.L61 28 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin SWALE #1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 19 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 20 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin SWALE #1*** PERLND 10 0.52 COPY 501 12 PERLND 10 0.52 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 21 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 22 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.wdm MESSU 25 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.MES 27 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.L61 28 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Tank for Swale #1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 23 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 24 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** TANK DET #1 *** PERLND 16 0.13 RCHRES 1 2 PERLND 16 0.13 RCHRES 1 3 IMPLND 11 0.39 RCHRES 1 5 ******Routing****** PERLND 16 0.13 COPY 1 12 IMPLND 11 0.39 COPY 1 15 PERLND 16 0.13 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Tank for Swale #-009 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 25 1 1 0.22 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.000000 0.000000 0.000000 0.032111 0.023200 0.000498 0.001418 0.064222 0.032625 0.001403 0.002005 0.096333 0.039730 0.002569 0.002456 0.128444 0.045611 0.003942 0.002836 0.160556 0.050698 0.005490 0.003171 0.192667 0.055209 0.007192 0.003473 0.224778 0.059276 0.009031 0.003752 0.256889 0.062986 0.010995 0.004011 0.289000 0.066398 0.013073 0.004254 0.321111 0.069557 0.015256 0.004484 0.353222 0.072494 0.017537 0.004703 0.385333 0.075237 0.019910 0.004912 0.417444 0.077806 0.022367 0.005113 0.449556 0.080217 0.024905 0.005306 0.481667 0.082484 0.027518 0.005492 0.513778 0.084619 0.030201 0.005672 0.545889 0.086632 0.032951 0.005847 0.578000 0.088531 0.035763 0.006016 0.610111 0.090323 0.038635 0.006181 0.642222 0.092015 0.041563 0.006341 0.674333 0.093611 0.044544 0.006498 0.706444 0.095117 0.047574 0.006651 0.738556 0.096537 0.050651 0.006800 0.770667 0.097875 0.053773 0.006947 0.802778 0.099133 0.056936 0.007090 0.834889 0.100316 0.060139 0.007230 0.867000 0.101425 0.063378 0.007368 0.899111 0.102463 0.066652 0.007503 0.931222 0.103433 0.069958 0.007636 0.963333 0.104335 0.073294 0.007767 0.995444 0.105172 0.076658 0.007895 1.027556 0.105945 0.080047 0.008021 1.059667 0.106657 0.083461 0.008146 1.091778 0.107307 0.086896 0.008268 1.123889 0.107897 0.090352 0.008389 1.156000 0.108428 0.093825 0.008508 1.188111 0.108901 0.097315 0.008625 1.220222 0.109317 0.100818 0.008741 1.252333 0.109676 0.104335 0.008855 1.284444 0.109979 0.107861 0.008968 1.316556 0.110226 0.111397 0.009080 1.348667 0.110418 0.114940 0.009190 1.380778 0.110555 0.118488 0.009298 1.412889 0.110637 0.122039 0.009406 1.445000 0.110664 0.125593 0.009512 1.477111 0.110637 0.129146 0.009617 1.509222 0.110555 0.132697 0.009721 1.541333 0.110418 0.136245 0.009824 1.573444 0.110226 0.139788 0.009926 1.605556 0.109979 0.143324 0.010027 1.637667 0.109676 0.146850 0.010126 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 26 1.669778 0.109317 0.150367 0.010225 1.701889 0.108901 0.153870 0.010323 1.734000 0.108428 0.157360 0.010420 1.766111 0.107897 0.160833 0.010516 1.798222 0.107307 0.164289 0.010611 1.830333 0.106657 0.167724 0.010706 1.862444 0.105945 0.171138 0.010799 1.894556 0.105172 0.174527 0.010892 1.926667 0.104335 0.177891 0.010984 1.958778 0.103433 0.181227 0.011075 1.990889 0.102463 0.184533 0.011165 2.023000 0.101425 0.187807 0.011255 2.055111 0.100316 0.191046 0.011344 2.087222 0.099133 0.194249 0.011432 2.119333 0.097875 0.197412 0.011520 2.151444 0.096537 0.200534 0.011607 2.183556 0.095117 0.203611 0.011693 2.215667 0.093611 0.206641 0.011779 2.247778 0.092015 0.209622 0.011864 2.279889 0.090323 0.212550 0.011948 2.312000 0.088531 0.215422 0.012032 2.344111 0.086632 0.218234 0.012115 2.376222 0.084619 0.220984 0.012198 2.408333 0.082484 0.223667 0.012280 2.440444 0.080217 0.226280 0.012362 2.472556 0.077806 0.228818 0.012443 2.504667 0.075237 0.231275 0.012523 2.536778 0.072494 0.233648 0.012603 2.568889 0.069557 0.235929 0.012683 2.601000 0.066398 0.238112 0.012762 2.633111 0.062986 0.240190 0.012840 2.665222 0.059276 0.242154 0.012919 2.697333 0.055209 0.243993 0.012996 2.729444 0.050698 0.245695 0.013073 2.761556 0.045611 0.247243 0.013150 2.793667 0.039730 0.248616 0.013226 2.825778 0.032625 0.249782 0.013302 2.857889 0.023200 0.250687 0.013377 2.890000 0.001000 0.251185 0.013452 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 27 END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 28 Predeveloped HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 29 Mitigated HSPF Message File ERROR/WARNING ID: 341 6 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 1.0920E+04 1.0942E+04 1.0945E+04 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 0.77425 1.2149E+00 101 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 1.2149 6.4327E-01 102 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 0.64327 1.0499E+00 103 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 30 -9.670E+02 2021.2 -1.216E+03 1.0499 -1.606E+01 104 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 -16.060 -7.5027 105 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -967.03 2021.2 -1.216E+03 -7.5027 -3.219E+00 106 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 -3.2191 -1.068E+00 107 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 -1.0677 2.7813E-02 108 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 0.02781 6.1768E-01 109 ERROR/WARNING ID: 341 4 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 31 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 0.61768 1.0248E+00 110 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 1.0248 5.1108E+00 111 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 5.1108 3.0576E+00 112 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 3.0576 2.0103E+00 113 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 2.0103 1.4420E+00 114 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 32 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 1.4420 1.0353E+00 115 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 1.0353 9.5409 116 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -967.03 2021.2 -1.216E+03 9.5409 5.2832E+00 117 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 5.2832 3.1446E+00 118 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 3.1446 2.0555E+00 119 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 11:30 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 33 A B C RDEP1 RDEP2 COUNT -9.670E+02 2021.2 -1.216E+03 2.0555 1.4685E+00 120 FUPC LARGE LOT_DET TANK FROM BF SWALE #1 FINAL2/18/2020 5:24:56 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com Date: Project Name: City / County: State: Designed By: Company: Telephone: Storage Volume Required (cf):7,318 Limiting Width (ft):29.25 3.13 Solid or Perforated Pipe:Perforated Shape Or Diameter (in):35x24 4.50 ft2 Pipe Area Number Of Headers:1 Spacing between Barrels (ft):1.25 Stone Width Around Perimeter of System (ft):0.625 Depth A: Porous Stone Above Pipe (in):7.8 Depth C: Porous Stone Below Pipe (in):0 Stone Porosity (0 to 40%):40 System Sizing Pipe Storage:4,662 cf Porous Stone Storage:2,717 cf 7,378 cf 100.8%Of Required Storage Barrel 12 7 barrels Barrel 11 Length per Barrel:144.0 ft Barrel 10 Length Per Header:27.9 ft Barrel 9 Rectangular Footprint (W x L):29.17 ft x 148.17 ft Barrel 8 CONTECH Materials Barrel 7 Total CMP Footage:1,036 ft Barrel 6 Approximate Total Pieces:58 pcs Barrel 5 Approximate Coupling Bands:57 bands Barrel 4 Approximate Truckloads:4 trucks Barrel 3 Construction Quantities**Barrel 2 Total Excavation:502 cy Barrel 1 Porous Stone Backfill For Storage:252 cy stone Backfill to Grade Excluding Stone:78 cy fill **Construction quantities are approximate and should be verified upon final design Number Of Barrels Exceed Graph Limitations SP Project Summary 425462-9441 2/17/2020 Corrugated Metal Pipe Calculator Enter Information in Blue Cells FUPC BASIN #2 FINAL RENTON ABOSSEIN WA Total Storage Provided: Number of Barrels: Invert Depth Below Asphalt (ft): System Layout 144 144 144 144 144 144 144 0 0 0 0 0 Barrel Footage (w/o headers) For design assistance, drawings, and pricing send completed worksheet to: dyods@contech-cpi.com © 2007 CONTECH Stormwater Solutions WWHM2012 PROJECT REPORT FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/17/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin DET TANK #2 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.29 Pervious Total 0.29 Impervious Land Use acre Impervious Total 0 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 4 Mitigated Land Use TANK DET #2 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.02 Pervious Total 0.02 Impervious Land Use acre PARKING FLAT 0.27 Impervious Total 0.27 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater Tank for Swale #2 Tank for Swale #2 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 6 Mitigated Routing Tank for Swale #2 Dimensions Depth:2.65 ft. Tank Type:Arched Width:4.17 ft. Height:2.65 ft. Length:1036 ft. Discharge Structure Riser Height:2.65 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.4 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Tank Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.000 0.000 0.000 0.000 0.0296 0.020 0.000 0.000 0.000 0.0591 0.029 0.001 0.001 0.000 0.0887 0.035 0.002 0.001 0.000 0.1182 0.040 0.003 0.001 0.000 0.1478 0.045 0.004 0.001 0.000 0.1773 0.049 0.005 0.001 0.000 0.2069 0.053 0.007 0.002 0.000 0.2364 0.056 0.009 0.002 0.000 0.2660 0.059 0.010 0.002 0.000 0.2956 0.062 0.012 0.002 0.000 0.3251 0.065 0.014 0.002 0.000 0.3547 0.067 0.016 0.002 0.000 0.3842 0.069 0.018 0.002 0.000 0.4138 0.071 0.020 0.002 0.000 0.4433 0.073 0.022 0.002 0.000 0.4729 0.075 0.024 0.003 0.000 0.5024 0.077 0.027 0.003 0.000 0.5320 0.079 0.029 0.003 0.000 0.5616 0.080 0.031 0.003 0.000 0.5911 0.082 0.034 0.003 0.000 0.6207 0.083 0.036 0.003 0.000 0.6502 0.085 0.039 0.003 0.000 0.6798 0.086 0.041 0.003 0.000 0.7093 0.087 0.044 0.003 0.000 0.7389 0.088 0.046 0.003 0.000 0.7684 0.089 0.049 0.003 0.000 0.7980 0.090 0.052 0.003 0.000 0.8276 0.091 0.054 0.003 0.000 0.8571 0.092 0.057 0.004 0.000 0.8867 0.093 0.060 0.004 0.000 0.9162 0.094 0.063 0.004 0.000 0.9458 0.094 0.065 0.004 0.000 0.9753 0.095 0.068 0.004 0.000 1.0049 0.096 0.071 0.004 0.000 1.0344 0.096 0.074 0.004 0.000 1.0640 0.097 0.077 0.004 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 7 1.0936 0.097 0.080 0.004 0.000 1.1231 0.098 0.082 0.004 0.000 1.1527 0.098 0.085 0.004 0.000 1.1822 0.098 0.088 0.004 0.000 1.2118 0.098 0.091 0.004 0.000 1.2413 0.099 0.094 0.004 0.000 1.2709 0.099 0.097 0.004 0.000 1.3004 0.099 0.100 0.005 0.000 1.3300 0.099 0.103 0.005 0.000 1.3596 0.099 0.106 0.005 0.000 1.3891 0.099 0.109 0.005 0.000 1.4187 0.099 0.112 0.005 0.000 1.4482 0.098 0.114 0.005 0.000 1.4778 0.098 0.117 0.005 0.000 1.5073 0.098 0.120 0.005 0.000 1.5369 0.098 0.123 0.005 0.000 1.5664 0.097 0.126 0.005 0.000 1.5960 0.097 0.129 0.005 0.000 1.6256 0.096 0.132 0.005 0.000 1.6551 0.096 0.135 0.005 0.000 1.6847 0.095 0.137 0.005 0.000 1.7142 0.094 0.140 0.005 0.000 1.7438 0.094 0.143 0.005 0.000 1.7733 0.093 0.146 0.005 0.000 1.8029 0.092 0.148 0.005 0.000 1.8324 0.091 0.151 0.005 0.000 1.8620 0.090 0.154 0.005 0.000 1.8916 0.089 0.157 0.006 0.000 1.9211 0.088 0.159 0.006 0.000 1.9507 0.087 0.162 0.006 0.000 1.9802 0.086 0.164 0.006 0.000 2.0098 0.085 0.167 0.006 0.000 2.0393 0.083 0.169 0.006 0.000 2.0689 0.082 0.172 0.006 0.000 2.0984 0.080 0.174 0.006 0.000 2.1280 0.079 0.177 0.006 0.000 2.1576 0.077 0.179 0.006 0.000 2.1871 0.075 0.181 0.006 0.000 2.2167 0.073 0.183 0.006 0.000 2.2462 0.071 0.186 0.006 0.000 2.2758 0.069 0.188 0.006 0.000 2.3053 0.067 0.190 0.006 0.000 2.3349 0.065 0.192 0.006 0.000 2.3644 0.062 0.193 0.006 0.000 2.3940 0.059 0.195 0.006 0.000 2.4236 0.056 0.197 0.006 0.000 2.4531 0.053 0.199 0.006 0.000 2.4827 0.049 0.200 0.006 0.000 2.5122 0.045 0.201 0.006 0.000 2.5418 0.040 0.203 0.006 0.000 2.5713 0.035 0.204 0.007 0.000 2.6009 0.029 0.205 0.007 0.000 2.6304 0.020 0.206 0.007 0.000 2.6600 0.016 0.167 0.017 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:12:44 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.29 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.02 Total Impervious Area:0.27 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.011329 5 year 0.018678 10 year 0.024256 25 year 0.032052 50 year 0.038375 100 year 0.045121 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.004672 5 year 0.005267 10 year 0.005615 25 year 0.006018 50 year 0.006297 100 year 0.006561 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.014 0.004 1950 0.016 0.005 1951 0.023 0.006 1952 0.008 0.004 1953 0.007 0.005 1954 0.010 0.004 1955 0.015 0.004 1956 0.012 0.005 1957 0.011 0.004 1958 0.011 0.005 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 9 1959 0.009 0.004 1960 0.018 0.005 1961 0.009 0.005 1962 0.006 0.004 1963 0.009 0.005 1964 0.011 0.005 1965 0.008 0.005 1966 0.007 0.005 1967 0.017 0.005 1968 0.010 0.004 1969 0.010 0.004 1970 0.008 0.005 1971 0.010 0.005 1972 0.018 0.006 1973 0.008 0.005 1974 0.009 0.004 1975 0.013 0.004 1976 0.010 0.004 1977 0.003 0.004 1978 0.008 0.005 1979 0.005 0.004 1980 0.025 0.006 1981 0.007 0.004 1982 0.018 0.005 1983 0.012 0.004 1984 0.008 0.004 1985 0.004 0.004 1986 0.019 0.005 1987 0.017 0.005 1988 0.007 0.004 1989 0.005 0.004 1990 0.049 0.005 1991 0.022 0.005 1992 0.009 0.005 1993 0.009 0.004 1994 0.004 0.004 1995 0.012 0.005 1996 0.028 0.006 1997 0.022 0.006 1998 0.008 0.004 1999 0.030 0.006 2000 0.008 0.005 2001 0.002 0.004 2002 0.012 0.005 2003 0.016 0.004 2004 0.019 0.006 2005 0.012 0.004 2006 0.013 0.006 2007 0.036 0.007 2008 0.038 0.006 2009 0.017 0.005 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0485 0.0065 2 0.0381 0.0061 3 0.0359 0.0059 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 10 4 0.0302 0.0058 5 0.0277 0.0057 6 0.0254 0.0056 7 0.0233 0.0056 8 0.0219 0.0055 9 0.0218 0.0055 10 0.0189 0.0055 11 0.0187 0.0055 12 0.0181 0.0054 13 0.0178 0.0054 14 0.0176 0.0053 15 0.0174 0.0052 16 0.0172 0.0052 17 0.0172 0.0052 18 0.0162 0.0051 19 0.0161 0.0050 20 0.0147 0.0050 21 0.0139 0.0050 22 0.0135 0.0049 23 0.0127 0.0049 24 0.0123 0.0049 25 0.0121 0.0048 26 0.0120 0.0048 27 0.0118 0.0048 28 0.0118 0.0047 29 0.0111 0.0047 30 0.0110 0.0047 31 0.0108 0.0047 32 0.0103 0.0046 33 0.0101 0.0046 34 0.0097 0.0045 35 0.0096 0.0045 36 0.0095 0.0045 37 0.0095 0.0045 38 0.0093 0.0045 39 0.0091 0.0044 40 0.0090 0.0044 41 0.0088 0.0044 42 0.0088 0.0044 43 0.0084 0.0043 44 0.0084 0.0043 45 0.0083 0.0043 46 0.0082 0.0043 47 0.0081 0.0043 48 0.0078 0.0042 49 0.0078 0.0042 50 0.0076 0.0041 51 0.0075 0.0041 52 0.0074 0.0041 53 0.0073 0.0040 54 0.0066 0.0039 55 0.0061 0.0039 56 0.0050 0.0039 57 0.0047 0.0038 58 0.0045 0.0038 59 0.0036 0.0036 60 0.0033 0.0036 61 0.0022 0.0035 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 11 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 12 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0057 18448 2209 11 Pass 0.0060 16095 1077 6 Pass 0.0063 14316 126 0 Pass 0.0067 12694 0 0 Pass 0.0070 11176 0 0 Pass 0.0073 9882 0 0 Pass 0.0076 8816 0 0 Pass 0.0080 7833 0 0 Pass 0.0083 7005 0 0 Pass 0.0086 6288 0 0 Pass 0.0090 5679 0 0 Pass 0.0093 5168 0 0 Pass 0.0096 4697 0 0 Pass 0.0100 4278 0 0 Pass 0.0103 3903 0 0 Pass 0.0106 3527 0 0 Pass 0.0110 3183 0 0 Pass 0.0113 2864 0 0 Pass 0.0116 2592 0 0 Pass 0.0119 2353 0 0 Pass 0.0123 2141 0 0 Pass 0.0126 1953 0 0 Pass 0.0129 1796 0 0 Pass 0.0133 1669 0 0 Pass 0.0136 1517 0 0 Pass 0.0139 1344 0 0 Pass 0.0143 1224 0 0 Pass 0.0146 1124 0 0 Pass 0.0149 1042 0 0 Pass 0.0152 971 0 0 Pass 0.0156 910 0 0 Pass 0.0159 839 0 0 Pass 0.0162 766 0 0 Pass 0.0166 705 0 0 Pass 0.0169 635 0 0 Pass 0.0172 572 0 0 Pass 0.0176 489 0 0 Pass 0.0179 426 0 0 Pass 0.0182 376 0 0 Pass 0.0186 341 0 0 Pass 0.0189 307 0 0 Pass 0.0192 270 0 0 Pass 0.0195 235 0 0 Pass 0.0199 196 0 0 Pass 0.0202 171 0 0 Pass 0.0205 145 0 0 Pass 0.0209 125 0 0 Pass 0.0212 107 0 0 Pass 0.0215 95 0 0 Pass 0.0219 84 0 0 Pass 0.0222 71 0 0 Pass 0.0225 61 0 0 Pass 0.0228 55 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 13 0.0232 45 0 0 Pass 0.0235 40 0 0 Pass 0.0238 37 0 0 Pass 0.0242 35 0 0 Pass 0.0245 29 0 0 Pass 0.0248 25 0 0 Pass 0.0252 22 0 0 Pass 0.0255 17 0 0 Pass 0.0258 15 0 0 Pass 0.0261 11 0 0 Pass 0.0265 9 0 0 Pass 0.0268 8 0 0 Pass 0.0271 8 0 0 Pass 0.0275 8 0 0 Pass 0.0278 7 0 0 Pass 0.0281 7 0 0 Pass 0.0285 7 0 0 Pass 0.0288 7 0 0 Pass 0.0291 7 0 0 Pass 0.0295 7 0 0 Pass 0.0298 7 0 0 Pass 0.0301 6 0 0 Pass 0.0304 5 0 0 Pass 0.0308 5 0 0 Pass 0.0311 5 0 0 Pass 0.0314 4 0 0 Pass 0.0318 4 0 0 Pass 0.0321 4 0 0 Pass 0.0324 4 0 0 Pass 0.0328 4 0 0 Pass 0.0331 4 0 0 Pass 0.0334 4 0 0 Pass 0.0337 4 0 0 Pass 0.0341 4 0 0 Pass 0.0344 4 0 0 Pass 0.0347 3 0 0 Pass 0.0351 3 0 0 Pass 0.0354 3 0 0 Pass 0.0357 3 0 0 Pass 0.0361 2 0 0 Pass 0.0364 2 0 0 Pass 0.0367 2 0 0 Pass 0.0371 2 0 0 Pass 0.0374 2 0 0 Pass 0.0377 2 0 0 Pass 0.0380 2 0 0 Pass 0.0384 1 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 14 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:23 PM Page 15 LID Report FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:51 PM Page 16 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:51 PM Page 17 Appendix Predeveloped Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:52 PM Page 18 Mitigated Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 19 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.wdm MESSU 25 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.MES 27 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.L61 28 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin DET TANK #2 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 20 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 21 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin DET TANK #2*** PERLND 10 0.29 COPY 501 12 PERLND 10 0.29 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 22 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 23 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.wdm MESSU 25 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.MES 27 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.L61 28 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Tank for Swale #2 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 24 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 25 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** TANK DET #2*** PERLND 16 0.02 RCHRES 1 2 PERLND 16 0.02 RCHRES 1 3 IMPLND 11 0.27 RCHRES 1 5 ******Routing****** PERLND 16 0.02 COPY 1 12 IMPLND 11 0.27 COPY 1 15 PERLND 16 0.02 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Tank for Swale #-009 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 26 1 1 0.2 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 90 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.000000 0.000000 0.000000 0.029444 0.020792 0.000409 0.000746 0.058889 0.029238 0.001153 0.001056 0.088333 0.035605 0.002111 0.001293 0.117778 0.040877 0.003239 0.001493 0.147222 0.045435 0.004511 0.001669 0.176667 0.049478 0.005910 0.001828 0.206111 0.053123 0.007421 0.001975 0.235556 0.056448 0.009035 0.002111 0.265000 0.059506 0.010743 0.002239 0.294444 0.062336 0.012537 0.002360 0.323889 0.064969 0.014412 0.002476 0.353333 0.067427 0.016361 0.002586 0.382778 0.069729 0.018381 0.002691 0.412222 0.071890 0.020466 0.002793 0.441667 0.073922 0.022613 0.002891 0.471111 0.075835 0.024818 0.002986 0.500556 0.077639 0.027078 0.003078 0.530000 0.079341 0.029389 0.003167 0.559444 0.080947 0.031749 0.003254 0.588889 0.082463 0.034155 0.003338 0.618333 0.083894 0.036605 0.003421 0.647778 0.085243 0.039095 0.003501 0.677222 0.086516 0.041624 0.003580 0.706667 0.087715 0.044189 0.003657 0.736111 0.088843 0.046788 0.003732 0.765556 0.089903 0.049420 0.003806 0.795000 0.090897 0.052082 0.003879 0.824444 0.091827 0.054772 0.003950 0.853889 0.092696 0.057489 0.004020 0.883333 0.093504 0.060230 0.004088 0.912778 0.094255 0.062995 0.004156 0.942222 0.094948 0.065780 0.004223 0.971667 0.095585 0.068586 0.004288 1.001111 0.096168 0.071409 0.004352 1.030556 0.096697 0.074248 0.004416 1.060000 0.097173 0.077103 0.004479 1.089444 0.097596 0.079970 0.004540 1.118889 0.097969 0.082849 0.004601 1.148333 0.098291 0.085739 0.004662 1.177778 0.098562 0.088637 0.004721 1.207222 0.098784 0.091543 0.004780 1.236667 0.098956 0.094454 0.004838 1.266111 0.099078 0.097370 0.004895 1.295556 0.099152 0.100288 0.004951 1.325000 0.099176 0.103208 0.005007 1.354444 0.099152 0.106128 0.005063 1.383889 0.099078 0.109047 0.005117 1.413333 0.098956 0.111962 0.005172 1.442778 0.098784 0.114873 0.005225 1.472222 0.098562 0.117779 0.005278 1.501667 0.098291 0.120677 0.005331 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 27 1.531111 0.097969 0.123567 0.005383 1.560556 0.097596 0.126446 0.005434 1.590000 0.097173 0.129314 0.005485 1.619444 0.096697 0.132168 0.005536 1.648889 0.096168 0.135007 0.005586 1.678333 0.095585 0.137831 0.005636 1.707778 0.094948 0.140636 0.005685 1.737222 0.094255 0.143421 0.005734 1.766667 0.093504 0.146186 0.005782 1.796111 0.092696 0.148927 0.005830 1.825556 0.091827 0.151644 0.005878 1.855000 0.090897 0.154334 0.005925 1.884444 0.089903 0.156996 0.005972 1.913889 0.088843 0.159628 0.006018 1.943333 0.087715 0.162227 0.006064 1.972778 0.086516 0.164792 0.006110 2.002222 0.085243 0.167321 0.006155 2.031667 0.083894 0.169812 0.006200 2.061111 0.082463 0.172261 0.006245 2.090556 0.080947 0.174667 0.006290 2.120000 0.079341 0.177027 0.006334 2.149444 0.077639 0.179338 0.006378 2.178889 0.075835 0.181598 0.006421 2.208333 0.073922 0.183803 0.006464 2.237778 0.071890 0.185950 0.006507 2.267222 0.069729 0.188035 0.006550 2.296667 0.067427 0.190055 0.006592 2.326111 0.064969 0.192004 0.006635 2.355556 0.062336 0.193879 0.006676 2.385000 0.059506 0.195673 0.006718 2.414444 0.056448 0.197381 0.006759 2.443889 0.053123 0.198995 0.006800 2.473333 0.049478 0.200506 0.006841 2.502778 0.045435 0.201905 0.006882 2.532222 0.040877 0.203177 0.006922 2.561667 0.035605 0.204305 0.006962 2.591111 0.029238 0.205263 0.007002 2.620556 0.020792 0.206007 0.007042 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 28 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 29 Predeveloped HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 30 Mitigated HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #2 FINAL2/17/2020 4:13:54 PM Page 31 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com WWHM2012 PROJECT REPORT VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 2 General Model Information Project Name:VAULT MODEL EQUAL TO TANK #2 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/25/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/09/13 Version:4.2.17 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year NOTE: THE VAULT MODEL WAS USED TO REVERIFY THE VOLUME OF REQUIRED STORAGE IN ORDER TO COMPARE THE STORAGE VOLUMEPROVIDED BY THE CONTECH'S CALCULATIONS FOR 1,036' OF 35" X 24" CAP VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 3 Landuse Basin Data Predeveloped Land Use VAULT 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.29 Pervious Total 0.29 Impervious Land Use acre Impervious Total 0 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 4 Mitigated Land Use VAULT Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.02 Pervious Total 0.02 Impervious Land Use acre PARKING FLAT 0.27 Impervious Total 0.27 Basin Total 0.29 Element Flows To: Surface Interflow Groundwater Vault 1 Vault 1 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 5 Routing Elements Predeveloped Routing VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 6 Mitigated Routing Vault 1 Width:3.02 ft. Length:914 ft. Depth:2.65 ft. Discharge Structure Riser Height:2.65 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.42 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Vault Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.063 0.000 0.000 0.000 0.0294 0.063 0.001 0.000 0.000 0.0589 0.063 0.003 0.001 0.000 0.0883 0.063 0.005 0.001 0.000 0.1178 0.063 0.007 0.001 0.000 0.1472 0.063 0.009 0.001 0.000 0.1767 0.063 0.011 0.002 0.000 0.2061 0.063 0.013 0.002 0.000 0.2356 0.063 0.014 0.002 0.000 0.2650 0.063 0.016 0.002 0.000 0.2944 0.063 0.018 0.002 0.000 0.3239 0.063 0.020 0.002 0.000 0.3533 0.063 0.022 0.002 0.000 0.3828 0.063 0.024 0.003 0.000 0.4122 0.063 0.026 0.003 0.000 0.4417 0.063 0.028 0.003 0.000 0.4711 0.063 0.029 0.003 0.000 0.5006 0.063 0.031 0.003 0.000 0.5300 0.063 0.033 0.003 0.000 0.5594 0.063 0.035 0.003 0.000 0.5889 0.063 0.037 0.003 0.000 0.6183 0.063 0.039 0.003 0.000 0.6478 0.063 0.041 0.003 0.000 0.6772 0.063 0.042 0.003 0.000 0.7067 0.063 0.044 0.004 0.000 0.7361 0.063 0.046 0.004 0.000 0.7656 0.063 0.048 0.004 0.000 0.7950 0.063 0.050 0.004 0.000 0.8244 0.063 0.052 0.004 0.000 0.8539 0.063 0.054 0.004 0.000 0.8833 0.063 0.056 0.004 0.000 0.9128 0.063 0.057 0.004 0.000 0.9422 0.063 0.059 0.004 0.000 0.9717 0.063 0.061 0.004 0.000 1.0011 0.063 0.063 0.004 0.000 1.0306 0.063 0.065 0.004 0.000 1.0600 0.063 0.067 0.004 0.000 1.0894 0.063 0.069 0.005 0.000 1.1189 0.063 0.070 0.005 0.000 1.1483 0.063 0.072 0.005 0.000 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 7 1.1778 0.063 0.074 0.005 0.000 1.2072 0.063 0.076 0.005 0.000 1.2367 0.063 0.078 0.005 0.000 1.2661 0.063 0.080 0.005 0.000 1.2956 0.063 0.082 0.005 0.000 1.3250 0.063 0.084 0.005 0.000 1.3544 0.063 0.085 0.005 0.000 1.3839 0.063 0.087 0.005 0.000 1.4133 0.063 0.089 0.005 0.000 1.4428 0.063 0.091 0.005 0.000 1.4722 0.063 0.093 0.005 0.000 1.5017 0.063 0.095 0.005 0.000 1.5311 0.063 0.097 0.005 0.000 1.5606 0.063 0.098 0.006 0.000 1.5900 0.063 0.100 0.006 0.000 1.6194 0.063 0.102 0.006 0.000 1.6489 0.063 0.104 0.006 0.000 1.6783 0.063 0.106 0.006 0.000 1.7078 0.063 0.108 0.006 0.000 1.7372 0.063 0.110 0.006 0.000 1.7667 0.063 0.111 0.006 0.000 1.7961 0.063 0.113 0.006 0.000 1.8256 0.063 0.115 0.006 0.000 1.8550 0.063 0.117 0.006 0.000 1.8844 0.063 0.119 0.006 0.000 1.9139 0.063 0.121 0.006 0.000 1.9433 0.063 0.123 0.006 0.000 1.9728 0.063 0.125 0.006 0.000 2.0022 0.063 0.126 0.006 0.000 2.0317 0.063 0.128 0.006 0.000 2.0611 0.063 0.130 0.006 0.000 2.0906 0.063 0.132 0.006 0.000 2.1200 0.063 0.134 0.007 0.000 2.1494 0.063 0.136 0.007 0.000 2.1789 0.063 0.138 0.007 0.000 2.2083 0.063 0.139 0.007 0.000 2.2378 0.063 0.141 0.007 0.000 2.2672 0.063 0.143 0.007 0.000 2.2967 0.063 0.145 0.007 0.000 2.3261 0.063 0.147 0.007 0.000 2.3556 0.063 0.149 0.007 0.000 2.3850 0.063 0.151 0.007 0.000 2.4144 0.063 0.153 0.007 0.000 2.4439 0.063 0.154 0.007 0.000 2.4733 0.063 0.156 0.007 0.000 2.5028 0.063 0.158 0.007 0.000 2.5322 0.063 0.160 0.007 0.000 2.5617 0.063 0.162 0.007 0.000 2.5911 0.063 0.164 0.007 0.000 2.6206 0.063 0.166 0.007 0.000 2.6500 0.063 0.167 0.007 0.000 2.6794 0.000 0.000 0.061 0.000 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:52:41 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.29 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.02 Total Impervious Area:0.27 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.011329 5 year 0.018678 10 year 0.024256 25 year 0.032052 50 year 0.038375 100 year 0.045121 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.00546 5 year 0.006309 10 year 0.006804 25 year 0.007375 50 year 0.007769 100 year 0.008141 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.014 0.005 1950 0.016 0.006 1951 0.023 0.007 1952 0.008 0.004 1953 0.007 0.005 1954 0.010 0.005 1955 0.015 0.005 1956 0.012 0.006 1957 0.011 0.005 1958 0.011 0.005 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 9 1959 0.009 0.005 1960 0.018 0.007 1961 0.009 0.006 1962 0.006 0.004 1963 0.009 0.005 1964 0.011 0.006 1965 0.008 0.006 1966 0.007 0.005 1967 0.017 0.006 1968 0.010 0.005 1969 0.010 0.005 1970 0.008 0.005 1971 0.010 0.005 1972 0.018 0.007 1973 0.008 0.006 1974 0.009 0.005 1975 0.013 0.005 1976 0.010 0.005 1977 0.003 0.005 1978 0.008 0.006 1979 0.005 0.004 1980 0.025 0.007 1981 0.007 0.005 1982 0.018 0.006 1983 0.012 0.005 1984 0.008 0.004 1985 0.004 0.005 1986 0.019 0.006 1987 0.017 0.006 1988 0.007 0.005 1989 0.005 0.005 1990 0.049 0.007 1991 0.022 0.007 1992 0.009 0.006 1993 0.009 0.004 1994 0.004 0.004 1995 0.012 0.006 1996 0.028 0.007 1997 0.022 0.007 1998 0.008 0.004 1999 0.030 0.007 2000 0.008 0.006 2001 0.002 0.004 2002 0.012 0.006 2003 0.016 0.005 2004 0.019 0.007 2005 0.012 0.005 2006 0.013 0.006 2007 0.036 0.008 2008 0.038 0.007 2009 0.017 0.006 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0485 0.0078 2 0.0381 0.0075 3 0.0359 0.0072 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 10 4 0.0302 0.0071 5 0.0277 0.0071 6 0.0254 0.0070 7 0.0233 0.0069 8 0.0219 0.0069 9 0.0218 0.0067 10 0.0189 0.0066 11 0.0187 0.0066 12 0.0181 0.0066 13 0.0178 0.0065 14 0.0176 0.0064 15 0.0174 0.0063 16 0.0172 0.0062 17 0.0172 0.0061 18 0.0162 0.0061 19 0.0161 0.0060 20 0.0147 0.0059 21 0.0139 0.0058 22 0.0135 0.0058 23 0.0127 0.0057 24 0.0123 0.0057 25 0.0121 0.0057 26 0.0120 0.0056 27 0.0118 0.0055 28 0.0118 0.0055 29 0.0111 0.0055 30 0.0110 0.0054 31 0.0108 0.0054 32 0.0103 0.0053 33 0.0101 0.0053 34 0.0097 0.0053 35 0.0096 0.0052 36 0.0095 0.0052 37 0.0095 0.0051 38 0.0093 0.0051 39 0.0091 0.0051 40 0.0090 0.0051 41 0.0088 0.0050 42 0.0088 0.0050 43 0.0084 0.0050 44 0.0084 0.0050 45 0.0083 0.0049 46 0.0082 0.0049 47 0.0081 0.0049 48 0.0078 0.0049 49 0.0078 0.0048 50 0.0076 0.0047 51 0.0075 0.0046 52 0.0074 0.0046 53 0.0073 0.0046 54 0.0066 0.0044 55 0.0061 0.0043 56 0.0050 0.0043 57 0.0047 0.0043 58 0.0045 0.0042 59 0.0036 0.0040 60 0.0033 0.0039 61 0.0022 0.0038 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 11 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 12 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0057 18448 12842 69 Pass 0.0060 16095 8113 50 Pass 0.0063 14316 4648 32 Pass 0.0067 12694 3014 23 Pass 0.0070 11176 1601 14 Pass 0.0073 9882 895 9 Pass 0.0076 8816 169 1 Pass 0.0080 7833 0 0 Pass 0.0083 7005 0 0 Pass 0.0086 6288 0 0 Pass 0.0090 5679 0 0 Pass 0.0093 5168 0 0 Pass 0.0096 4697 0 0 Pass 0.0100 4278 0 0 Pass 0.0103 3903 0 0 Pass 0.0106 3527 0 0 Pass 0.0110 3183 0 0 Pass 0.0113 2864 0 0 Pass 0.0116 2592 0 0 Pass 0.0119 2353 0 0 Pass 0.0123 2141 0 0 Pass 0.0126 1953 0 0 Pass 0.0129 1796 0 0 Pass 0.0133 1669 0 0 Pass 0.0136 1517 0 0 Pass 0.0139 1344 0 0 Pass 0.0143 1224 0 0 Pass 0.0146 1124 0 0 Pass 0.0149 1042 0 0 Pass 0.0152 971 0 0 Pass 0.0156 910 0 0 Pass 0.0159 839 0 0 Pass 0.0162 766 0 0 Pass 0.0166 705 0 0 Pass 0.0169 635 0 0 Pass 0.0172 572 0 0 Pass 0.0176 489 0 0 Pass 0.0179 426 0 0 Pass 0.0182 376 0 0 Pass 0.0186 341 0 0 Pass 0.0189 307 0 0 Pass 0.0192 270 0 0 Pass 0.0195 235 0 0 Pass 0.0199 196 0 0 Pass 0.0202 171 0 0 Pass 0.0205 145 0 0 Pass 0.0209 125 0 0 Pass 0.0212 107 0 0 Pass 0.0215 95 0 0 Pass 0.0219 84 0 0 Pass 0.0222 71 0 0 Pass 0.0225 61 0 0 Pass 0.0228 55 0 0 Pass VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 13 0.0232 45 0 0 Pass 0.0235 40 0 0 Pass 0.0238 37 0 0 Pass 0.0242 35 0 0 Pass 0.0245 29 0 0 Pass 0.0248 25 0 0 Pass 0.0252 22 0 0 Pass 0.0255 17 0 0 Pass 0.0258 15 0 0 Pass 0.0261 11 0 0 Pass 0.0265 9 0 0 Pass 0.0268 8 0 0 Pass 0.0271 8 0 0 Pass 0.0275 8 0 0 Pass 0.0278 7 0 0 Pass 0.0281 7 0 0 Pass 0.0285 7 0 0 Pass 0.0288 7 0 0 Pass 0.0291 7 0 0 Pass 0.0295 7 0 0 Pass 0.0298 7 0 0 Pass 0.0301 6 0 0 Pass 0.0304 5 0 0 Pass 0.0308 5 0 0 Pass 0.0311 5 0 0 Pass 0.0314 4 0 0 Pass 0.0318 4 0 0 Pass 0.0321 4 0 0 Pass 0.0324 4 0 0 Pass 0.0328 4 0 0 Pass 0.0331 4 0 0 Pass 0.0334 4 0 0 Pass 0.0337 4 0 0 Pass 0.0341 4 0 0 Pass 0.0344 4 0 0 Pass 0.0347 3 0 0 Pass 0.0351 3 0 0 Pass 0.0354 3 0 0 Pass 0.0357 3 0 0 Pass 0.0361 2 0 0 Pass 0.0364 2 0 0 Pass 0.0367 2 0 0 Pass 0.0371 2 0 0 Pass 0.0374 2 0 0 Pass 0.0377 2 0 0 Pass 0.0380 2 0 0 Pass 0.0384 1 0 0 Pass VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 14 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:19 PM Page 15 LID Report VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:48 PM Page 16 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:48 PM Page 17 Appendix Predeveloped Schematic VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:49 PM Page 18 Mitigated Schematic VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 19 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 VAULT MODEL EQUAL TO TANK #2.wdm MESSU 25 PreVAULT MODEL EQUAL TO TANK #2.MES 27 PreVAULT MODEL EQUAL TO TANK #2.L61 28 PreVAULT MODEL EQUAL TO TANK #2.L62 30 POCVAULT MODEL EQUAL TO TANK #21.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 VAULT 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 20 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 21 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** VAULT 1*** PERLND 10 0.29 COPY 501 12 PERLND 10 0.29 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 22 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 23 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 VAULT MODEL EQUAL TO TANK #2.wdm MESSU 25 MitVAULT MODEL EQUAL TO TANK #2.MES 27 MitVAULT MODEL EQUAL TO TANK #2.L61 28 MitVAULT MODEL EQUAL TO TANK #2.L62 30 POCVAULT MODEL EQUAL TO TANK #21.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Vault 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 24 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 25 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** VAULT *** PERLND 16 0.02 RCHRES 1 2 PERLND 16 0.02 RCHRES 1 3 IMPLND 11 0.27 RCHRES 1 5 ******Routing****** PERLND 16 0.02 COPY 1 12 IMPLND 11 0.27 COPY 1 15 PERLND 16 0.02 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Vault 1 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 26 1 1 0.17 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.063367 0.000000 0.000000 0.029444 0.063367 0.001866 0.000821 0.058889 0.063367 0.003732 0.001162 0.088333 0.063367 0.005597 0.001423 0.117778 0.063367 0.007463 0.001643 0.147222 0.063367 0.009329 0.001837 0.176667 0.063367 0.011195 0.002012 0.206111 0.063367 0.013061 0.002173 0.235556 0.063367 0.014927 0.002323 0.265000 0.063367 0.016792 0.002464 0.294444 0.063367 0.018658 0.002598 0.323889 0.063367 0.020524 0.002724 0.353333 0.063367 0.022390 0.002845 0.382778 0.063367 0.024256 0.002962 0.412222 0.063367 0.026121 0.003073 0.441667 0.063367 0.027987 0.003181 0.471111 0.063367 0.029853 0.003286 0.500556 0.063367 0.031719 0.003387 0.530000 0.063367 0.033585 0.003485 0.559444 0.063367 0.035450 0.003580 0.588889 0.063367 0.037316 0.003673 0.618333 0.063367 0.039182 0.003764 0.647778 0.063367 0.041048 0.003853 0.677222 0.063367 0.042914 0.003939 0.706667 0.063367 0.044780 0.004024 0.736111 0.063367 0.046645 0.004107 0.765556 0.063367 0.048511 0.004188 0.795000 0.063367 0.050377 0.004268 0.824444 0.063367 0.052243 0.004346 0.853889 0.063367 0.054109 0.004423 0.883333 0.063367 0.055974 0.004499 0.912778 0.063367 0.057840 0.004573 0.942222 0.063367 0.059706 0.004647 0.971667 0.063367 0.061572 0.004719 1.001111 0.063367 0.063438 0.004790 1.030556 0.063367 0.065304 0.004860 1.060000 0.063367 0.067169 0.004928 1.089444 0.063367 0.069035 0.004996 1.118889 0.063367 0.070901 0.005063 1.148333 0.063367 0.072767 0.005130 1.177778 0.063367 0.074633 0.005195 1.207222 0.063367 0.076498 0.005260 1.236667 0.063367 0.078364 0.005323 1.266111 0.063367 0.080230 0.005386 1.295556 0.063367 0.082096 0.005449 1.325000 0.063367 0.083962 0.005510 1.354444 0.063367 0.085828 0.005571 1.383889 0.063367 0.087693 0.005631 1.413333 0.063367 0.089559 0.005691 1.442778 0.063367 0.091425 0.005750 1.472222 0.063367 0.093291 0.005808 1.501667 0.063367 0.095157 0.005866 VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 27 1.531111 0.063367 0.097022 0.005923 1.560556 0.063367 0.098888 0.005980 1.590000 0.063367 0.100754 0.006036 1.619444 0.063367 0.102620 0.006092 1.648889 0.063367 0.104486 0.006147 1.678333 0.063367 0.106351 0.006201 1.707778 0.063367 0.108217 0.006256 1.737222 0.063367 0.110083 0.006309 1.766667 0.063367 0.111949 0.006363 1.796111 0.063367 0.113815 0.006415 1.825556 0.063367 0.115681 0.006468 1.855000 0.063367 0.117546 0.006520 1.884444 0.063367 0.119412 0.006571 1.913889 0.063367 0.121278 0.006622 1.943333 0.063367 0.123144 0.006673 1.972778 0.063367 0.125010 0.006724 2.002222 0.063367 0.126875 0.006774 2.031667 0.063367 0.128741 0.006823 2.061111 0.063367 0.130607 0.006872 2.090556 0.063367 0.132473 0.006921 2.120000 0.063367 0.134339 0.006970 2.149444 0.063367 0.136205 0.007018 2.178889 0.063367 0.138070 0.007066 2.208333 0.063367 0.139936 0.007114 2.237778 0.063367 0.141802 0.007161 2.267222 0.063367 0.143668 0.007208 2.296667 0.063367 0.145534 0.007254 2.326111 0.063367 0.147399 0.007301 2.355556 0.063367 0.149265 0.007347 2.385000 0.063367 0.151131 0.007393 2.414444 0.063367 0.152997 0.007438 2.443889 0.063367 0.154863 0.007483 2.473333 0.063367 0.156728 0.007528 2.502778 0.063367 0.158594 0.007573 2.532222 0.063367 0.160460 0.007617 2.561667 0.063367 0.162326 0.007662 2.591111 0.063367 0.164192 0.007705 2.620556 0.063367 0.166058 0.007749 2.650000 0.063367 0.167923 0.007793 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1002 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 28 END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 29 Predeveloped HSPF Message File VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 30 Mitigated HSPF Message File VAULT MODEL EQUAL TO TANK #2 2/25/2020 2:53:51 PM Page 31 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com Date: Project Name: City / County: State: Designed By: Company: Telephone: Storage Volume Required (cf):8,233 Limiting Width (ft):41.00 3.00 Solid or Perforated Pipe:Perforated Shape Or Diameter (in):35x24 4.50 ft2 Pipe Area Number Of Headers:1 Spacing between Barrels (ft):1.25 Stone Width Around Perimeter of System (ft):0.625 Depth A: Porous Stone Above Pipe (in):11.76 Depth C: Porous Stone Below Pipe (in):0 Stone Porosity (0 to 40%):40 System Sizing Pipe Storage:4,861 cf Porous Stone Storage:3,427 cf 8,288 cf 100.7%Of Required Storage Barrel 12 9 barrels Barrel 11 Length per Barrel:116.0 ft Barrel 10 Length Per Header:36.3 ft Barrel 9 Rectangular Footprint (W x L):37.5 ft x 120.17 ft Barrel 8 CONTECH Materials Barrel 7 Total CMP Footage:1,080 ft Barrel 6 Approximate Total Pieces:56 pcs Barrel 5 Approximate Coupling Bands:55 bands Barrel 4 Approximate Truckloads:4 trucks Barrel 3 Construction Quantities**Barrel 2 Total Excavation:501 cy Barrel 1 Porous Stone Backfill For Storage:317 cy stone Backfill to Grade Excluding Stone:4 cy fill **Construction quantities are approximate and should be verified upon final design Number Of Barrels Exceed Graph Limitations SP Project Summary 425462-9441 2/17/2020 Corrugated Metal Pipe Calculator Enter Information in Blue Cells FUPC BASIN #3 FINAL RENTON ABOSSEIN WA Total Storage Provided: Number of Barrels: Invert Depth Below Asphalt (ft): System Layout 116 116 116 116 116 116 116 116 116 0 0 0 Barrel Footage (w/o headers) For design assistance, drawings, and pricing send completed worksheet to: dyods@contech-cpi.com © 2007 CONTECH Stormwater Solutions WWHM2012 PROJECT REPORT FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/17/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin SWALE #3 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.35 Pervious Total 0.35 Impervious Land Use acre Impervious Total 0 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 4 Mitigated Land Use TANK DET #3 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.03 Pervious Total 0.03 Impervious Land Use acre PARKING FLAT 0.32 Impervious Total 0.32 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater Tank for Swale #3 Tank for Swale #3 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 6 Mitigated Routing Tank for Swale #3 Dimensions Depth:2.98 ft. Tank Type:Arched Width:4.17 ft. Height:2.98 ft. Length:1080 ft. Discharge Structure Riser Height:2.98 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.45 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Tank Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.000 0.000 0.000 0.000 0.0332 0.021 0.000 0.001 0.000 0.0663 0.030 0.001 0.001 0.000 0.0995 0.037 0.002 0.001 0.000 0.1327 0.042 0.003 0.002 0.000 0.1658 0.047 0.005 0.002 0.000 0.1990 0.051 0.006 0.002 0.000 0.2322 0.055 0.008 0.002 0.000 0.2653 0.058 0.010 0.002 0.000 0.2985 0.062 0.012 0.003 0.000 0.3317 0.065 0.014 0.003 0.000 0.3648 0.067 0.016 0.003 0.000 0.3980 0.070 0.019 0.003 0.000 0.4312 0.072 0.021 0.003 0.000 0.4643 0.074 0.024 0.003 0.000 0.4975 0.077 0.026 0.003 0.000 0.5307 0.079 0.029 0.004 0.000 0.5638 0.080 0.031 0.004 0.000 0.5970 0.082 0.034 0.004 0.000 0.6302 0.084 0.037 0.004 0.000 0.6633 0.086 0.040 0.004 0.000 0.6965 0.087 0.042 0.004 0.000 0.7297 0.088 0.045 0.004 0.000 0.7628 0.090 0.048 0.004 0.000 0.7960 0.091 0.051 0.004 0.000 0.8292 0.092 0.054 0.005 0.000 0.8623 0.093 0.057 0.005 0.000 0.8955 0.094 0.061 0.005 0.000 0.9287 0.095 0.064 0.005 0.000 0.9618 0.096 0.067 0.005 0.000 0.9950 0.097 0.070 0.005 0.000 1.0282 0.098 0.073 0.005 0.000 1.0613 0.099 0.077 0.005 0.000 1.0945 0.099 0.080 0.005 0.000 1.1277 0.100 0.083 0.005 0.000 1.1608 0.100 0.087 0.005 0.000 1.1940 0.101 0.090 0.006 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 7 1.2272 0.101 0.093 0.006 0.000 1.2603 0.102 0.097 0.006 0.000 1.2935 0.102 0.100 0.006 0.000 1.3267 0.102 0.103 0.006 0.000 1.3598 0.103 0.107 0.006 0.000 1.3930 0.103 0.110 0.006 0.000 1.4262 0.103 0.114 0.006 0.000 1.4593 0.103 0.117 0.006 0.000 1.4925 0.103 0.121 0.006 0.000 1.5257 0.103 0.124 0.006 0.000 1.5588 0.103 0.127 0.006 0.000 1.5920 0.103 0.131 0.006 0.000 1.6252 0.103 0.134 0.007 0.000 1.6583 0.102 0.138 0.007 0.000 1.6915 0.102 0.141 0.007 0.000 1.7247 0.102 0.144 0.007 0.000 1.7578 0.101 0.148 0.007 0.000 1.7910 0.101 0.151 0.007 0.000 1.8242 0.100 0.154 0.007 0.000 1.8573 0.100 0.158 0.007 0.000 1.8905 0.099 0.161 0.007 0.000 1.9237 0.099 0.164 0.007 0.000 1.9568 0.098 0.168 0.007 0.000 1.9900 0.097 0.171 0.007 0.000 2.0232 0.096 0.174 0.007 0.000 2.0563 0.095 0.177 0.007 0.000 2.0895 0.094 0.180 0.007 0.000 2.1227 0.093 0.184 0.008 0.000 2.1558 0.092 0.187 0.008 0.000 2.1890 0.091 0.190 0.008 0.000 2.2222 0.090 0.193 0.008 0.000 2.2553 0.088 0.196 0.008 0.000 2.2885 0.087 0.199 0.008 0.000 2.3217 0.086 0.201 0.008 0.000 2.3548 0.084 0.204 0.008 0.000 2.3880 0.082 0.207 0.008 0.000 2.4212 0.080 0.210 0.008 0.000 2.4543 0.079 0.212 0.008 0.000 2.4875 0.077 0.215 0.008 0.000 2.5207 0.074 0.218 0.008 0.000 2.5538 0.072 0.220 0.008 0.000 2.5870 0.070 0.222 0.008 0.000 2.6202 0.067 0.225 0.008 0.000 2.6533 0.065 0.227 0.009 0.000 2.6865 0.062 0.229 0.009 0.000 2.7197 0.058 0.231 0.009 0.000 2.7528 0.055 0.233 0.009 0.000 2.7860 0.051 0.235 0.009 0.000 2.8192 0.047 0.236 0.009 0.000 2.8523 0.042 0.238 0.009 0.000 2.8855 0.037 0.239 0.009 0.000 2.9187 0.030 0.240 0.009 0.000 2.9518 0.021 0.241 0.009 0.000 2.9850 0.000 0.227 0.013 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:03 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.35 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.03 Total Impervious Area:0.32 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.013673 5 year 0.022542 10 year 0.029275 25 year 0.038684 50 year 0.046314 100 year 0.054456 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.006136 5 year 0.006919 10 year 0.007377 25 year 0.007906 50 year 0.008273 100 year 0.008621 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.017 0.005 1950 0.020 0.006 1951 0.028 0.008 1952 0.009 0.005 1953 0.008 0.006 1954 0.011 0.006 1955 0.018 0.006 1956 0.014 0.007 1957 0.013 0.006 1958 0.013 0.006 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 9 1959 0.011 0.005 1960 0.022 0.007 1961 0.011 0.006 1962 0.007 0.005 1963 0.011 0.006 1964 0.013 0.006 1965 0.010 0.007 1966 0.009 0.006 1967 0.021 0.006 1968 0.012 0.006 1969 0.012 0.006 1970 0.010 0.006 1971 0.012 0.006 1972 0.021 0.007 1973 0.010 0.007 1974 0.011 0.006 1975 0.016 0.006 1976 0.012 0.006 1977 0.004 0.005 1978 0.010 0.006 1979 0.006 0.005 1980 0.031 0.008 1981 0.009 0.006 1982 0.021 0.007 1983 0.015 0.006 1984 0.009 0.005 1985 0.005 0.005 1986 0.023 0.006 1987 0.021 0.007 1988 0.009 0.006 1989 0.006 0.005 1990 0.059 0.007 1991 0.026 0.007 1992 0.011 0.006 1993 0.011 0.005 1994 0.004 0.005 1995 0.014 0.006 1996 0.033 0.007 1997 0.026 0.008 1998 0.009 0.005 1999 0.036 0.007 2000 0.010 0.006 2001 0.003 0.005 2002 0.014 0.007 2003 0.019 0.006 2004 0.023 0.008 2005 0.015 0.006 2006 0.015 0.007 2007 0.043 0.009 2008 0.046 0.007 2009 0.021 0.007 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0586 0.0086 2 0.0460 0.0081 3 0.0433 0.0077 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 10 4 0.0365 0.0076 5 0.0334 0.0076 6 0.0306 0.0074 7 0.0281 0.0074 8 0.0264 0.0074 9 0.0264 0.0073 10 0.0229 0.0072 11 0.0226 0.0072 12 0.0218 0.0071 13 0.0215 0.0071 14 0.0212 0.0070 15 0.0210 0.0069 16 0.0208 0.0069 17 0.0207 0.0068 18 0.0195 0.0067 19 0.0195 0.0065 20 0.0177 0.0065 21 0.0167 0.0064 22 0.0163 0.0064 23 0.0154 0.0064 24 0.0148 0.0064 25 0.0146 0.0063 26 0.0145 0.0062 27 0.0142 0.0062 28 0.0142 0.0062 29 0.0134 0.0062 30 0.0132 0.0062 31 0.0131 0.0061 32 0.0125 0.0060 33 0.0121 0.0060 34 0.0117 0.0059 35 0.0116 0.0059 36 0.0115 0.0059 37 0.0114 0.0059 38 0.0113 0.0058 39 0.0110 0.0058 40 0.0109 0.0058 41 0.0107 0.0058 42 0.0106 0.0058 43 0.0102 0.0057 44 0.0101 0.0057 45 0.0100 0.0056 46 0.0098 0.0056 47 0.0097 0.0056 48 0.0094 0.0055 49 0.0094 0.0054 50 0.0092 0.0054 51 0.0090 0.0054 52 0.0089 0.0054 53 0.0089 0.0053 54 0.0079 0.0052 55 0.0074 0.0051 56 0.0061 0.0051 57 0.0057 0.0050 58 0.0054 0.0049 59 0.0043 0.0047 60 0.0040 0.0047 61 0.0026 0.0047 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 11 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 12 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0068 18448 6862 37 Pass 0.0072 16091 3258 20 Pass 0.0076 14316 1347 9 Pass 0.0080 12694 875 6 Pass 0.0084 11178 62 0 Pass 0.0088 9882 0 0 Pass 0.0092 8812 0 0 Pass 0.0096 7835 0 0 Pass 0.0100 7013 0 0 Pass 0.0104 6299 0 0 Pass 0.0108 5679 0 0 Pass 0.0112 5172 0 0 Pass 0.0116 4697 0 0 Pass 0.0120 4278 0 0 Pass 0.0124 3912 0 0 Pass 0.0128 3527 0 0 Pass 0.0132 3189 0 0 Pass 0.0136 2866 0 0 Pass 0.0140 2594 0 0 Pass 0.0144 2353 0 0 Pass 0.0148 2138 0 0 Pass 0.0152 1951 0 0 Pass 0.0156 1797 0 0 Pass 0.0160 1670 0 0 Pass 0.0164 1518 0 0 Pass 0.0168 1344 0 0 Pass 0.0172 1223 0 0 Pass 0.0176 1123 0 0 Pass 0.0180 1042 0 0 Pass 0.0184 969 0 0 Pass 0.0188 910 0 0 Pass 0.0192 839 0 0 Pass 0.0196 766 0 0 Pass 0.0200 705 0 0 Pass 0.0204 635 0 0 Pass 0.0208 570 0 0 Pass 0.0212 488 0 0 Pass 0.0216 425 0 0 Pass 0.0220 378 0 0 Pass 0.0224 341 0 0 Pass 0.0228 307 0 0 Pass 0.0232 271 0 0 Pass 0.0236 235 0 0 Pass 0.0240 196 0 0 Pass 0.0244 171 0 0 Pass 0.0248 145 0 0 Pass 0.0252 125 0 0 Pass 0.0256 107 0 0 Pass 0.0260 95 0 0 Pass 0.0264 84 0 0 Pass 0.0268 71 0 0 Pass 0.0272 61 0 0 Pass 0.0276 55 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 13 0.0280 45 0 0 Pass 0.0284 40 0 0 Pass 0.0288 37 0 0 Pass 0.0292 35 0 0 Pass 0.0296 29 0 0 Pass 0.0300 25 0 0 Pass 0.0304 22 0 0 Pass 0.0308 17 0 0 Pass 0.0312 15 0 0 Pass 0.0316 11 0 0 Pass 0.0320 9 0 0 Pass 0.0324 8 0 0 Pass 0.0328 8 0 0 Pass 0.0332 8 0 0 Pass 0.0336 7 0 0 Pass 0.0340 7 0 0 Pass 0.0344 7 0 0 Pass 0.0347 7 0 0 Pass 0.0351 7 0 0 Pass 0.0355 7 0 0 Pass 0.0359 7 0 0 Pass 0.0363 6 0 0 Pass 0.0367 5 0 0 Pass 0.0371 5 0 0 Pass 0.0375 5 0 0 Pass 0.0379 4 0 0 Pass 0.0383 4 0 0 Pass 0.0387 4 0 0 Pass 0.0391 4 0 0 Pass 0.0395 4 0 0 Pass 0.0399 4 0 0 Pass 0.0403 4 0 0 Pass 0.0407 4 0 0 Pass 0.0411 4 0 0 Pass 0.0415 4 0 0 Pass 0.0419 3 0 0 Pass 0.0423 3 0 0 Pass 0.0427 3 0 0 Pass 0.0431 3 0 0 Pass 0.0435 2 0 0 Pass 0.0439 2 0 0 Pass 0.0443 2 0 0 Pass 0.0447 2 0 0 Pass 0.0451 2 0 0 Pass 0.0455 2 0 0 Pass 0.0459 2 0 0 Pass 0.0463 1 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 14 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:53:42 PM Page 15 LID Report FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:10 PM Page 16 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:10 PM Page 17 Appendix Predeveloped Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:11 PM Page 18 Mitigated Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 19 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.wdm MESSU 25 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.MES 27 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.L61 28 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin SWALE #3 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 20 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 21 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin SWALE #3*** PERLND 10 0.35 COPY 501 12 PERLND 10 0.35 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 22 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 23 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.wdm MESSU 25 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.MES 27 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.L61 28 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Tank for Swale #3 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 24 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 25 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** TANK DET #3 *** PERLND 16 0.03 RCHRES 1 2 PERLND 16 0.03 RCHRES 1 3 IMPLND 11 0.32 RCHRES 1 5 ******Routing****** PERLND 16 0.03 COPY 1 12 IMPLND 11 0.32 COPY 1 15 PERLND 16 0.03 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Tank for Swale #-009 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 26 1 1 0.2 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 90 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.000000 0.000000 0.000000 0.033111 0.021675 0.000480 0.001001 0.066222 0.030480 0.001352 0.001415 0.099333 0.037118 0.002475 0.001733 0.132444 0.042613 0.003797 0.002002 0.165556 0.047365 0.005289 0.002238 0.198667 0.051579 0.006928 0.002451 0.231778 0.055379 0.008700 0.002648 0.264889 0.058845 0.010592 0.002831 0.298000 0.062033 0.012594 0.003002 0.331111 0.064984 0.014697 0.003165 0.364222 0.067728 0.016895 0.003319 0.397333 0.070291 0.019180 0.003467 0.430444 0.072690 0.021548 0.003608 0.463556 0.074943 0.023992 0.003745 0.496667 0.077061 0.026509 0.003876 0.529778 0.079056 0.029094 0.004003 0.562889 0.080937 0.031743 0.004126 0.596000 0.082711 0.034453 0.004246 0.629111 0.084385 0.037219 0.004362 0.662222 0.085965 0.040040 0.004476 0.695333 0.087457 0.042911 0.004586 0.728444 0.088864 0.045830 0.004694 0.761556 0.090190 0.048795 0.004800 0.794667 0.091440 0.051802 0.004903 0.827778 0.092616 0.054850 0.005004 0.860889 0.093721 0.057935 0.005103 0.894000 0.094757 0.061055 0.005200 0.927111 0.095727 0.064209 0.005296 0.960222 0.096633 0.067394 0.005389 0.993333 0.097476 0.070607 0.005481 1.026444 0.098258 0.073848 0.005572 1.059556 0.098980 0.077114 0.005661 1.092667 0.099645 0.080402 0.005749 1.125778 0.100252 0.083712 0.005835 1.158889 0.100803 0.087040 0.005921 1.192000 0.101300 0.090387 0.006005 1.225111 0.101742 0.093748 0.006087 1.258222 0.102130 0.097123 0.006169 1.291333 0.102465 0.100511 0.006250 1.324444 0.102748 0.103908 0.006329 1.357556 0.102979 0.107314 0.006408 1.390667 0.103158 0.110727 0.006486 1.423778 0.103286 0.114145 0.006562 1.456889 0.103363 0.117567 0.006638 1.490000 0.103388 0.120990 0.006713 1.523111 0.103363 0.124413 0.006788 1.556222 0.103286 0.127834 0.006861 1.589333 0.103158 0.131252 0.006934 1.622444 0.102979 0.134665 0.007005 1.655556 0.102748 0.138071 0.007077 1.688667 0.102465 0.141468 0.007147 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 27 1.721778 0.102130 0.144856 0.007217 1.754889 0.101742 0.148231 0.007286 1.788000 0.101300 0.151593 0.007354 1.821111 0.100803 0.154939 0.007422 1.854222 0.100252 0.158268 0.007489 1.887333 0.099645 0.161577 0.007556 1.920444 0.098980 0.164866 0.007622 1.953556 0.098258 0.168131 0.007687 1.986667 0.097476 0.171372 0.007752 2.019778 0.096633 0.174586 0.007816 2.052889 0.095727 0.177770 0.007880 2.086000 0.094757 0.180924 0.007943 2.119111 0.093721 0.184045 0.008006 2.152222 0.092616 0.187130 0.008068 2.185333 0.091440 0.190177 0.008130 2.218444 0.090190 0.193184 0.008192 2.251556 0.088864 0.196149 0.008253 2.284667 0.087457 0.199068 0.008313 2.317778 0.085965 0.201939 0.008373 2.350889 0.084385 0.204760 0.008433 2.384000 0.082711 0.207527 0.008492 2.417111 0.080937 0.210236 0.008551 2.450222 0.079056 0.212885 0.008609 2.483333 0.077061 0.215470 0.008667 2.516444 0.074943 0.217987 0.008725 2.549556 0.072690 0.220432 0.008782 2.582667 0.070291 0.222799 0.008839 2.615778 0.067728 0.225085 0.008895 2.648889 0.064984 0.227282 0.008951 2.682000 0.062033 0.229386 0.009007 2.715111 0.058845 0.231388 0.009062 2.748222 0.055379 0.233279 0.009117 2.781333 0.051579 0.235051 0.009172 2.814444 0.047365 0.236691 0.009227 2.847556 0.042613 0.238182 0.009281 2.880667 0.037118 0.239504 0.009335 2.913778 0.030480 0.240627 0.009388 2.946889 0.021675 0.241500 0.009441 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 28 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 29 Predeveloped HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 30 Mitigated HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #3 FINAL2/17/2020 6:54:13 PM Page 31 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com WWHM2012 PROJECT REPORT VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 2 General Model Information Project Name:VAULT MODEL EQUAL TO TANK #3 Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/25/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/09/13 Version:4.2.17 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year NOTE: THE VAULT MODEL WAS USED TO REVERIFY THE VOLUME OF REQUIRED STORAGE IN ORDER TO COMPARE THE STORAGE VOLUME PROVIDEDBY THE CONTECH'S CALCULATIONS FOR 1,080 LF OF 35" X 24" CAP VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin SWALE #3 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.35 Pervious Total 0.35 Impervious Land Use acre Impervious Total 0 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 4 Mitigated Land Use VAULT 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.03 Pervious Total 0.03 Impervious Land Use acre PARKING FLAT 0.32 Impervious Total 0.32 Basin Total 0.35 Element Flows To: Surface Interflow Groundwater Vault 1 Vault 1 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 5 Routing Elements Predeveloped Routing VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 6 Mitigated Routing Vault 1 Width:2.68 ft. Length:1029 ft. Depth:2.98 ft. Discharge Structure Riser Height:2.98 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.45 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Vault Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.063 0.000 0.000 0.000 0.0331 0.063 0.002 0.001 0.000 0.0662 0.063 0.004 0.001 0.000 0.0993 0.063 0.006 0.001 0.000 0.1324 0.063 0.008 0.002 0.000 0.1656 0.063 0.010 0.002 0.000 0.1987 0.063 0.012 0.002 0.000 0.2318 0.063 0.014 0.002 0.000 0.2649 0.063 0.016 0.002 0.000 0.2980 0.063 0.018 0.003 0.000 0.3311 0.063 0.021 0.003 0.000 0.3642 0.063 0.023 0.003 0.000 0.3973 0.063 0.025 0.003 0.000 0.4304 0.063 0.027 0.003 0.000 0.4636 0.063 0.029 0.003 0.000 0.4967 0.063 0.031 0.003 0.000 0.5298 0.063 0.033 0.004 0.000 0.5629 0.063 0.035 0.004 0.000 0.5960 0.063 0.037 0.004 0.000 0.6291 0.063 0.039 0.004 0.000 0.6622 0.063 0.041 0.004 0.000 0.6953 0.063 0.044 0.004 0.000 0.7284 0.063 0.046 0.004 0.000 0.7616 0.063 0.048 0.004 0.000 0.7947 0.063 0.050 0.004 0.000 0.8278 0.063 0.052 0.005 0.000 0.8609 0.063 0.054 0.005 0.000 0.8940 0.063 0.056 0.005 0.000 0.9271 0.063 0.058 0.005 0.000 0.9602 0.063 0.060 0.005 0.000 0.9933 0.063 0.062 0.005 0.000 1.0264 0.063 0.065 0.005 0.000 1.0596 0.063 0.067 0.005 0.000 1.0927 0.063 0.069 0.005 0.000 1.1258 0.063 0.071 0.005 0.000 1.1589 0.063 0.073 0.005 0.000 1.1920 0.063 0.075 0.006 0.000 1.2251 0.063 0.077 0.006 0.000 1.2582 0.063 0.079 0.006 0.000 1.2913 0.063 0.081 0.006 0.000 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 7 1.3244 0.063 0.083 0.006 0.000 1.3576 0.063 0.085 0.006 0.000 1.3907 0.063 0.088 0.006 0.000 1.4238 0.063 0.090 0.006 0.000 1.4569 0.063 0.092 0.006 0.000 1.4900 0.063 0.094 0.006 0.000 1.5231 0.063 0.096 0.006 0.000 1.5562 0.063 0.098 0.006 0.000 1.5893 0.063 0.100 0.006 0.000 1.6224 0.063 0.102 0.007 0.000 1.6556 0.063 0.104 0.007 0.000 1.6887 0.063 0.106 0.007 0.000 1.7218 0.063 0.109 0.007 0.000 1.7549 0.063 0.111 0.007 0.000 1.7880 0.063 0.113 0.007 0.000 1.8211 0.063 0.115 0.007 0.000 1.8542 0.063 0.117 0.007 0.000 1.8873 0.063 0.119 0.007 0.000 1.9204 0.063 0.121 0.007 0.000 1.9536 0.063 0.123 0.007 0.000 1.9867 0.063 0.125 0.007 0.000 2.0198 0.063 0.127 0.007 0.000 2.0529 0.063 0.130 0.007 0.000 2.0860 0.063 0.132 0.007 0.000 2.1191 0.063 0.134 0.008 0.000 2.1522 0.063 0.136 0.008 0.000 2.1853 0.063 0.138 0.008 0.000 2.2184 0.063 0.140 0.008 0.000 2.2516 0.063 0.142 0.008 0.000 2.2847 0.063 0.144 0.008 0.000 2.3178 0.063 0.146 0.008 0.000 2.3509 0.063 0.148 0.008 0.000 2.3840 0.063 0.150 0.008 0.000 2.4171 0.063 0.153 0.008 0.000 2.4502 0.063 0.155 0.008 0.000 2.4833 0.063 0.157 0.008 0.000 2.5164 0.063 0.159 0.008 0.000 2.5496 0.063 0.161 0.008 0.000 2.5827 0.063 0.163 0.008 0.000 2.6158 0.063 0.165 0.008 0.000 2.6489 0.063 0.167 0.008 0.000 2.6820 0.063 0.169 0.009 0.000 2.7151 0.063 0.171 0.009 0.000 2.7482 0.063 0.174 0.009 0.000 2.7813 0.063 0.176 0.009 0.000 2.8144 0.063 0.178 0.009 0.000 2.8476 0.063 0.180 0.009 0.000 2.8807 0.063 0.182 0.009 0.000 2.9138 0.063 0.184 0.009 0.000 2.9469 0.063 0.186 0.009 0.000 2.9800 0.063 0.188 0.009 0.000 3.0131 0.063 0.128 0.073 0.000 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:28:25 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.35 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.03 Total Impervious Area:0.32 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.013155 5 year 0.020984 10 year 0.026645 25 year 0.034239 50 year 0.040174 100 year 0.04632 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.006684 5 year 0.007692 10 year 0.008277 25 year 0.008951 50 year 0.009415 100 year 0.009853 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.017 0.006 1950 0.020 0.007 1951 0.028 0.009 1952 0.009 0.005 1953 0.008 0.007 1954 0.011 0.006 1955 0.018 0.006 1956 0.014 0.008 1957 0.013 0.006 1958 0.013 0.007 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 9 1959 0.011 0.006 1960 0.022 0.008 1961 0.011 0.007 1962 0.007 0.005 1963 0.011 0.006 1964 0.013 0.007 1965 0.010 0.008 1966 0.009 0.006 1967 0.021 0.007 1968 0.012 0.006 1969 0.012 0.006 1970 0.010 0.007 1971 0.012 0.007 1972 0.021 0.008 1973 0.010 0.008 1974 0.011 0.006 1975 0.016 0.006 1976 0.012 0.006 1977 0.004 0.006 1978 0.010 0.007 1979 0.006 0.005 1980 0.031 0.009 1981 0.009 0.006 1982 0.021 0.008 1983 0.015 0.006 1984 0.009 0.005 1985 0.005 0.006 1986 0.023 0.007 1987 0.021 0.008 1988 0.009 0.006 1989 0.006 0.006 1990 0.059 0.008 1991 0.026 0.008 1992 0.011 0.007 1993 0.011 0.005 1994 0.004 0.005 1995 0.014 0.007 1996 0.033 0.009 1997 0.026 0.009 1998 0.009 0.005 1999 0.036 0.009 2000 0.010 0.007 2001 0.003 0.005 2002 0.014 0.007 2003 0.019 0.006 2004 0.023 0.009 2005 0.015 0.006 2006 0.015 0.008 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0586 0.0094 2 0.0365 0.0089 3 0.0334 0.0089 4 0.0306 0.0088 5 0.0281 0.0087 6 0.0264 0.0085 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 10 7 0.0264 0.0083 8 0.0229 0.0083 9 0.0226 0.0082 10 0.0218 0.0082 11 0.0215 0.0080 12 0.0212 0.0079 13 0.0210 0.0078 14 0.0208 0.0076 15 0.0195 0.0075 16 0.0195 0.0075 17 0.0177 0.0074 18 0.0167 0.0072 19 0.0163 0.0072 20 0.0154 0.0072 21 0.0148 0.0071 22 0.0146 0.0070 23 0.0145 0.0069 24 0.0142 0.0068 25 0.0142 0.0068 26 0.0134 0.0068 27 0.0132 0.0067 28 0.0131 0.0066 29 0.0125 0.0066 30 0.0121 0.0065 31 0.0117 0.0065 32 0.0116 0.0065 33 0.0115 0.0064 34 0.0114 0.0064 35 0.0113 0.0064 36 0.0110 0.0063 37 0.0109 0.0063 38 0.0107 0.0063 39 0.0106 0.0062 40 0.0102 0.0062 41 0.0101 0.0062 42 0.0100 0.0061 43 0.0098 0.0061 44 0.0097 0.0060 45 0.0094 0.0060 46 0.0094 0.0059 47 0.0092 0.0058 48 0.0090 0.0057 49 0.0089 0.0057 50 0.0089 0.0057 51 0.0079 0.0055 52 0.0074 0.0054 53 0.0061 0.0053 54 0.0057 0.0053 55 0.0054 0.0052 56 0.0043 0.0049 57 0.0040 0.0048 58 0.0026 0.0047 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 11 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0066 18904 15483 81 Pass 0.0069 16641 10633 63 Pass 0.0073 14778 7233 48 Pass 0.0076 13315 4494 33 Pass 0.0079 12033 2881 23 Pass 0.0083 10740 1748 16 Pass 0.0086 9649 818 8 Pass 0.0090 8682 167 1 Pass 0.0093 7847 59 0 Pass 0.0096 7057 0 0 Pass 0.0100 6404 0 0 Pass 0.0103 5793 0 0 Pass 0.0106 5293 0 0 Pass 0.0110 4848 0 0 Pass 0.0113 4462 0 0 Pass 0.0117 4110 0 0 Pass 0.0120 3785 0 0 Pass 0.0123 3489 0 0 Pass 0.0127 3182 0 0 Pass 0.0130 2922 0 0 Pass 0.0134 2664 0 0 Pass 0.0137 2418 0 0 Pass 0.0140 2211 0 0 Pass 0.0144 2025 0 0 Pass 0.0147 1852 0 0 Pass 0.0151 1704 0 0 Pass 0.0154 1572 0 0 Pass 0.0157 1464 0 0 Pass 0.0161 1372 0 0 Pass 0.0164 1252 0 0 Pass 0.0168 1118 0 0 Pass 0.0171 1017 0 0 Pass 0.0174 953 0 0 Pass 0.0178 886 0 0 Pass 0.0181 836 0 0 Pass 0.0185 782 0 0 Pass 0.0188 738 0 0 Pass 0.0191 690 0 0 Pass 0.0195 643 0 0 Pass 0.0198 594 0 0 Pass 0.0202 544 0 0 Pass 0.0205 501 0 0 Pass 0.0208 444 0 0 Pass 0.0212 387 0 0 Pass 0.0215 344 0 0 Pass 0.0218 294 0 0 Pass 0.0222 270 0 0 Pass 0.0225 243 0 0 Pass 0.0229 214 0 0 Pass 0.0232 188 0 0 Pass 0.0235 160 0 0 Pass 0.0239 134 0 0 Pass 0.0242 118 0 0 Pass VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 12 0.0246 97 0 0 Pass 0.0249 81 0 0 Pass 0.0252 65 0 0 Pass 0.0256 55 0 0 Pass 0.0259 46 0 0 Pass 0.0263 38 0 0 Pass 0.0266 29 0 0 Pass 0.0269 24 0 0 Pass 0.0273 18 0 0 Pass 0.0276 15 0 0 Pass 0.0280 10 0 0 Pass 0.0283 8 0 0 Pass 0.0286 7 0 0 Pass 0.0290 7 0 0 Pass 0.0293 7 0 0 Pass 0.0297 7 0 0 Pass 0.0300 6 0 0 Pass 0.0303 6 0 0 Pass 0.0307 4 0 0 Pass 0.0310 4 0 0 Pass 0.0314 4 0 0 Pass 0.0317 4 0 0 Pass 0.0320 4 0 0 Pass 0.0324 4 0 0 Pass 0.0327 4 0 0 Pass 0.0330 4 0 0 Pass 0.0334 4 0 0 Pass 0.0337 3 0 0 Pass 0.0341 3 0 0 Pass 0.0344 3 0 0 Pass 0.0347 3 0 0 Pass 0.0351 3 0 0 Pass 0.0354 3 0 0 Pass 0.0358 3 0 0 Pass 0.0361 3 0 0 Pass 0.0364 3 0 0 Pass 0.0368 2 0 0 Pass 0.0371 2 0 0 Pass 0.0375 2 0 0 Pass 0.0378 2 0 0 Pass 0.0381 2 0 0 Pass 0.0385 2 0 0 Pass 0.0388 2 0 0 Pass 0.0392 2 0 0 Pass 0.0395 2 0 0 Pass 0.0398 2 0 0 Pass 0.0402 2 0 0 Pass VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 13 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:03 PM Page 14 LID Report VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:30 PM Page 15 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:30 PM Page 16 Appendix Predeveloped Schematic VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:32 PM Page 17 Mitigated Schematic VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 18 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 VAULT MODEL EQUAL TO TANK #3.wdm MESSU 25 PreVAULT MODEL EQUAL TO TANK #3.MES 27 PreVAULT MODEL EQUAL TO TANK #3.L61 28 PreVAULT MODEL EQUAL TO TANK #3.L62 30 POCVAULT MODEL EQUAL TO TANK #31.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin SWALE #3 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 19 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 20 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin SWALE #3*** PERLND 10 0.35 COPY 501 12 PERLND 10 0.35 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 21 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 22 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 VAULT MODEL EQUAL TO TANK #3.wdm MESSU 25 MitVAULT MODEL EQUAL TO TANK #3.MES 27 MitVAULT MODEL EQUAL TO TANK #3.L61 28 MitVAULT MODEL EQUAL TO TANK #3.L62 30 POCVAULT MODEL EQUAL TO TANK #31.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Vault 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 23 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 24 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** VAULT 1 *** PERLND 16 0.03 RCHRES 1 2 PERLND 16 0.03 RCHRES 1 3 IMPLND 11 0.32 RCHRES 1 5 ******Routing****** PERLND 16 0.03 COPY 1 12 IMPLND 11 0.32 COPY 1 15 PERLND 16 0.03 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Vault 1 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 25 1 1 0.19 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.063309 0.000000 0.000000 0.033111 0.063309 0.002096 0.001000 0.066222 0.063309 0.004192 0.001414 0.099333 0.063309 0.006289 0.001732 0.132444 0.063309 0.008385 0.002000 0.165556 0.063309 0.010481 0.002236 0.198667 0.063309 0.012577 0.002449 0.231778 0.063309 0.014674 0.002646 0.264889 0.063309 0.016770 0.002828 0.298000 0.063309 0.018866 0.003000 0.331111 0.063309 0.020962 0.003162 0.364222 0.063309 0.023058 0.003316 0.397333 0.063309 0.025155 0.003464 0.430444 0.063309 0.027251 0.003605 0.463556 0.063309 0.029347 0.003741 0.496667 0.063309 0.031443 0.003873 0.529778 0.063309 0.033539 0.004000 0.562889 0.063309 0.035636 0.004123 0.596000 0.063309 0.037732 0.004242 0.629111 0.063309 0.039828 0.004359 0.662222 0.063309 0.041924 0.004472 0.695333 0.063309 0.044021 0.004582 0.728444 0.063309 0.046117 0.004690 0.761556 0.063309 0.048213 0.004796 0.794667 0.063309 0.050309 0.004899 0.827778 0.063309 0.052405 0.005000 0.860889 0.063309 0.054502 0.005099 0.894000 0.063309 0.056598 0.005196 0.927111 0.063309 0.058694 0.005291 0.960222 0.063309 0.060790 0.005385 0.993333 0.063309 0.062886 0.005477 1.026444 0.063309 0.064983 0.005567 1.059556 0.063309 0.067079 0.005656 1.092667 0.063309 0.069175 0.005744 1.125778 0.063309 0.071271 0.005831 1.158889 0.063309 0.073368 0.005916 1.192000 0.063309 0.075464 0.006000 1.225111 0.063309 0.077560 0.006082 1.258222 0.063309 0.079656 0.006164 1.291333 0.063309 0.081752 0.006245 1.324444 0.063309 0.083849 0.006324 1.357556 0.063309 0.085945 0.006403 1.390667 0.063309 0.088041 0.006480 1.423778 0.063309 0.090137 0.006557 1.456889 0.063309 0.092234 0.006633 1.490000 0.063309 0.094330 0.006708 1.523111 0.063309 0.096426 0.006782 1.556222 0.063309 0.098522 0.006855 1.589333 0.063309 0.100618 0.006928 1.622444 0.063309 0.102715 0.007000 1.655556 0.063309 0.104811 0.007071 1.688667 0.063309 0.106907 0.007141 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 26 1.721778 0.063309 0.109003 0.007211 1.754889 0.063309 0.111099 0.007280 1.788000 0.063309 0.113196 0.007348 1.821111 0.063309 0.115292 0.007416 1.854222 0.063309 0.117388 0.007483 1.887333 0.063309 0.119484 0.007549 1.920444 0.063309 0.121581 0.007615 1.953556 0.063309 0.123677 0.007681 1.986667 0.063309 0.125773 0.007745 2.019778 0.063309 0.127869 0.007810 2.052889 0.063309 0.129965 0.007873 2.086000 0.063309 0.132062 0.007937 2.119111 0.063309 0.134158 0.007999 2.152222 0.063309 0.136254 0.008062 2.185333 0.063309 0.138350 0.008123 2.218444 0.063309 0.140446 0.008185 2.251556 0.063309 0.142543 0.008246 2.284667 0.063309 0.144639 0.008306 2.317778 0.063309 0.146735 0.008366 2.350889 0.063309 0.148831 0.008426 2.384000 0.063309 0.150928 0.008485 2.417111 0.063309 0.153024 0.008543 2.450222 0.063309 0.155120 0.008602 2.483333 0.063309 0.157216 0.008660 2.516444 0.063309 0.159312 0.008717 2.549556 0.063309 0.161409 0.008774 2.582667 0.063309 0.163505 0.008831 2.615778 0.063309 0.165601 0.008888 2.648889 0.063309 0.167697 0.008944 2.682000 0.063309 0.169794 0.008999 2.715111 0.063309 0.171890 0.009055 2.748222 0.063309 0.173986 0.009110 2.781333 0.063309 0.176082 0.009165 2.814444 0.063309 0.178178 0.009219 2.847556 0.063309 0.180275 0.009273 2.880667 0.063309 0.182371 0.009327 2.913778 0.063309 0.184467 0.009380 2.946889 0.063309 0.186563 0.009433 2.980000 0.063309 0.188659 0.009486 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1002 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1003 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 27 END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 28 Predeveloped HSPF Message File VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:33 PM Page 29 Mitigated HSPF Message File ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 21: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8233.7 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 21: 0 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -6.464E+03 1.1719 1.1719 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 21:15 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8247.3 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 21:15 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -7.285E+03 1.3209 1.3209E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 21:30 RCHRES: 1 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 30 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8258.2 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 21:30 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -7.946E+03 1.4407 1.4407 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 21:45 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8268.7 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 21:45 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -8.577E+03 1.5551 1.5551E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 22: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8279.0 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 31 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 22: 0 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.201E+03 1.6682 1.6682E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 22:15 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8289.1 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 22:15 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.810E+03 1.7786 1.7786 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 22:30 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8297.6 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 22:30 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 32 Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.032E+04 1.8720 1.8720 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 22:45 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8302.3 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 22:45 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.061E+04 1.9235 1.9235E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 23: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8304.4 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 23: 0 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.073E+04 1.9463 1.9463E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 23:15 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 33 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8304.6 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 23:15 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.075E+04 1.9487 1.9487E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 23:30 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8303.5 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 23:30 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.068E+04 1.9362 1.9362E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 23:45 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 34 NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8301.3 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 23:45 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.055E+04 1.9126 1.9126E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 6 24: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8298.4 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 6 24: 0 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.037E+04 1.8804 1.8804 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 0:15 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8294.8 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 0:15 RCHRES: 1 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 35 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.016E+04 1.8415 1.8415E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 0:30 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8292.0 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 0:30 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.989E+03 1.8110 1.8110E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 0:45 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8292.1 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 0:45 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.995E+03 1.8122 1.8122 2 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 36 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 1: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8126.7 8218.0 8293.3 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 1: 0 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.007E+04 1.8250 1.8249E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 1:15 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8292.8 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 1:15 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -1.004E+04 1.8198 1.8198E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 1:30 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 37 simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8291.7 ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 1:30 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.966E+03 1.8069 1.8069E+00 2 ERROR/WARNING ID: 341 6 DATE/TIME: 2006/11/ 7 1:45 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 8.1267E+03 8218.0 8292.2 The count for the WARNING printed above has reached its maximum. If the condition is encountered again the message will not be repeated. ERROR/WARNING ID: 341 5 DATE/TIME: 2006/11/ 7 1:45 RCHRES: 1 Calculation of relative depth, using Newton's method of successive approximations, converged to an invalid value (not in range 0.0 to 1.0). Probably ftable was extrapolated. If extrapolation was small, no problem. Remedy; extend ftable. Relevant data are: A B C RDEP1 RDEP2 COUNT 0.0000E+00 5515.5 -9.997E+03 1.8126 1.8125E+00 2 VAULT MODEL EQUAL TO TANK #3 2/25/2020 2:29:34 PM Page 38 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com Date: Project Name: City / County: State: Designed By: Company: Telephone: Storage Volume Required (cf):7,275 Limiting Width (ft):30.00 3.50 Solid or Perforated Pipe:Perforated Shape Or Diameter (in):35x24 4.50 ft2 Pipe Area Number Of Headers:1 Spacing between Barrels (ft):1.25 Stone Width Around Perimeter of System (ft):0.625 Depth A: Porous Stone Above Pipe (in):18 Depth C: Porous Stone Below Pipe (in):0 Stone Porosity (0 to 40%):40 System Sizing Pipe Storage:3,874 cf Porous Stone Storage:3,480 cf 7,354 cf 101.1%Of Required Storage Barrel 12 7 barrels Barrel 11 Length per Barrel:119.0 ft Barrel 10 Length Per Header:27.9 ft Barrel 9 Rectangular Footprint (W x L):29.17 ft x 123.17 ft Barrel 8 CONTECH Materials Barrel 7 Total CMP Footage:861 ft Barrel 6 Approximate Total Pieces:44 pcs Barrel 5 Approximate Coupling Bands:43 bands Barrel 4 Approximate Truckloads:3 trucks Barrel 3 Construction Quantities**Barrel 2 Total Excavation:466 cy Barrel 1 Porous Stone Backfill For Storage:322 cy stone Backfill to Grade Excluding Stone:0 cy fill **Construction quantities are approximate and should be verified upon final design Number Of Barrels Exceed Graph Limitations SP Project Summary 425462-9441 2/19/2020 Corrugated Metal Pipe Calculator Enter Information in Blue Cells FUPC BASIN #4_ FINAL PC RENTON ABOSSEIN WA Total Storage Provided: Number of Barrels: Invert Depth Below Asphalt (ft): System Layout 119 119 119 119 119 119 119 0 0 0 0 0 Barrel Footage (w/o headers) For design assistance, drawings, and pricing send completed worksheet to: dyods@contech-cpi.com © 2007 CONTECH Stormwater Solutions WWHM2012 PROJECT REPORT FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 2 General Model Information Project Name:FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL Site Name:FUPC Site Address:3812 NE 21ST STREET City:RENTON Report Date:2/19/2020 Gage:Seatac Data Start:1948/10/01 Data End:2009/09/30 Timestep:15 Minute Precip Scale:0.000 (adjusted) Version Date:2019/04/19 Version:4.2.16 POC Thresholds Low Flow Threshold for POC1:50 Percent of the 2 Year High Flow Threshold for POC1:50 Year FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Forest, Flat 0.4 Pervious Total 0.4 Impervious Land Use acre Impervious Total 0 Basin Total 0.4 Element Flows To: Surface Interflow Groundwater FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 4 Mitigated Land Use Basin 1 Bypass:No GroundWater:No Pervious Land Use acre C, Lawn, Flat 0.21 Pervious Total 0.21 Impervious Land Use acre PARKING FLAT 0.19 Impervious Total 0.19 Basin Total 0.4 Element Flows To: Surface Interflow Groundwater Tank for Swale #4 Tank for Swale #4 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 5 Routing Elements Predeveloped Routing FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 6 Mitigated Routing Tank for Swale #4 Dimensions Depth:3.5 ft. Tank Type:Arched Width:4.17 ft. Height:3.5 ft. Length:635 ft. Discharge Structure Riser Height:3.5 ft. Riser Diameter:12 in. Orifice 1 Diameter:0.45 in.Elevation:0 ft. Element Flows To: Outlet 1 Outlet 2 Tank Hydraulic Table Stage(feet)Area(ac.)Volume(ac-ft.)Discharge(cfs)Infilt(cfs) 0.0000 0.000 0.000 0.000 0.000 0.0389 0.012 0.000 0.001 0.000 0.0778 0.017 0.000 0.001 0.000 0.1167 0.021 0.001 0.001 0.000 0.1556 0.025 0.002 0.002 0.000 0.1944 0.027 0.003 0.002 0.000 0.2333 0.030 0.004 0.002 0.000 0.2722 0.032 0.006 0.002 0.000 0.3111 0.034 0.007 0.003 0.000 0.3500 0.036 0.008 0.003 0.000 0.3889 0.038 0.010 0.003 0.000 0.4278 0.039 0.011 0.003 0.000 0.4667 0.041 0.013 0.003 0.000 0.5056 0.042 0.014 0.003 0.000 0.5444 0.044 0.016 0.004 0.000 0.5833 0.045 0.018 0.004 0.000 0.6222 0.046 0.020 0.004 0.000 0.6611 0.047 0.021 0.004 0.000 0.7000 0.048 0.023 0.004 0.000 0.7389 0.049 0.025 0.004 0.000 0.7778 0.050 0.027 0.004 0.000 0.8167 0.051 0.029 0.005 0.000 0.8556 0.052 0.031 0.005 0.000 0.8944 0.053 0.033 0.005 0.000 0.9333 0.053 0.035 0.005 0.000 0.9722 0.054 0.037 0.005 0.000 1.0111 0.055 0.040 0.005 0.000 1.0500 0.055 0.042 0.005 0.000 1.0889 0.056 0.044 0.005 0.000 1.1278 0.056 0.046 0.005 0.000 1.1667 0.057 0.048 0.005 0.000 1.2056 0.057 0.051 0.006 0.000 1.2444 0.058 0.053 0.006 0.000 1.2833 0.058 0.055 0.006 0.000 1.3222 0.058 0.057 0.006 0.000 1.3611 0.059 0.060 0.006 0.000 1.4000 0.059 0.062 0.006 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 7 1.4389 0.059 0.064 0.006 0.000 1.4778 0.060 0.067 0.006 0.000 1.5167 0.060 0.069 0.006 0.000 1.5556 0.060 0.071 0.006 0.000 1.5944 0.060 0.074 0.006 0.000 1.6333 0.060 0.076 0.007 0.000 1.6722 0.060 0.078 0.007 0.000 1.7111 0.060 0.081 0.007 0.000 1.7500 0.060 0.083 0.007 0.000 1.7889 0.060 0.085 0.007 0.000 1.8278 0.060 0.088 0.007 0.000 1.8667 0.060 0.090 0.007 0.000 1.9056 0.060 0.093 0.007 0.000 1.9444 0.060 0.095 0.007 0.000 1.9833 0.060 0.097 0.007 0.000 2.0222 0.060 0.100 0.007 0.000 2.0611 0.059 0.102 0.007 0.000 2.1000 0.059 0.104 0.008 0.000 2.1389 0.059 0.107 0.008 0.000 2.1778 0.058 0.109 0.008 0.000 2.2167 0.058 0.111 0.008 0.000 2.2556 0.058 0.113 0.008 0.000 2.2944 0.057 0.116 0.008 0.000 2.3333 0.057 0.118 0.008 0.000 2.3722 0.056 0.120 0.008 0.000 2.4111 0.056 0.122 0.008 0.000 2.4500 0.055 0.124 0.008 0.000 2.4889 0.055 0.127 0.008 0.000 2.5278 0.054 0.129 0.008 0.000 2.5667 0.053 0.131 0.008 0.000 2.6056 0.053 0.133 0.008 0.000 2.6444 0.052 0.135 0.008 0.000 2.6833 0.051 0.137 0.009 0.000 2.7222 0.050 0.139 0.009 0.000 2.7611 0.049 0.141 0.009 0.000 2.8000 0.048 0.143 0.009 0.000 2.8389 0.047 0.145 0.009 0.000 2.8778 0.046 0.147 0.009 0.000 2.9167 0.045 0.148 0.009 0.000 2.9556 0.044 0.150 0.009 0.000 2.9944 0.042 0.152 0.009 0.000 3.0333 0.041 0.153 0.009 0.000 3.0722 0.039 0.155 0.009 0.000 3.1111 0.038 0.157 0.009 0.000 3.1500 0.036 0.158 0.009 0.000 3.1889 0.034 0.159 0.009 0.000 3.2278 0.032 0.161 0.009 0.000 3.2667 0.030 0.162 0.009 0.000 3.3056 0.027 0.163 0.010 0.000 3.3444 0.025 0.164 0.010 0.000 3.3833 0.021 0.165 0.010 0.000 3.4222 0.017 0.166 0.010 0.000 3.4611 0.012 0.166 0.010 0.000 3.5000 0.000 0.167 0.010 0.000 3.5389 0.000 0.000 0.091 0.000 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:13:38 PM Page 8 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area:0.4 Total Impervious Area:0 Mitigated Landuse Totals for POC #1 Total Pervious Area:0.21 Total Impervious Area:0.19 Flow Frequency Method:Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.014038 5 year 0.022056 10 year 0.028213 25 year 0.036966 50 year 0.044204 100 year 0.052067 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.006675 5 year 0.007591 10 year 0.008131 25 year 0.008758 50 year 0.009194 100 year 0.009609 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.019 0.006 1950 0.022 0.007 1951 0.032 0.009 1952 0.011 0.005 1953 0.009 0.007 1954 0.013 0.007 1955 0.020 0.006 1956 0.017 0.008 1957 0.015 0.007 1958 0.015 0.007 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 9 1959 0.013 0.006 1960 0.025 0.009 1961 0.012 0.007 1962 0.008 0.005 1963 0.012 0.007 1964 0.015 0.007 1965 0.011 0.008 1966 0.010 0.006 1967 0.024 0.007 1968 0.014 0.006 1969 0.013 0.006 1970 0.011 0.007 1971 0.014 0.007 1972 0.025 0.008 1973 0.012 0.008 1974 0.013 0.007 1975 0.019 0.006 1976 0.013 0.007 1977 0.005 0.005 1978 0.011 0.007 1979 0.007 0.005 1980 0.035 0.009 1981 0.010 0.007 1982 0.024 0.008 1983 0.017 0.007 1984 0.011 0.006 1985 0.006 0.006 1986 0.026 0.007 1987 0.024 0.008 1988 0.010 0.006 1989 0.006 0.006 1990 0.067 0.008 1991 0.030 0.008 1992 0.013 0.007 1993 0.012 0.006 1994 0.005 0.005 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0669 0.0093 2 0.0350 0.0091 3 0.0321 0.0085 4 0.0301 0.0085 5 0.0261 0.0084 6 0.0249 0.0081 7 0.0245 0.0080 8 0.0243 0.0078 9 0.0240 0.0076 10 0.0237 0.0076 11 0.0223 0.0075 12 0.0203 0.0073 13 0.0191 0.0071 14 0.0186 0.0071 15 0.0167 0.0070 16 0.0165 0.0070 17 0.0153 0.0069 18 0.0151 0.0069 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 10 19 0.0149 0.0069 20 0.0142 0.0068 21 0.0139 0.0068 22 0.0134 0.0067 23 0.0132 0.0067 24 0.0131 0.0066 25 0.0131 0.0066 26 0.0129 0.0066 27 0.0126 0.0065 28 0.0125 0.0065 29 0.0122 0.0065 30 0.0122 0.0064 31 0.0116 0.0063 32 0.0114 0.0063 33 0.0112 0.0063 34 0.0111 0.0062 35 0.0108 0.0059 36 0.0105 0.0059 37 0.0103 0.0059 38 0.0102 0.0058 39 0.0101 0.0057 40 0.0091 0.0056 41 0.0085 0.0056 42 0.0069 0.0054 43 0.0065 0.0053 44 0.0062 0.0053 45 0.0050 0.0051 46 0.0046 0.0050 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 11 Duration Flows The Facility PASSED Flow(cfs)Predev Mit Percentage Pass/Fail 0.0070 16632 9130 54 Pass 0.0074 14557 6016 41 Pass 0.0078 12813 3416 26 Pass 0.0081 11337 1838 16 Pass 0.0085 10141 922 9 Pass 0.0089 9160 543 5 Pass 0.0093 8144 38 0 Pass 0.0096 7225 0 0 Pass 0.0100 6416 0 0 Pass 0.0104 5752 0 0 Pass 0.0108 5149 0 0 Pass 0.0112 4594 0 0 Pass 0.0115 4132 0 0 Pass 0.0119 3745 0 0 Pass 0.0123 3384 0 0 Pass 0.0127 3090 0 0 Pass 0.0130 2837 0 0 Pass 0.0134 2611 0 0 Pass 0.0138 2381 0 0 Pass 0.0142 2179 0 0 Pass 0.0145 1980 0 0 Pass 0.0149 1818 0 0 Pass 0.0153 1674 0 0 Pass 0.0157 1543 0 0 Pass 0.0160 1410 0 0 Pass 0.0164 1302 0 0 Pass 0.0168 1218 0 0 Pass 0.0172 1125 0 0 Pass 0.0175 1035 0 0 Pass 0.0179 959 0 0 Pass 0.0183 899 0 0 Pass 0.0187 828 0 0 Pass 0.0190 757 0 0 Pass 0.0194 696 0 0 Pass 0.0198 648 0 0 Pass 0.0202 599 0 0 Pass 0.0205 559 0 0 Pass 0.0209 524 0 0 Pass 0.0213 489 0 0 Pass 0.0217 463 0 0 Pass 0.0220 425 0 0 Pass 0.0224 387 0 0 Pass 0.0228 359 0 0 Pass 0.0232 321 0 0 Pass 0.0235 290 0 0 Pass 0.0239 262 0 0 Pass 0.0243 228 0 0 Pass 0.0247 202 0 0 Pass 0.0250 178 0 0 Pass 0.0254 159 0 0 Pass 0.0258 145 0 0 Pass 0.0262 128 0 0 Pass 0.0266 112 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 12 0.0269 100 0 0 Pass 0.0273 84 0 0 Pass 0.0277 74 0 0 Pass 0.0281 59 0 0 Pass 0.0284 47 0 0 Pass 0.0288 44 0 0 Pass 0.0292 39 0 0 Pass 0.0296 34 0 0 Pass 0.0299 32 0 0 Pass 0.0303 27 0 0 Pass 0.0307 20 0 0 Pass 0.0311 15 0 0 Pass 0.0314 13 0 0 Pass 0.0318 9 0 0 Pass 0.0322 6 0 0 Pass 0.0326 4 0 0 Pass 0.0329 4 0 0 Pass 0.0333 4 0 0 Pass 0.0337 4 0 0 Pass 0.0341 4 0 0 Pass 0.0344 4 0 0 Pass 0.0348 3 0 0 Pass 0.0352 2 0 0 Pass 0.0356 2 0 0 Pass 0.0359 2 0 0 Pass 0.0363 2 0 0 Pass 0.0367 2 0 0 Pass 0.0371 2 0 0 Pass 0.0374 2 0 0 Pass 0.0378 2 0 0 Pass 0.0382 2 0 0 Pass 0.0386 2 0 0 Pass 0.0389 2 0 0 Pass 0.0393 2 0 0 Pass 0.0397 2 0 0 Pass 0.0401 2 0 0 Pass 0.0404 2 0 0 Pass 0.0408 2 0 0 Pass 0.0412 2 0 0 Pass 0.0416 2 0 0 Pass 0.0420 2 0 0 Pass 0.0423 2 0 0 Pass 0.0427 2 0 0 Pass 0.0431 2 0 0 Pass 0.0435 2 0 0 Pass 0.0438 2 0 0 Pass 0.0442 2 0 0 Pass FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 13 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume:0.0596 acre-feet On-line facility target flow:0.037 cfs. Adjusted for 15 min:0.037 cfs. Off-line facility target flow:0.027 cfs. Adjusted for 15 min:0.027 cfs. FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:10 PM Page 14 LID Report FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:33 PM Page 15 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:33 PM Page 16 Appendix Predeveloped Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:34 PM Page 17 Mitigated Schematic FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 18 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.wdm MESSU 25 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.MES 27 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.L61 28 PreFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 19 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 20 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 10 0.4 COPY 501 12 PERLND 10 0.4 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 21 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 22 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.wdm MESSU 25 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.MES 27 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.L61 28 MitFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL.L62 30 POCFUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 11 RCHRES 1 COPY 1 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Tank for Swale #4 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 23 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 11 PARKING/FLAT 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 11 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 11 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 11 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 11 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 24 # - # ***PETMAX PETMIN 11 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 11 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.21 RCHRES 1 2 PERLND 16 0.21 RCHRES 1 3 IMPLND 11 0.19 RCHRES 1 5 ******Routing****** PERLND 16 0.21 COPY 1 12 IMPLND 11 0.19 COPY 1 15 PERLND 16 0.21 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Tank for Swale #-009 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 25 1 1 0.12 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.000000 0.000000 0.000000 0.038889 0.012744 0.000331 0.001084 0.077778 0.017921 0.000933 0.001533 0.116667 0.021824 0.001709 0.001877 0.155556 0.025055 0.002622 0.002167 0.194444 0.027849 0.003652 0.002423 0.233333 0.030327 0.004784 0.002654 0.272222 0.032561 0.006008 0.002867 0.311111 0.034599 0.007314 0.003065 0.350000 0.036473 0.008697 0.003251 0.388889 0.038208 0.010149 0.003427 0.427778 0.039822 0.011667 0.003594 0.466667 0.041328 0.013245 0.003754 0.505556 0.042739 0.014880 0.003907 0.544444 0.044064 0.016568 0.004055 0.583333 0.045309 0.018306 0.004197 0.622222 0.046482 0.020091 0.004335 0.661111 0.047588 0.021921 0.004468 0.700000 0.048631 0.023792 0.004598 0.738889 0.049615 0.025702 0.004724 0.777778 0.050544 0.027650 0.004846 0.816667 0.051421 0.029633 0.004966 0.855556 0.052249 0.031649 0.005083 0.894444 0.053029 0.033696 0.005197 0.933333 0.053763 0.035773 0.005309 0.972222 0.054455 0.037877 0.005418 1.011111 0.055104 0.040007 0.005526 1.050000 0.055714 0.042162 0.005631 1.088889 0.056284 0.044340 0.005734 1.127778 0.056816 0.046539 0.005836 1.166667 0.057312 0.048759 0.005935 1.205556 0.057772 0.050997 0.006034 1.244444 0.058197 0.053252 0.006130 1.283333 0.058587 0.055523 0.006225 1.322222 0.058944 0.057808 0.006319 1.361111 0.059269 0.060107 0.006411 1.400000 0.059560 0.062417 0.006502 1.438889 0.059820 0.064739 0.006592 1.477778 0.060049 0.067070 0.006680 1.516667 0.060246 0.069409 0.006768 1.555556 0.060412 0.071755 0.006854 1.594444 0.060548 0.074107 0.006939 1.633333 0.060653 0.076464 0.007023 1.672222 0.060728 0.078824 0.007106 1.711111 0.060774 0.081187 0.007188 1.750000 0.060789 0.083551 0.007269 1.788889 0.060774 0.085914 0.007350 1.827778 0.060728 0.088277 0.007429 1.866667 0.060653 0.090637 0.007508 1.905556 0.060548 0.092994 0.007586 1.944444 0.060412 0.095346 0.007663 1.983333 0.060246 0.097693 0.007739 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 26 2.022222 0.060049 0.100032 0.007814 2.061111 0.059820 0.102363 0.007889 2.100000 0.059560 0.104684 0.007963 2.138889 0.059269 0.106995 0.008037 2.177778 0.058944 0.109293 0.008109 2.216667 0.058587 0.111579 0.008182 2.255556 0.058197 0.113850 0.008253 2.294444 0.057772 0.116105 0.008324 2.333333 0.057312 0.118343 0.008394 2.372222 0.056816 0.120562 0.008464 2.411111 0.056284 0.122761 0.008533 2.450000 0.055714 0.124939 0.008601 2.488889 0.055104 0.127094 0.008669 2.527778 0.054455 0.129224 0.008737 2.566667 0.053763 0.131329 0.008804 2.605556 0.053029 0.133405 0.008870 2.644444 0.052249 0.135453 0.008936 2.683333 0.051421 0.137469 0.009002 2.722222 0.050544 0.139451 0.009067 2.761111 0.049615 0.141399 0.009131 2.800000 0.048631 0.143310 0.009195 2.838889 0.047588 0.145181 0.009259 2.877778 0.046482 0.147010 0.009322 2.916667 0.045309 0.148795 0.009385 2.955556 0.044064 0.150533 0.009447 2.994444 0.042739 0.152221 0.009509 3.033333 0.041328 0.153856 0.009571 3.072222 0.039822 0.155435 0.009632 3.111111 0.038208 0.156952 0.009693 3.150000 0.036473 0.158405 0.009753 3.188889 0.034599 0.159787 0.009813 3.227778 0.032561 0.161094 0.009873 3.266667 0.030327 0.162317 0.009932 3.305556 0.027849 0.163449 0.009991 3.344444 0.025055 0.164479 0.010050 3.383333 0.021824 0.165392 0.010108 3.422222 0.017921 0.166168 0.010166 3.461111 0.012744 0.166770 0.010223 3.500000 0.001000 0.167101 0.010281 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1.167 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1.167 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 27 END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 28 Predeveloped HSPF Message File FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 29 Mitigated HSPF Message File ERROR/WARNING ID: 341 6 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The volume of water in this reach/mixed reservoir is greater than the value in the "volume" column of the last row of RCHTAB(). To continue the simulation the table has been extrapolated, based on information contained in the last two rows. This will usually result in some loss of accuracy. If depth is being calculated it will also cause an error condition. Relevant data are: NROWS V1 V2 VOL 91 7264.5 7278.9 7282.2 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 1.2821 5.3574E-01 101 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.53574 1.0427E+00 102 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.0427 4.0730E+00 103 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 30 -5.116E+02 1110.3 -732.97 4.0730 2.5363 104 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 2.5363 1.7228E+00 105 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.7228 1.2038 106 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 1.2038 6.9146E-02 107 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.06915 0.70276 108 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 0.70276 1.2277E+00 109 ERROR/WARNING ID: 341 4 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 31 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.2277 2.6118E-01 110 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.26118 0.82805 111 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 0.82805 1.4530E+00 112 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.4530 9.2213E-01 113 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.92213 1.7865E+00 114 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 32 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.7865 1.2538E+00 115 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.2539 4.1298E-01 116 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.41298 9.3893E-01 117 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 0.93893 1.8849 118 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: A B C RDEP1 RDEP2 COUNT -511.57 1110.3 -732.97 1.8849 1.3254E+00 119 ERROR/WARNING ID: 341 4 DATE/TIME: 1997/ 1/ 2 12: 0 RCHRES: 1 The calculation of relative depth in subroutine AUXIL, using Newton's method of successive approximations, did not converge. Probable reason -- unusual or bad entries in RCHTAB. Relevant data are: FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 33 A B C RDEP1 RDEP2 COUNT -5.116E+02 1110.3 -732.97 1.3254 6.7416E-01 120 FUPC LARGE LOT_DET TANK FROM BF SWALE #4 FINAL2/19/2020 1:14:36 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment B CONTECH Details and Specifications Buoyancy Calculations 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXVVVCEMVDVVVVFNVWVVVVGPVWVVVVHRVWVVVVJSVWVVVVKTVWVVVVLUVWAB35" x 24" BULKHEADw/ 12"Ø STUB TYP. OF 7VVVVVVVVVVVVVVXXXXXXX28'-034"70'-012"6"Ø STUB C189'-1114"6"Ø STUB D1105'-5"24"Ø RISERE1, F1, G1, H1, J1, K1, L1207'-1114"1'-3" TYP.7-1/2" STONE PERIMETER205'-0"JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-10-CMP DETENTION\DRAWINGS\624723-010-CMP CONFAB.DWG 3/3/2020 8:22 AM SHEET NO.:45OFJMDDATE:PROJECT No.:624723SEQ. No.:010PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-010FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC SUBBASIN #1The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comMARKDATEREVISION DESCRIPTIONBY BAND, TYPICALSEE DETAIL SHEET P3NOTES·ALL RISER AND STUB DIMENSIONS ARE TO CENTERLINE.·ALL ELEVATIONS, DIMENSIONS, AND LOCATIONS OF RISERS AND INLETS, SHALL BE VERIFIEDBY THE ENGINEER OF RECORD (EOR) PRIOR TO RELEASING FOR FABRICATION.· ALL FITTINGS AND REINFORCEMENT COMPLY WITH ASTM A998.· ALL RISERS AND STUBS ARE 223" x 12" CORRUGATION AND 16 GAGE UNLESS OTHERWISENOTED.·RISERS TO BE FIELD TRIMMED TO GRADE AS REQUIRED, BY CONTRACTOR.·QUANTITY OF PIPE SHOWN DOES NOT PROVIDE EXTRA PIPE FOR CONNECTING THE SYSTEM TOEXISTING PIPE OR DRAINAGE STRUCTURES. OUR SYSTEM AS DETAILED PROVIDES NOMINALINLET AND/OR OUTLET PIPE STUB FOR CONNECTION TO EXISTING DRAINAGE FACILITIES. IFADDITIONAL PIPE IS NEEDED IT IS THE RESPONSIBILITY OF THE CONTRACTOR.·ALL ACCESS CASTINGS ARE THE RESPONSIBILITY OF THE CONTRACTOR AND ARE NOTSUPPLIED BY CONTECH.ASSEMBLYSCALE: 1" = 20'PIPE STORAGE: 6583 CFLOADING: H20PIPE INV. = 428.99'±2/28/2020THE UNDERSIGNED HEREBY APPROVES THE ATTACHED(5) PAGES INCLUDING THE FOLLOWING:CUSTOMER·PIPE STORAGE = 6583 CF·MAINLINE PIPE GAGE = 16·WALL TYPE = PERFORATED·DIAMETER = 35" X 24"·FINISH = ALT2·CORRUGATION = 2 2/3x1/2DATESTUB INFORMATIONPIECESTUB INVERTSYSTEMINVERT12"Ø STUB C1428.99428.9912"Ø STUB D1428.99428.9912"Ø STUB M2428.99428.9912"Ø STUB N2428.99428.9912"Ø STUB P2428.99428.9912"Ø STUB R2428.99428.9912"Ø STUB S2428.99428.9912"Ø STUB T2428.99428.9912"Ø STUB U2428.99428.99RISER INFORMATIONPIECERIM ELEV.SYSTEMINVERT24"Ø RISER E1433.73428.9924"Ø RISER F1433.73428.9924"Ø RISER G1433.73428.9924"Ø RISER H1433.73428.9924"Ø RISER J1433.73428.9924"Ø RISER K1433.73428.9924"Ø RISER L1433.73428.9965TOTAL STORAGE = PIPE STORAGE + ROCK STORAGETOTAL STORAGE PROVIDED = 11,003 CF 1.50"2.8"COIL WIDTHOPEN AREA = 3.76 SQ IN/SQ FTNOTES:1.PERFORATIONS MEET AASHTO AND ASTM SPECIFICATIONS.2.PERFORATION OPEN AREA PER SQUARE FOOT OF PIPE IS BASEDON THE NOMINAL DIAMETER AND LENGTH OF PIPE.3.DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.4.ALL HOLES 3/8"Ø.EXFILTRATION AREASTANDARD PERFORATION PATTERNSAPPROXIMATE AREA PER LINEAR FOOT OF PIPEPIPECORRUGATION PATTERN2 2/3" x 1/2"3" x 1"5" x 1"ULTRA FLO30"Ø30.5 SQ. IN.32.3 SQ. IN.NOTES:·GAGE AND COATING LIMITATIONS APPLY. 5" x 1" IS NOT AVAILABLE INALUMINUM.·DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.TYPICAL PERFORATION DETAILNOT TO SCALETYPICAL SECTION VIEWNOT TO SCALENOTE: IF SALTING AGENTS FOR SNOW AND ICE REMOVAL ARE USED ON OR NEAR THEPROJECT, A GEOMEMBRANE BARRIER IS RECOMMENDED WITH THE SYSTEM. THEGEOMEMBRANE LINER IS INTENDED TO HELP PROTECT THE SYSTEM FROM THEPOTENTIAL ADVERSE EFFECTS THAT MAY RESULT FROM A CHANGE IN THESURROUNDING ENVIRONMENT OVER A PERIOD OF TIME. PLEASE REFER TO THECORRUGATED METAL PIPE DETENTION DESIGN GUIDE FOR ADDITIONAL INFORMATION.35" x 24" TYP.15"TYP.15" SEE TYPICALBACKFILL DETAILNOTESLIMITS OFREQUIREDBACKFILL20 MIL PEIMPERMEABLELINER OVERTOP OF PIPE(IF REQUIRED)LIVE LOADS NOT TO EXCEED CONVENTIONAL HIGHWAY LOADS.1MINIMUM TRENCH WIDTH MUST ALLOW ROOM FOR PROPER COMPACTION OF HAUNCH MATERIALS UNDER THE PIPE ARCH. THE TRENCH WIDTH IS THE MINIMUM AMOUNT REQUIRED FOR PROPER INSTALLATION AND TO SUPPORT HORIZONTAL PRESSURE FROM THEPIPE. THE MANUFACTURER'S SUGGESTED MINIMUM VALUE IS: 1.5S + 12".1aMINIMUM EMBANKMENT WIDTH (IN FEET) FOR INITIAL FILL ENVELOPE:3.0S BUT NO LESS THAN S + 4'0".2FOUNDATION SHALL BE WELL CONSOLIDATED, STABLE & CAPABLE OF SUPPORTING FILL MATERIAL LOAD.3OPEN-GRADED GRANULAR BEDDING MATERIAL SHALL BE A RELATIVELY LOOSE MATERIAL THAT IS ROUGHLY SHAPED TO FIT THE BOTTOM OFTHE PIPE ARCH, 4" TO 6" IN DEPTH. SUGGESTED PARTICLE SIZE IS 1/2 CORRUGATION DEPTH. THE WIDTH OF BEDDING SHOULD BE THE EXTENTSOF THE INVERT OF THE PIPE ARCH.4CORRUGATED STEEL PIPE ARCH (CSPA) [HEL-COR PIPE ARCH].5HAUNCH ZONE MATERIAL SHALL BE HAND SHOVELED OR SHOVEL SLICED INTO PLACE TO ALLOW FOR PROPER COMPACTION. REFER TO AASHTO26.5.2, 26.5.4 OR ASTM A798 10.3 TO PROPERLY ADDRESS CORNER BEARING PRESSURE.5aTHE BACKFILL MATERIAL SHALL BE A FREE-DRAINING, ANGULAR, WASHED-STONE PER AASHTO M 43 SIZE #3 WITH A ½” - 2” PARTICLE SIZE ORAPPROVED EQUAL. MATERIAL SHALL BE PLACED IN 12" MAXIMUM LIFTS AND SHALL BE WORKED INTO THE PIPE HAUNCHES BY MEANS OFSHOVEL-SLICING, RODDING, AIR-TAMPER, VIBRATORY PLATE OR OTHER EFFECTIVE METHODS. COMPACTION IS CONSIDERED ADEQUATE WHENA DENSITY EQUIVALENT TO 90% STANDARD PROCTOR IS ACHIEVED OR WHEN NO FURTHER YIELDING OF THE MATERIAL IS OBSERVED UNDERTHE COMPACTOR OR UNDER FOOT. THE PROJECT ENGINEER OR HIS REPRESENTATIVE MUST BE SATISFIED WITH THE LEVEL OF COMPACTION.INADEQUATE COMPACTION CAN LEAD TO EXCESSIVE PIPE DEFLECTIONS AND SETTLEMENT OF THE SOILS OVER THE SYSTEM. BACKFILL SHALLBE PLACED SUCH THAT THERE IS NO MORE THAN A TWO-LIFT DIFFERENTIAL BETWEEN THE SIDES OF ANY PIPE IN THE SYSTEM AT ALL TIMESDURING THE BACKFILL PROCESS. BACKFILL SHALL BE ADVANCED ALONG THE LENGTH OF THE SYSTEM AT THE SAME RATE TO AVOIDDIFFERENTIAL LOADING ON ANY PIPES IN THE SYSTEM.6INITIAL OPEN GRADED GRANULAR BACKFILL ABOVE PIPE ARCH MAY INCLUDE ROAD BASE MATERIAL (AND RIGID PAVEMENT IF APPLICABLE).SEE TABLE ABOVE. INITIAL BACKFILL OF 7.0" PER ENGINEER OF RECORD.6a TOTAL HEIGHT OF COMPACTED COVER IS MEASURED FROM TOP OF PIPE ARCH TO BOTTOM OF FLEXIBLE PAVEMENT OR TOP OF RIGID PAVEMENT.7FINAL BACKFILL MATERIAL SELECTION AND COMPACTION REQUIREMENTS SHALL FOLLOW THE PROJECT PLANS AND SPECIFICATIONS PER THEENGINEER OF RECORD. PER ENGINEER OF RECORD, 4" CLEAN ROCK WITH 40% POROSITY.NOTES:·GEOTEXTILE SHALL BE USED AS REQUIRED TO PREVENT SOIL MIGRATION.·FOR MULTIPLE BARREL INSTALLATIONS THE RECOMMENDED STANDARD SPACING BETWEEN PARALLEL PIPE ARCH RUNS SHALL BE SPAN/2 BUT NO LESS THAN 12", OR 36" FOR PIPE SPANS 108" AND LARGER. CONTACT YOUR CONTECH REPRESENTATIVE FOR NONSTANDARD SPACING.FINAL BACKFILLINITIAL BACKFILL IN SITUSPAN (S)SPANMIN.COVERCORR.PROFILE17"-83"12"2 2/3" x 1/2"<53"12"3" x 1" & 5" x 1"54"-66"15"3" x 1" & 5" x 1"67"-103"18"3" x 1" & 5" x 1"104"-117"21"3" x 1" & 5" x 1"118"-142"24"3" x 1" & 5" x 1"LIMITS OF DRAIN ROCK MAY BEPLACED BELOW PIPE AS DEFINED BYENGINEER OF RECORD.FOUNDATION SPEC STILL APPLIESAND BEDDING WILL BE THE FIRST 4"TO 6" BELOW INVERT4TYPICAL BACKFILL DETAILNOT TO SCALEEMBANKMENT CONDITIONTRENCH CONDITION66aBEDDINGFOUNDATIONPIPE EMBEDMENT 5a7532INITIAL FILL ENVELOPE 1 1a11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-10-CMP DETENTION\DRAWINGS\624723-010-CMP CONFAB.DWG 3/3/2020 8:22 AM SHEET NO.:46OFJMDDATE:PROJECT No.:624723SEQ. No.:010PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-010FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC SUBBASIN #1The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comMARKDATEREVISION DESCRIPTIONBY PIPE Ø 2'-6"PIPE Ø2'-6"PIPE Ø FRONTTYPICAL MANWAY DETAILNOT TO SCALE1'-0" MIN.48"Ø to 90"Ø FITTING REINFORCEMENTMAY BE REQUIRED BASED ON HEIGHT OFCOVER AND LIVE LOAD CONDITIONPLAN2/28/202065IMPERMEABLE LINERSUPPLIED BY OTHERS 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAX12" TECHCO BAND ANGLES 1/2" DIA. BOLT12" RISER BAND DETAILNOT TO SCALEPLAIN END CMP RISER PIPECONNECTION DETAIL7 1/2" TECHCO SHOWN - MAY VARYSTUB HEIGHT2'-0" RECOMMENDED12" MIN.MAINLINEPIPERISEREXTENSIONFLAT BAND SHOWN,MAY VARY (NOGASKET)GENERAL NOTES:1.DELIVERED BAND STYLE AND FASTENER TYPE MAY VARY BY FABRICATION PLANT.2.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.3.BAND MATERIAL AND GAGE TO BE SAME AS RISER MATERIAL.4.IF RISER HAS A HEIGHT OF COVER OF 10' OR MORE, USE A SLIP JOINT.5.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" 2-PIECES6.ALL RISER JOINT COMPONENTS WILL BE FIELD ASSEMBLED.7.MANHOLE RISERS IN APPLICATIONS WHERE TRAFFIC LOADS ARE IMPOSED REQUIRE SPECIAL DESIGN CONSIDERATIONS.8.DIMENSIONS SUBJECT TO MANUFACTURING TOLERANCES.ELEVATION VIEWOF CMP AND RISERNO GASKETCORRUGATEDBANDCONNECTION DETAIL12" TECHCO2 2/3"x1/2" RIVETED PIPE5-C BAND DETAILNOT TO SCALEGENERAL NOTES:1.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.2.BAND MATERIALS AND/OR COATING CAN VARY BY LOCATION. CONTACT YOUR CONTECH REPRESENTATIVE FOR AVAILABILITY.3.BANDS ARE SHAPED TO MATCH THE PIPE-ARCH WHEN APPLICABLE.4.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" THRU 96" 2-PIECES·102" THRU 144" 3-PIECES5.BAND FASTENERS ARE ATTACHED WITH SPOT WELDS, RIVETS OR HAND WELDS.6.ALL CMP IS REROLLED TO HAVE ANNULAR END CORRUGATIONS OF 2 2/3"x1/2"7.DIMENSIONS ARE SUBJECT TO MANUFACTURING TOLERANCES.8.ORDER SHALL DESIGNATE GASKET OPTION, IF REQUIRED (SEE DETAILS ABOVE).TECHCO BAND ANGLES1/2" DIA. BOLT12 1/4"JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-10-CMP DETENTION\DRAWINGS\624723-010-CMP CONFAB.DWG 3/3/2020 8:22 AM SHEET NO.:47OFJMDDATE:PROJECT No.:624723SEQ. No.:010PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-010FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC SUBBASIN #1The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comMARKDATEREVISION DESCRIPTIONBY65 2/28/2020 MANHOLE CAP DETAILNOT TO SCALE8"11" TYP.2" COVER TYP.1" GAP (TYP. ALL SIDES)NOTES:1.DESIGN IN ACCORDANCE WITH AASHTO, 17thEDITION AND ACI 350.2.DESIGN LOAD HS25.3.EARTH COVER = 1' MAX.4.CONCRETE STRENGTH = 4,000 psi5.REINFORCING STEEL = ASTM A615, GRADE 60.6.PROVIDE ADDITIONAL REINFORCING AROUNDOPENINGS EQUAL TO THE BARS INTERRUPTED,HALF EACH SIDE. ADDITIONAL BARS TO BE IN THESAME PLANE.AA 2" COVER(TYP)SECTION VIEWROUND OPTION PLAN VIEWSQUARE OPTION PLAN VIEWØ CMP RISERINTERRUPTED BARREPLACEMENT,SEE NOTE 6.STANDARDREINFORCING,SEE TABLEOPENING INPROTECTIONSLAB FORACESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.AINTERRUPTED BARREPLACEMENT, SEENOTE 6.BOPENING INPROTECTIONSLAB FORACCESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.STANDARDREINFORCING,SEE TABLEGASKET MATERIALSUFFICIENT TO PREVENTSLAB FROM BEARING ONRISER TO BE PROVIDED BYCONTRACTOR.2" COVER(TYP.)ØBREINFORCING TABLEØ CMPRISERAB ØREINFORCING**BEARINGPRESSURE(PSF)24"4'Ø4'x4'26"#5 @ 10" OCEW#5 @ 10" OCEW2,5401,90030"4'-6"Ø4'-6" x 4'-6"32"#5 @ 10" OCEW#5 @ 9" OCEW2,2601,67036"5'Ø5' x 5'38"#5 @ 9" OCEW#5 @ 8" OCEW2,0601,50042"5'-6"Ø5'-6" x 5'-6"44"#5 @ 8" OCEW#5 @ 8" OCEW1,4901,37048"6'Ø6' x 6'50"#5 @ 7" OCEW#5 @ 7" OCEW1,2101,270** ASSUMED SOIL BEARING CAPACITY1'-0"A2 " C O V E R ( T YP . ) 2 " COV ER ( T YP )7.TRIM OPENING WITH DIAGONAL #4 BARS, EXTEND BARS AMINIMUM OF 12" BEYOND OPENING, BEND BARS AS REQUIREDTO MAINTAIN BAR COVER.8.PROTECTION SLAB AND ALL MATERIALS TO BE PROVIDED ANDINSTALLED BY CONTRACTOR.9.DETAIL DESIGN BY DELTA ENGINEERS, ARCHITECTS AND LANDSURVEYORS, ENDWELL, NY.ØB36"Ø MAX., HS-25 ACCESS CASTINGWITH GRADE RINGS AS REQUIRED, TOBE PROVIDED AND INSTALLED BYCONTRACTOR. MAY BE TOP MOUNTED(AS SHOWN) OR RECESSED.CMPPROTECTIONSLABVARIESRIM/FINISHEDGRADEACCESS CASTING NOT SUPPLIED BY CONTECH11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-10-CMP DETENTION\DRAWINGS\624723-010-CMP CONFAB.DWG 3/3/2020 8:22 AM SHEET NO.:48OFJMDDATE:PROJECT No.:624723SEQ. No.:010PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-010FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC SUBBASIN #1The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comCONSTRUCTION LOADSFOR TEMPORARY CONSTRUCTION VEHICLE LOADS, AN EXTRA AMOUNT OF COMPACTED COVER MAY BE REQUIRED OVERTHE TOP OF THE PIPE. THE HEIGHT-OF-COVER SHALL MEET THE MINIMUM REQUIREMENTS SHOWN IN THE TABLE BELOW.THE USE OF HEAVY CONSTRUCTION EQUIPMENT NECESSITATES GREATER PROTECTION FOR THE PIPE THAN FINISHEDGRADE COVER MINIMUMS FOR NORMAL HIGHWAY TRAFFIC.PIPE SPAN,INCHES18-50MINIMUM COVER (FT)AXLE LOADS(kips)50-7575-110110-15012-422.02.53.03.04.03.53.048-723.03.078-1203.54.04.04.54.54.0126-1443.5*MINIMUM COVER MAY VARY, DEPENDING ON LOCAL CONDITIONS. THE CONTRACTOR MUST PROVIDE THE ADDITIONALCOVER REQUIRED TO AVOID DAMAGE TO THE PIPE. MINIMUM COVER IS MEASURED FROM THE TOP OF THE PIPE TOTHE TOP OF THE MAINTAINED CONSTRUCTION ROADWAY SURFACE. HEIGHT OFCOVERTEMPORARY COVER FORCONSTRUCTION LOADSFINISHEDGRADE CONSTRUCTION LOADING DIAGRAMNOT TO SCALESCOPETHIS SPECIFICATION COVERS THE MANUFACTURE ANDINSTALLATION OF THE CORRUGATED STEEL PIPE (CSP) DETAILED INTHE PROJECT PLANS.MATERIALTHE ALUMINIZED TYPE 2 STEEL COILS SHALL CONFORM TO THEAPPLICABLE REQUIREMENTS OF AASHTO M274 OR ASTM A929.PIPETHE CSP SHALL BE MANUFACTURED IN ACCORDANCE WITH THEAPPLICABLE REQUIREMENTS OF AASHTO M36 OR ASTM A760. THEPIPE SIZES, GAGES AND CORRUGATIONS SHALL BE AS SHOWN ONTHE PROJECT PLANS.ALL FABRICATION OF THE PRODUCT SHALL OCCUR WITHIN THEUNITED STATES.HANDLING AND ASSEMBLYSHALL BE IN ACCORDANCE WITH RECOMMENDATIONS OF THENATIONAL CORRUGATED STEEL PIPE ASSOCIATION (NCSPA)INSTALLATIONSHALL BE IN ACCORDANCE WITH AASHTO STANDARDSPECIFICATIONS FOR HIGHWAY BRIDGES, SECTION 26, DIVISION IIOR ASTM A798 AND IN CONFORMANCE WITH THE PROJECT PLANSAND SPECIFICATIONS. IF THERE ARE ANY INCONSISTENCIES ORCONFLICTS THE CONTRACTOR SHOULD DISCUSS AND RESOLVEWITH THE SITE ENGINEER.IT IS ALWAYS THE RESPONSIBILITY OF THE CONTRACTOR TOFOLLOW OSHA GUIDELINES FOR SAFE PRACTICES.SPECIFICATION FOR CORRUGATED STEEL PIPE-ALUMINIZED TYPE 2 STEELMATERIAL SPECIFICATIONNOT TO SCALEMARKDATEREVISION DESCRIPTIONBY 65 2/28/2020 RISER LADDER DETAILNOT TO SCALEPART NO. HALAGVL16PLANAA3"±6"(2) 14" FILLET WELDS1" LONG FROM EACH ANGLETO LADDER RAILRISER w/ LADDER AND STEPS IF EXTENSION IS REQUIREDPROVIDE MINIMUM OF 4 ATTACHMENTANGLES (2 ON EITHER SIDE OF LADDER RAIL)TO CONNECT LADDER TO RISER EXTENSIONRISER w/ LADDERAND STEPSMAINLINE CMP223 x 12, 5 x 1, 3 x 1, ETC.1'-6"MAX.℄ PIPE ∠5" x 3" x 14" x 16" LONG AT 1'-0"SPACING. LONG LEG TOPROJECT OUT. WELD TOPAND BOTTOM OF 3" LEG TO EACHCORRUGATION CREST(THESE ANGLES SHOULD BE USEDFOR LARGER DIAMETERMAINLINES WHERE ADDITIONALSTEPS ARE NEEDED)6" FROM RUNG TORISER JOINT6" FROM RUNG TORISER JOINT*NOTE: WHEN RISER EXTENSIONSARE USED, THE PLANT SHOULDCUT 3" FROM THE SIDE RAILS ASSHOWN(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELD EACH SIDE)RISER NORMALLY CMPWITH 223" x 12"CORRUGATIONSLADDER RAILS AND RUNGS(2) 14" FILLET WELDS 1" LONGATTACHMENT ANGLEMINIMUM OF 4 ANGLES PERLADDER SECTION, (2 EACH SIDE OFLADDER) 6' MAX. SPACINGVERTICALLYLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONGRISER(4) 116" FILLET WELDS FROMEACH ANGLE CORRUGATIONCREST (2 WELDS EACH SIDE)(4) ∠3" x 3" x 316"512" LONGLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONG(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELDS EACH SIDE)ELEVATIONSECTION A-AFABRICATION TOLERANCE: ±14"FLAT BAR AND REBAR: MILLTOLERANCE APPLIES12" TYP.CENTER TO CENTERRUNG SPACING34" (#6) REBAR CAN BE CUT FLUSHTO OUTSIDE OF RAIL(BAR LENGTH = 1634") OR BAR CANEXTEND BEYOND RAIL 12"±78" HOLE w/ 34" REBAR RUNG,WELD REBAR TO RUNG ONOUTSIDE OF STEEL RAIL212" x 38" FLAT BAR SIDE RAIL1'-4"1'-4"6"212"6"*3" FROM BOTTOM OF LADDERRAIL TO RISER JOINT*3" FROM TOP OF LADDERRAIL TO RISER JOINT1'-0"ALL STEEL PERASTM A361'-0"TYP.PLANSIDENOTE:THIS DRAWING IS INTENDED TO APPLY TO LADDERSINSTALLED IN RISERS HAVING A DIAMETER OF 30" ORLARGER. DUE TO SPACE CONSTRAINTS AND LIMITEDACCESSIBILITY, THE PRACTICALITY AND SUITABILITY OFUTILIZING RISERS SMALLER THAN 30" DIAMETERAND/OR INCORPORATING LADDERS IN THESE SMALLERDIAMETER RISERS SHOULD BE ADDRESSED BY THEOWNER AND PROJECT ENGINEERSTANDARD LADDER DETAILNOT TO SCALENOTES:1.LADDERS CAN BE MADE IN 20'-0" STANDARD LENGTHS AND CUT TO FIT2.ALL MATERIAL TO MEET ASTM A363.LADDER TO BE HOT DIPPED GALVANIZED PER ASTM A-123 AFTERFABRICATION IS COMPLETE3/8"TYP.11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-10-CMP DETENTION\DRAWINGS\624723-010-CMP CONFAB.DWG 3/3/2020 8:22 AM SHEET NO.:49OFJMDDATE:PROJECT No.:624723SEQ. No.:010PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-010FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC SUBBASIN #1The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comMARKDATEREVISION DESCRIPTIONBY 65 2/28/2020 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXVVVDVVVVEVVVVFVVVVGVVVVHVVVVJVVCVKVBAVVVVVVLWWWWWWWMNPRSTU28'-034"23'-834"6"Ø STUB L131'-712"6"Ø STUB C1146'-1114"75'-0"24"Ø RISER D1, E1F1, G1, H1, J1, K17-1/2" STONE PERIMETER35" x 24" BULKHEADw/ 12"Ø STUB, TYP. OF 71'-3" TYP.144'-0"JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:50OFJMDDATE:PROJECT No.:624723SEQ. No.:020PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-020FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #2The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY BAND, TYPICALSEE DETAIL SHEET P3NOTES·ALL RISER AND STUB DIMENSIONS ARE TO CENTERLINE.·ALL ELEVATIONS, DIMENSIONS, AND LOCATIONS OF RISERS AND INLETS, SHALL BE VERIFIEDBY THE ENGINEER OF RECORD (EOR) PRIOR TO RELEASING FOR FABRICATION.· ALL FITTINGS AND REINFORCEMENT COMPLY WITH ASTM A998.· ALL RISERS AND STUBS ARE 223" x 12" CORRUGATION AND 16 GAGE UNLESS OTHERWISENOTED.·RISERS TO BE FIELD TRIMMED TO GRADE AS REQUIRED, BY CONTRACTOR.·QUANTITY OF PIPE SHOWN DOES NOT PROVIDE EXTRA PIPE FOR CONNECTING THE SYSTEM TOEXISTING PIPE OR DRAINAGE STRUCTURES. OUR SYSTEM AS DETAILED PROVIDES NOMINALINLET AND/OR OUTLET PIPE STUB FOR CONNECTION TO EXISTING DRAINAGE FACILITIES. IFADDITIONAL PIPE IS NEEDED IT IS THE RESPONSIBILITY OF THE CONTRACTOR.·ALL ACCESS CASTINGS ARE THE RESPONSIBILITY OF THE CONTRACTOR AND ARE NOTSUPPLIED BY CONTECH.ASSEMBLYSCALE: 1" = 20'PIPE STORAGE: 4,662 CFLOADING: H20PIPE INV. = 429.58'±3/2/2020THE UNDERSIGNED HEREBY APPROVES THE ATTACHED(65) PAGES INCLUDING THE FOLLOWING:CUSTOMER·PIPE STORAGE = 4,662 CF·MAINLINE PIPE GAGE = 16·WALL TYPE = PERFORATED·DIAMETER = 35" X 24"·FINISH = ALT2·CORRUGATION = 2 2/3x1/2DATESTUB INFORMATIONPIECESTUB INVERTSYSTEMINVERT6"Ø STUB C1429.58429.586"Ø STUB L1429.58429.5812"Ø STUB M2429.58429.5812"Ø STUB N2429.58429.5812"Ø STUB P2429.58429.5812"Ø STUB R2429.58429.5812"Ø STUB S2429.58429.5812"Ø STUB T2429.58429.5812"Ø STUB U2429.58429.58RISER INFORMATIONPIECERIM ELEV.SYSTEMINVERT24"Ø RISER D1435.30429.5824"Ø RISER E1435.30429.5824"Ø RISER F1435.30429.5824"Ø RISER G1435.30429.5824"Ø RISER H1435.30429.5824"Ø RISER J1435.30429.5824"Ø RISER K1435.30429.58TOTAL STORAGE = PIPE STORAGE + ROCK STORAGETOTAL STORAGE PROVIDED = 7,378 CF 1.50"2 2/3" x 1/2" CORRUGATION - STEEL AND ALUMINUM CMPEDGE SPACING EQUAL ON BOTH SIDESNOTES:1.PERFORATIONS MEET AASHTO AND ASTM SPECIFICATIONS.2.PERFORATION OPEN AREA PER SQUARE FOOT OF PIPE IS BASEDON THE NOMINAL DIAMETER AND LENGTH OF PIPE.3.DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.4.ALL HOLES 3/8"Ø.EXFILTRATION AREASTANDARD PERFORATION PATTERNSAPPROXIMATE AREA PER LINEAR FOOT OF PIPEPIPECORRUGATION PATTERN2 2/3" x 1/2"3" x 1"5" x 1"ULTRA FLO30"Ø30.5 SQ. IN.32.3 SQ. IN.NOTES:·GAGE AND COATING LIMITATIONS APPLY. 5" x 1" IS NOT AVAILABLE INALUMINUM.·DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.TYPICAL PERFORATION DETAILNOT TO SCALETYPICAL SECTION VIEWNOT TO SCALENOTE: IF SALTING AGENTS FOR SNOW AND ICE REMOVAL ARE USED ON OR NEAR THEPROJECT, A GEOMEMBRANE BARRIER IS RECOMMENDED WITH THE SYSTEM. THEGEOMEMBRANE LINER IS INTENDED TO HELP PROTECT THE SYSTEM FROM THEPOTENTIAL ADVERSE EFFECTS THAT MAY RESULT FROM A CHANGE IN THESURROUNDING ENVIRONMENT OVER A PERIOD OF TIME. PLEASE REFER TO THECORRUGATED METAL PIPE DETENTION DESIGN GUIDE FOR ADDITIONAL INFORMATION.35" x 24" TYP.36"TYP.15" SEE TYPICALBACKFILL DETAILNOTESLIMITS OFREQUIREDBACKFILL20 MIL PEIMPERMEABLELINER OVERTOP OF PIPE(IF REQUIRED)LIVE LOADS NOT TO EXCEED CONVENTIONAL HIGHWAY LOADS.1MINIMUM TRENCH WIDTH MUST ALLOW ROOM FOR PROPER COMPACTION OF HAUNCH MATERIALS UNDER THE PIPE ARCH. THE TRENCH WIDTH IS THE MINIMUM AMOUNT REQUIRED FOR PROPER INSTALLATION AND TO SUPPORT HORIZONTAL PRESSURE FROM THEPIPE. THE MANUFACTURER'S SUGGESTED MINIMUM VALUE IS: 1.5S + 12".1aMINIMUM EMBANKMENT WIDTH (IN FEET) FOR INITIAL FILL ENVELOPE:3.0S BUT NO LESS THAN S + 4'-0".2FOUNDATION SHALL BE WELL CONSOLIDATED, STABLE & CAPABLE OF SUPPORTING FILL MATERIAL LOAD.3OPEN-GRADED GRANULAR BEDDING MATERIAL SHALL BE A RELATIVELY LOOSE MATERIAL THAT IS ROUGHLY SHAPED TO FIT THE BOTTOM OFTHE PIPE ARCH, 4" TO 6" IN DEPTH. SUGGESTED PARTICLE SIZE IS 1/2 CORRUGATION DEPTH. THE WIDTH OF BEDDING SHOULD BE THE EXTENTSOF THE INVERT OF THE PIPE ARCH.4CORRUGATED ALUMINUM PIPE ARCH (CAPA) [CORLIX PIPE ARCH].5HAUNCH ZONE MATERIAL SHALL BE HAND SHOVELED OR SHOVEL SLICED INTO PLACE TO ALLOW FOR PROPER COMPACTION. REFER TO AASHTO26.5.2, 26.5.4 OR ASTM B788 10.3 TO PROPERLY ADDRESS CORNER BEARING PRESSURE.5aTHE BACKFILL MATERIAL SHALL BE A FREE-DRAINING, ANGULAR, WASHED-STONE PER AASHTO M 43 SIZE #3 WITH A ½” - 2” PARTICLE SIZE ORAPPROVED EQUAL. MATERIAL SHALL BE PLACED IN 12" MAXIMUM LIFTS AND SHALL BE WORKED INTO THE PIPE HAUNCHES BY MEANS OFSHOVEL-SLICING, RODDING, AIR-TAMPER, VIBRATORY PLATE OR OTHER EFFECTIVE METHODS. COMPACTION IS CONSIDERED ADEQUATE WHENA DENSITY EQUIVALENT TO 90% STANDARD PROCTOR IS ACHIEVED OR WHEN NO FURTHER YIELDING OF THE MATERIAL IS OBSERVED UNDERTHE COMPACTOR OR UNDER FOOT. THE PROJECT ENGINEER OR HIS REPRESENTATIVE MUST BE SATISFIED WITH THE LEVEL OF COMPACTION.INADEQUATE COMPACTION CAN LEAD TO EXCESSIVE PIPE DEFLECTIONS AND SETTLEMENT OF THE SOILS OVER THE SYSTEM. BACKFILL SHALLBE PLACED SUCH THAT THERE IS NO MORE THAN A TWO-LIFT DIFFERENTIAL BETWEEN THE SIDES OF ANY PIPE IN THE SYSTEM AT ALL TIMESDURING THE BACKFILL PROCESS. BACKFILL SHALL BE ADVANCED ALONG THE LENGTH OF THE SYSTEM AT THE SAME RATE TO AVOIDDIFFERENTIAL LOADING ON ANY PIPES IN THE SYSTEM.6INITIAL OPEN GRADED GRANULAR BACKFILL ABOVE PIPE ARCH MAY INCLUDE ROAD BASE MATERIAL (AND RIGID PAVEMENT IF APPLICABLE).SEE TABLE ABOVE. INITIAL BACKFILL OF 6" PER ENGINEER OF RECORD.6a TOTAL HEIGHT OF COMPACTED COVER IS MEASURED FROM TOP OF PIPE ARCH TO BOTTOM OF FLEXIBLE PAVEMENT OR TOP OF RIGID PAVEMENT.7FINAL BACKFILL MATERIAL SELECTION AND COMPACTION REQUIREMENTS SHALL FOLLOW THE PROJECT PLANS AND SPECIFICATIONS PER THEENGINEER OF RECORD. PER ENGINEER OF RECORD, 2" CLEAN ROCK WITH 40% POROSITY.NOTES:·GEOTEXTILE SHALL BE USED AS REQUIRED TO PREVENT SOIL MIGRATION.·FOR MULTIPLE BARREL INSTALLATIONS THE RECOMMENDED STANDARD SPACING BETWEEN PARALLEL PIPE ARCH RUNS SHALL BE SPAN/2 BUT NO LESS THAN 12", OR 36" FOR PIPE SPANS 108" AND LARGER. CONTACT YOUR CONTECH REPRESENTATIVE FOR NONSTANDARD SPACING.FINAL BACKFILLINITIAL BACKFILL IN SITUSPAN (S)SPANMIN.COVERCORR.PROFILE17"-42"12"2 2/3" x 1/2"43"-57"15"2 2/3" x 1/2"58"-71"18"2 2/3" x 1/2"<60"15"3" x 1"61"-66"18"3" x 1"67"-81"21"3" x 1"82"-112"24"3" x 1" LIMITS OF DRAIN ROCK MAY BEPLACED BELOW PIPE AS DEFINEDBY ENGINEER OF RECORD.FOUNDATION SPEC STILL APPLIESAND BEDDING WILL BE THE FIRST4" TO 6" BELOW INVERT4TYPICAL BACKFILL DETAILNOT TO SCALEEMBANKMENT CONDITIONTRENCH CONDITION66aBEDDINGFOUNDATIONPIPE EMBEDMENT 5a7532INITIAL FILL ENVELOPE 1 1a11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:51OFJMDDATE:PROJECT No.:624723SEQ. No.:020PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-020FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #2The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY PIPE Ø 2'-6"PIPE Ø2'-6"PIPE Ø FRONTTYPICAL MANWAY DETAILNOT TO SCALE1'-0" MIN.48"Ø to 90"Ø FITTING REINFORCEMENTMAY BE REQUIRED BASED ON HEIGHT OFCOVER AND LIVE LOAD CONDITIONPLAN3/2/2020IMPERMEABLE LINERSUPPLIED BY OTHERS 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAX12" TECHCO BAND ANGLES 1/2" DIA. BOLT12" RISER BAND DETAILNOT TO SCALEPLAIN END CMP RISER PIPECONNECTION DETAIL7 1/2" TECHCO SHOWN - MAY VARYSTUB HEIGHT2'-0" RECOMMENDED12" MIN.MAINLINEPIPERISEREXTENSIONFLAT BAND SHOWN,MAY VARY (NOGASKET)GENERAL NOTES:1.DELIVERED BAND STYLE AND FASTENER TYPE MAY VARY BY FABRICATION PLANT.2.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.3.BAND MATERIAL AND GAGE TO BE SAME AS RISER MATERIAL.4.IF RISER HAS A HEIGHT OF COVER OF 10' OR MORE, USE A SLIP JOINT.5.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" 2-PIECES6.ALL RISER JOINT COMPONENTS WILL BE FIELD ASSEMBLED.7.MANHOLE RISERS IN APPLICATIONS WHERE TRAFFIC LOADS ARE IMPOSED REQUIRE SPECIAL DESIGN CONSIDERATIONS.8.DIMENSIONS SUBJECT TO MANUFACTURING TOLERANCES.ELEVATION VIEWOF CMP AND RISER12 1/4"TECHCO BAND ANGLES1/2" DIA. BOLTGENERAL NOTES:1.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.2.BAND MATERIALS AND/OR COATING CAN VARY BY LOCATION. CONTACT YOUR CONTECH REPRESENTATIVE FOR AVAILABILITY.3.BANDS ARE SHAPED TO MATCH THE PIPE-ARCH WHEN APPLICABLE.4.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" THRU 96" 2-PIECES·102" THRU 144" 3-PIECES5.BAND FASTENERS ARE ATTACHED WITH SPOT WELDS, RIVETS OR HAND WELDS.6.ALL CMP IS REROLLED TO HAVE ANNULAR END CORRUGATIONS OF 2 2/3"x1/2"7.DIMENSIONS ARE SUBJECT TO MANUFACTURING TOLERANCES.8.ORDER SHALL DESIGNATE GASKET OPTION, IF REQUIRED (SEE DETAILS ABOVE).5-C BAND DETAILNOT TO SCALE2 2/3"x1/2" RIVETED PIPECONNECTION DETAIL12" TECHCONO GASKETCORRUGATEDBANDJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:52OFJMDDATE:PROJECT No.:624723SEQ. No.:020PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-020FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #2The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/2/2020 MANHOLE CAP DETAILNOT TO SCALE8"11" TYP.2" COVER TYP.1" GAP (TYP. ALL SIDES)NOTES:1.DESIGN IN ACCORDANCE WITH AASHTO, 17thEDITION AND ACI 350.2.DESIGN LOAD HS25.3.EARTH COVER = 1' MAX.4.CONCRETE STRENGTH = 4,000 psi5.REINFORCING STEEL = ASTM A615, GRADE 60.6.PROVIDE ADDITIONAL REINFORCING AROUNDOPENINGS EQUAL TO THE BARS INTERRUPTED,HALF EACH SIDE. ADDITIONAL BARS TO BE IN THESAME PLANE.AA 2" COVER(TYP)SECTION VIEWROUND OPTION PLAN VIEWSQUARE OPTION PLAN VIEWØ CMP RISERINTERRUPTED BARREPLACEMENT,SEE NOTE 6.STANDARDREINFORCING,SEE TABLEOPENING INPROTECTIONSLAB FORACESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.AINTERRUPTED BARREPLACEMENT, SEENOTE 6.BOPENING INPROTECTIONSLAB FORACCESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.STANDARDREINFORCING,SEE TABLEGASKET MATERIALSUFFICIENT TO PREVENTSLAB FROM BEARING ONRISER TO BE PROVIDED BYCONTRACTOR.2" COVER(TYP.)ØBREINFORCING TABLEØ CMPRISERAB ØREINFORCING**BEARINGPRESSURE(PSF)24"4'Ø4'x4'26"#5 @ 10" OCEW#5 @ 10" OCEW2,5401,90030"4'-6"Ø4'-6" x 4'-6"32"#5 @ 10" OCEW#5 @ 9" OCEW2,2601,67036"5'Ø5' x 5'38"#5 @ 9" OCEW#5 @ 8" OCEW2,0601,50042"5'-6"Ø5'-6" x 5'-6"44"#5 @ 8" OCEW#5 @ 8" OCEW1,4901,37048"6'Ø6' x 6'50"#5 @ 7" OCEW#5 @ 7" OCEW1,2101,270** ASSUMED SOIL BEARING CAPACITY1'-0"A2 " C O V E R ( T YP . ) 2 " COV ER ( T YP )7.TRIM OPENING WITH DIAGONAL #4 BARS, EXTEND BARS AMINIMUM OF 12" BEYOND OPENING, BEND BARS AS REQUIREDTO MAINTAIN BAR COVER.8.PROTECTION SLAB AND ALL MATERIALS TO BE PROVIDED ANDINSTALLED BY CONTRACTOR.9.DETAIL DESIGN BY DELTA ENGINEERS, ARCHITECTS AND LANDSURVEYORS, ENDWELL, NY.ØB36"Ø MAX., HS-25 ACCESS CASTINGWITH GRADE RINGS AS REQUIRED, TOBE PROVIDED AND INSTALLED BYCONTRACTOR. MAY BE TOP MOUNTED(AS SHOWN) OR RECESSED.CMPPROTECTIONSLABVARIESRIM/FINISHEDGRADEACCESS CASTING NOT SUPPLIED BY CONTECH11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:53OFJMDDATE:PROJECT No.:624723SEQ. No.:020PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-020FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #2The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comCONSTRUCTION LOADSFOR TEMPORARY CONSTRUCTION VEHICLE LOADS, AN EXTRA AMOUNT OF COMPACTED COVER MAY BE REQUIRED OVERTHE TOP OF THE PIPE. THE HEIGHT-OF-COVER SHALL MEET THE MINIMUM REQUIREMENTS SHOWN IN THE TABLE BELOW.THE USE OF HEAVY CONSTRUCTION EQUIPMENT NECESSITATES GREATER PROTECTION FOR THE PIPE THAN FINISHEDGRADE COVER MINIMUMS FOR NORMAL HIGHWAY TRAFFIC.PIPE SPAN,INCHES18-50MINIMUM COVER (FT)AXLE LOADS(kips)50-7575-110110-15012-422.02.53.03.04.03.53.048-723.03.078-1203.54.04.04.54.54.0126-1443.5*MINIMUM COVER MAY VARY, DEPENDING ON LOCAL CONDITIONS. THE CONTRACTOR MUST PROVIDE THE ADDITIONALCOVER REQUIRED TO AVOID DAMAGE TO THE PIPE. MINIMUM COVER IS MEASURED FROM THE TOP OF THE PIPE TOTHE TOP OF THE MAINTAINED CONSTRUCTION ROADWAY SURFACE. HEIGHT OFCOVERTEMPORARY COVER FORCONSTRUCTION LOADSFINISHEDGRADE CONSTRUCTION LOADING DIAGRAMNOT TO SCALESCOPETHIS SPECIFICATION COVERS THE MANUFACTURE ANDINSTALLATION OF THE CORRUGATED STEEL PIPE (CSP) DETAILED INTHE PROJECT PLANS.MATERIALTHE ALUMINIZED TYPE 2 STEEL COILS SHALL CONFORM TO THEAPPLICABLE REQUIREMENTS OF AASHTO M274 OR ASTM A929.PIPETHE CSP SHALL BE MANUFACTURED IN ACCORDANCE WITH THEAPPLICABLE REQUIREMENTS OF AASHTO M36 OR ASTM A760. THEPIPE SIZES, GAGES AND CORRUGATIONS SHALL BE AS SHOWN ONTHE PROJECT PLANS.ALL FABRICATION OF THE PRODUCT SHALL OCCUR WITHIN THEUNITED STATES.HANDLING AND ASSEMBLYSHALL BE IN ACCORDANCE WITH RECOMMENDATIONS OF THENATIONAL CORRUGATED STEEL PIPE ASSOCIATION (NCSPA)INSTALLATIONSHALL BE IN ACCORDANCE WITH AASHTO STANDARDSPECIFICATIONS FOR HIGHWAY BRIDGES, SECTION 26, DIVISION IIOR ASTM A798 AND IN CONFORMANCE WITH THE PROJECT PLANSAND SPECIFICATIONS. IF THERE ARE ANY INCONSISTENCIES ORCONFLICTS THE CONTRACTOR SHOULD DISCUSS AND RESOLVEWITH THE SITE ENGINEER.IT IS ALWAYS THE RESPONSIBILITY OF THE CONTRACTOR TOFOLLOW OSHA GUIDELINES FOR SAFE PRACTICES.SPECIFICATION FOR CORRUGATED STEEL PIPE-ALUMINIZED TYPE 2 STEELMATERIAL SPECIFICATIONNOT TO SCALE65REVISION DESCRIPTIONDATEMARKBY 3/2/2020 RISER LADDER DETAILNOT TO SCALEPART NO. HALAGVL16PLANAA3"±6"(2) 14" FILLET WELDS1" LONG FROM EACH ANGLETO LADDER RAILRISER w/ LADDER AND STEPS IF EXTENSION IS REQUIREDPROVIDE MINIMUM OF 4 ATTACHMENTANGLES (2 ON EITHER SIDE OF LADDER RAIL)TO CONNECT LADDER TO RISER EXTENSIONRISER w/ LADDERAND STEPSMAINLINE CMP223 x 12, 5 x 1, 3 x 1, ETC.1'-6"MAX.℄ PIPE ∠5" x 3" x 14" x 16" LONG AT 1'-0"SPACING. LONG LEG TOPROJECT OUT. WELD TOPAND BOTTOM OF 3" LEG TO EACHCORRUGATION CREST(THESE ANGLES SHOULD BE USEDFOR LARGER DIAMETERMAINLINES WHERE ADDITIONALSTEPS ARE NEEDED)6" FROM RUNG TORISER JOINT6" FROM RUNG TORISER JOINT*NOTE: WHEN RISER EXTENSIONSARE USED, THE PLANT SHOULDCUT 3" FROM THE SIDE RAILS ASSHOWN(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELD EACH SIDE)RISER NORMALLY CMPWITH 223" x 12"CORRUGATIONSLADDER RAILS AND RUNGS(2) 14" FILLET WELDS 1" LONGATTACHMENT ANGLEMINIMUM OF 4 ANGLES PERLADDER SECTION, (2 EACH SIDE OFLADDER) 6' MAX. SPACINGVERTICALLYLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONGRISER(4) 116" FILLET WELDS FROMEACH ANGLE CORRUGATIONCREST (2 WELDS EACH SIDE)(4) ∠3" x 3" x 316"512" LONGLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONG(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELDS EACH SIDE)ELEVATIONSECTION A-AFABRICATION TOLERANCE: ±14"FLAT BAR AND REBAR: MILLTOLERANCE APPLIES12" TYP.CENTER TO CENTERRUNG SPACING34" (#6) REBAR CAN BE CUT FLUSHTO OUTSIDE OF RAIL(BAR LENGTH = 1634") OR BAR CANEXTEND BEYOND RAIL 12"±78" HOLE w/ 34" REBAR RUNG,WELD REBAR TO RUNG ONOUTSIDE OF STEEL RAIL212" x 38" FLAT BAR SIDE RAIL1'-4"1'-4"6"212"6"*3" FROM BOTTOM OF LADDERRAIL TO RISER JOINT*3" FROM TOP OF LADDERRAIL TO RISER JOINT1'-0"ALL STEEL PERASTM A361'-0"TYP.PLANSIDENOTE:THIS DRAWING IS INTENDED TO APPLY TO LADDERSINSTALLED IN RISERS HAVING A DIAMETER OF 30" ORLARGER. DUE TO SPACE CONSTRAINTS AND LIMITEDACCESSIBILITY, THE PRACTICALITY AND SUITABILITY OFUTILIZING RISERS SMALLER THAN 30" DIAMETERAND/OR INCORPORATING LADDERS IN THESE SMALLERDIAMETER RISERS SHOULD BE ADDRESSED BY THEOWNER AND PROJECT ENGINEERSTANDARD LADDER DETAILNOT TO SCALENOTES:1.LADDERS CAN BE MADE IN 20'-0" STANDARD LENGTHS AND CUT TO FIT2.ALL MATERIAL TO MEET ASTM A363.LADDER TO BE HOT DIPPED GALVANIZED PER ASTM A-123 AFTERFABRICATION IS COMPLETE3/8"TYP.11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:54OFJMDDATE:PROJECT No.:624723SEQ. No.:020PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-020FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #2The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/2/2020 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXZZEZZZZFZZZZGZZZZHZZZZJZZZZKZZZZLZZZZMZZDZNZZPRSTUVWXYCBA35" x 24" BULKHEADw/ 12"Ø STUB, TYP. OF 92'-4"6"Ø STUB Y312'-114"6"Ø STUB D1118'-1114"60'-0"24"Ø RISER E1F1, G1, H1, J160'-0"24"Ø RISERK1, L1, M1, N11'-3" TYP. 36'-514"116'-0"JSM/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-30-CMP DETENTION\DRAWINGS\624723-030-CMP CONFAB.DWG 3/4/2020 8:07 AM SHEET NO.:55OFJSMDATE:PROJECT No.:624723SEQ. No.:030PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-030FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #3The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comTHE UNDERSIGNED HEREBY APPROVES THE ATTACHED(65) PAGES INCLUDING THE FOLLOWING:CUSTOMER·PIPE STORAGE = 4,861 CF·MAINLINE PIPE GAGE = 16·WALL TYPE = PERFORATED·DIAMETER = 35" X 24"·FINISH = ALT2·CORRUGATION = 2 2/3x1/2DATE65REVISION DESCRIPTIONDATEMARKBY BAND, TYPICALSEE DETAIL SHEET C3NOTES·ALL RISER AND STUB DIMENSIONS ARE TO CENTERLINE.·ALL ELEVATIONS, DIMENSIONS, AND LOCATIONS OF RISERS AND INLETS, SHALL BE VERIFIEDBY THE ENGINEER OF RECORD (EOR) PRIOR TO RELEASING FOR FABRICATION.· ALL FITTINGS AND REINFORCEMENT COMPLY WITH ASTM A998.· ALL RISERS AND STUBS ARE 223" x 12" CORRUGATION AND 16 GAGE UNLESS OTHERWISENOTED.·RISERS TO BE FIELD TRIMMED TO GRADE AS REQUIRED, BY CONTRACTOR.·QUANTITY OF PIPE SHOWN DOES NOT PROVIDE EXTRA PIPE FOR CONNECTING THE SYSTEM TOEXISTING PIPE OR DRAINAGE STRUCTURES. OUR SYSTEM AS DETAILED PROVIDES NOMINALINLET AND/OR OUTLET PIPE STUB FOR CONNECTION TO EXISTING DRAINAGE FACILITIES. IFADDITIONAL PIPE IS NEEDED IT IS THE RESPONSIBILITY OF THE CONTRACTOR.·ALL ACCESS CASTINGS ARE THE RESPONSIBILITY OF THE CONTRACTOR AND ARE NOTSUPPLIED BY CONTECH.ASSEMBLYSCALE: 1" = 20'PIPE STORAGE: 4,861 CFSTRUCTURAL BACKFILL STORAGE: PER EOR CFTOTAL STORAGE PROVIDED: PER EOR CFLOADING: H20PIPE INV. = 429.35'±3/3/2020STUB INFORMATIONPIECESTUB INVERTSYSTEMINVERT6"Ø STUB D1429.35429.3512"Ø STUB P2429.35429.3512"Ø STUB R2429.35429.3512"Ø STUB S2429.35429.3512"Ø STUB T2429.35429.3512"Ø STUB U2429.35429.3512"Ø STUB V2429.35429.3512"Ø STUB W2429.35429.3512"Ø STUB X2429.35429.3512"Ø STUB Y2429.35429.356"Ø STUB Y3429.35429.35RISER INFORMATIONPIECERIM ELEV.SYSTEMINVERT24"Ø RISER E1433.88429.3524"Ø RISER F1433.88429.3524"Ø RISER G1433.88429.3524"Ø RISER H1433.88429.3524"Ø RISER J1433.88429.3524"Ø RISER K1433.88429.3524"Ø RISER L1433.88429.3524"Ø RISER M1433.88429.3524"Ø RISER N1433.88429.35TOTAL STORAGE = PIPE STORAGE + ROCK STORAGETOTAL STORAGE PROVIDED = 8,288 CF 1.50"2.8"COIL WIDTHOPEN AREA = 3.76 SQ IN/SQ FT2 2/3" x 1/2" CORRUGATION - STEEL AND ALUMINUM CMPEDGE SPACING EQUAL ON BOTH SIDES2.05"NOTES:1.PERFORATIONS MEET AASHTO AND ASTM SPECIFICATIONS.2.PERFORATION OPEN AREA PER SQUARE FOOT OF PIPE IS BASEDON THE NOMINAL DIAMETER AND LENGTH OF PIPE.3.DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.4.ALL HOLES 3/8"Ø.EXFILTRATION AREASTANDARD PERFORATION PATTERNSAPPROXIMATE AREA PER LINEAR FOOT OF PIPEPIPECORRUGATION PATTERN2 2/3" x 1/2"3" x 1"5" x 1"ULTRA FLO30"Ø30.5 SQ. IN.32.3 SQ. IN.NOTES:·GAGE AND COATING LIMITATIONS APPLY. 5" x 1" IS NOT AVAILABLE INALUMINUM.·DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.TYPICAL PERFORATION DETAILNOT TO SCALETYPICAL SECTION VIEWNOT TO SCALE35" x 24" TYP.15"TYP.15" SEE TYPICALBACKFILL DETAILNOTESLIMITS OFREQUIREDBACKFILLLIVE LOADS NOT TO EXCEED CONVENTIONAL HIGHWAY LOADS.1MINIMUM TRENCH WIDTH MUST ALLOW ROOM FOR PROPER COMPACTION OF HAUNCH MATERIALS UNDER THE PIPE ARCH. THE TRENCH WIDTH IS THE MINIMUM AMOUNT REQUIRED FOR PROPER INSTALLATION AND TO SUPPORT HORIZONTAL PRESSURE FROM THEPIPE. THE MANUFACTURER'S SUGGESTED MINIMUM VALUE IS: 1.5S + 12".1aMINIMUM EMBANKMENT WIDTH (IN FEET) FOR INITIAL FILL ENVELOPE:3.0S BUT NO LESS THAN S + 4'0".2FOUNDATION SHALL BE WELL CONSOLIDATED, STABLE & CAPABLE OF SUPPORTING FILL MATERIAL LOAD.3OPEN-GRADED GRANULAR BEDDING MATERIAL SHALL BE A RELATIVELY LOOSE MATERIAL THAT IS ROUGHLY SHAPED TO FIT THE BOTTOM OFTHE PIPE ARCH, 4" TO 6" IN DEPTH. SUGGESTED PARTICLE SIZE IS 1/2 CORRUGATION DEPTH. THE WIDTH OF BEDDING SHOULD BE THE EXTENTSOF THE INVERT OF THE PIPE ARCH.4CORRUGATED STEEL PIPE ARCH (CSPA) [HEL-COR PIPE ARCH].5HAUNCH ZONE MATERIAL SHALL BE HAND SHOVELED OR SHOVEL SLICED INTO PLACE TO ALLOW FOR PROPER COMPACTION. REFER TO AASHTO26.5.2, 26.5.4 OR ASTM A798 10.3 TO PROPERLY ADDRESS CORNER BEARING PRESSURE.5aTHE BACKFILL MATERIAL SHALL BE A FREE-DRAINING, ANGULAR, WASHED-STONE PER AASHTO M 43 SIZE #3 WITH A ½” - 2” PARTICLE SIZE ORAPPROVED EQUAL. MATERIAL SHALL BE PLACED IN 12" MAXIMUM LIFTS AND SHALL BE WORKED INTO THE PIPE HAUNCHES BY MEANS OFSHOVEL-SLICING, RODDING, AIR-TAMPER, VIBRATORY PLATE OR OTHER EFFECTIVE METHODS. COMPACTION IS CONSIDERED ADEQUATE WHENA DENSITY EQUIVALENT TO 90% STANDARD PROCTOR IS ACHIEVED OR WHEN NO FURTHER YIELDING OF THE MATERIAL IS OBSERVED UNDERTHE COMPACTOR OR UNDER FOOT. THE PROJECT ENGINEER OR HIS REPRESENTATIVE MUST BE SATISFIED WITH THE LEVEL OF COMPACTION.INADEQUATE COMPACTION CAN LEAD TO EXCESSIVE PIPE DEFLECTIONS AND SETTLEMENT OF THE SOILS OVER THE SYSTEM. BACKFILL SHALLBE PLACED SUCH THAT THERE IS NO MORE THAN A TWO-LIFT DIFFERENTIAL BETWEEN THE SIDES OF ANY PIPE IN THE SYSTEM AT ALL TIMESDURING THE BACKFILL PROCESS. BACKFILL SHALL BE ADVANCED ALONG THE LENGTH OF THE SYSTEM AT THE SAME RATE TO AVOIDDIFFERENTIAL LOADING ON ANY PIPES IN THE SYSTEM.6 INITIAL OPEN GRADED GRANULAR BACKFILL ABOVE PIPE ARCH MAY INCLUDE ROAD BASE MATERIAL (AND RIGID PAVEMENT IF APPLICABLE).SEE TABLE ABOVE. INITIAL BACKFILL OF 7.5" PER ENGINEER OF RECORD.6a TOTAL HEIGHT OF COMPACTED COVER IS MEASURED FROM TOP OF PIPE ARCH TO BOTTOM OF FLEXIBLE PAVEMENT OR TOP OF RIGID PAVEMENT.7 FINAL BACKFILL MATERIAL SELECTION AND COMPACTION REQUIREMENTS SHALL FOLLOW THE PROJECT PLANS AND SPECIFICATIONS PER THEENGINEER OF RECORD. PER ENGINEER OF RECORD, 4.5" CLEAN ROCK WITH 40% POROSITY.NOTES:·GEOTEXTILE SHALL BE USED AS REQUIRED TO PREVENT SOIL MIGRATION.·FOR MULTIPLE BARREL INSTALLATIONS THE RECOMMENDED STANDARD SPACING BETWEEN PARALLEL PIPE ARCH RUNS SHALL BE SPAN/2 BUT NO LESS THAN 12", OR 36" FOR PIPE SPANS 108" AND LARGER. CONTACT YOUR CONTECH REPRESENTATIVE FOR NONSTANDARD SPACING.FINAL BACKFILLINITIAL BACKFILL IN SITUSPAN (S)SPANMIN.COVERCORR.PROFILE17"-83"12"2 2/3" x 1/2"<53"12"3" x 1" & 5" x 1"54"-66"15"3" x 1" & 5" x 1"67"-103"18"3" x 1" & 5" x 1"104"-117"21"3" x 1" & 5" x 1"118"-142"24"3" x 1" & 5" x 1"LIMITS OF DRAIN ROCK MAY BEPLACED BELOW PIPE AS DEFINED BYENGINEER OF RECORD.FOUNDATION SPEC STILL APPLIESAND BEDDING WILL BE THE FIRST 4"TO 6" BELOW INVERT4TYPICAL BACKFILL DETAILNOT TO SCALEEMBANKMENT CONDITIONTRENCH CONDITION66aBEDDINGFOUNDATIONPIPE EMBEDMENT 5a7532INITIAL FILL ENVELOPE 1 1a11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAX1'-1112"8"2'-1114"TYPICAL 35" x 24" ARCH PIPE DETAILN.T.S.AREA = 4.5 SFEQUIVALENT DIA. = 30"NOTES:1. ALL DIMENSIONS ARE TO THE INSIDE CORRUGATION CREST UNLESS NOTED OTHERWISE.2. ALL DIMENSIONS ARE SUBJECT TO MANUFACTURING TOLERANCES.3. RISE AND SPAN DIMENSIONS ACCOUNT FOR AASHTO AND ASTM SPECIFICATIONALLOWABLE TOLERANCES FROM NOMINAL DIMENSIONS.JSM/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-30-CMP DETENTION\DRAWINGS\624723-030-CMP CONFAB.DWG 3/4/2020 8:07 AM SHEET NO.:56OFJSMDATE:PROJECT No.:624723SEQ. No.:030PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-030FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #3The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/3/2020IMPERMEABLE LINERSUPPLIED BY OTHERS 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAX12" TECHCO BAND ANGLES 1/2" DIA. BOLT12" RISER BAND DETAILNOT TO SCALEPLAIN END CMP RISER PIPECONNECTION DETAIL7 1/2" TECHCO SHOWN - MAY VARYSTUB HEIGHT2'-0" RECOMMENDED12" MIN.MAINLINEPIPERISEREXTENSIONFLAT BAND SHOWN,MAY VARY (NOGASKET)GENERAL NOTES:1.DELIVERED BAND STYLE AND FASTENER TYPE MAY VARY BY FABRICATION PLANT.2.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.3.BAND MATERIAL AND GAGE TO BE SAME AS RISER MATERIAL.4.IF RISER HAS A HEIGHT OF COVER OF 10' OR MORE, USE A SLIP JOINT.5.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" 2-PIECES6.ALL RISER JOINT COMPONENTS WILL BE FIELD ASSEMBLED.7.MANHOLE RISERS IN APPLICATIONS WHERE TRAFFIC LOADS ARE IMPOSED REQUIRE SPECIAL DESIGN CONSIDERATIONS.8.DIMENSIONS SUBJECT TO MANUFACTURING TOLERANCES.ELEVATION VIEWOF CMP AND RISERNO GASKETCORRUGATEDBANDCONNECTION DETAIL12" TECHCO2 2/3"x1/2" RIVETED PIPE5-C BAND DETAILNOT TO SCALEGENERAL NOTES:1.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.2.BAND MATERIALS AND/OR COATING CAN VARY BY LOCATION. CONTACT YOUR CONTECH REPRESENTATIVE FOR AVAILABILITY.3.BANDS ARE SHAPED TO MATCH THE PIPE-ARCH WHEN APPLICABLE.4.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" THRU 96" 2-PIECES·102" THRU 144" 3-PIECES5.BAND FASTENERS ARE ATTACHED WITH SPOT WELDS, RIVETS OR HAND WELDS.6.ALL CMP IS REROLLED TO HAVE ANNULAR END CORRUGATIONS OF 2 2/3"x1/2"7.DIMENSIONS ARE SUBJECT TO MANUFACTURING TOLERANCES.8.ORDER SHALL DESIGNATE GASKET OPTION, IF REQUIRED (SEE DETAILS ABOVE).TECHCO BAND ANGLES1/2" DIA. BOLT12 1/4"JSM/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-30-CMP DETENTION\DRAWINGS\624723-030-CMP CONFAB.DWG 3/4/2020 8:07 AM SHEET NO.:57OFJSMDATE:PROJECT No.:624723SEQ. No.:030PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-030FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #3The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 MANHOLE CAP DETAILNOT TO SCALE8"11" TYP.2" COVER TYP.1" GAP (TYP. ALL SIDES)NOTES:1.DESIGN IN ACCORDANCE WITH AASHTO, 17thEDITION AND ACI 350.2.DESIGN LOAD HS25.3.EARTH COVER = 1' MAX.4.CONCRETE STRENGTH = 4,000 psi5.REINFORCING STEEL = ASTM A615, GRADE 60.6.PROVIDE ADDITIONAL REINFORCING AROUNDOPENINGS EQUAL TO THE BARS INTERRUPTED,HALF EACH SIDE. ADDITIONAL BARS TO BE IN THESAME PLANE.AA 2" COVER(TYP)SECTION VIEWROUND OPTION PLAN VIEWSQUARE OPTION PLAN VIEWØ CMP RISERINTERRUPTED BARREPLACEMENT,SEE NOTE 6.STANDARDREINFORCING,SEE TABLEOPENING INPROTECTIONSLAB FORACESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.AINTERRUPTED BARREPLACEMENT, SEENOTE 6.BOPENING INPROTECTIONSLAB FORACCESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.STANDARDREINFORCING,SEE TABLEGASKET MATERIALSUFFICIENT TO PREVENTSLAB FROM BEARING ONRISER TO BE PROVIDED BYCONTRACTOR.2" COVER(TYP.)ØBREINFORCING TABLEØ CMPRISERAB ØREINFORCING**BEARINGPRESSURE(PSF)24"4'Ø4'x4'26"#5 @ 10" OCEW#5 @ 10" OCEW2,5401,90030"4'-6"Ø4'-6" x 4'-6"32"#5 @ 10" OCEW#5 @ 9" OCEW2,2601,67036"5'Ø5' x 5'38"#5 @ 9" OCEW#5 @ 8" OCEW2,0601,50042"5'-6"Ø5'-6" x 5'-6"44"#5 @ 8" OCEW#5 @ 8" OCEW1,4901,37048"6'Ø6' x 6'50"#5 @ 7" OCEW#5 @ 7" OCEW1,2101,270** ASSUMED SOIL BEARING CAPACITY1'-0"A2 " CO VER ( T Y P . ) 2 " COV E R (T YP )7.TRIM OPENING WITH DIAGONAL #4 BARS, EXTEND BARS AMINIMUM OF 12" BEYOND OPENING, BEND BARS AS REQUIREDTO MAINTAIN BAR COVER.8.PROTECTION SLAB AND ALL MATERIALS TO BE PROVIDED ANDINSTALLED BY CONTRACTOR.9.DETAIL DESIGN BY DELTA ENGINEERS, ARCHITECTS AND LANDSURVEYORS, ENDWELL, NY.ØB36"Ø MAX., HS-25 ACCESS CASTINGWITH GRADE RINGS AS REQUIRED, TOBE PROVIDED AND INSTALLED BYCONTRACTOR. MAY BE TOP MOUNTED(AS SHOWN) OR RECESSED.CMPPROTECTIONSLABVARIESRIM/FINISHEDGRADEACCESS CASTING NOT SUPPLIED BY CONTECH11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJSM/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-30-CMP DETENTION\DRAWINGS\624723-030-CMP CONFAB.DWG 3/4/2020 8:07 AM SHEET NO.:58OFJSMDATE:PROJECT No.:624723SEQ. No.:030PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-030FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #3The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comCONSTRUCTION LOADSFOR TEMPORARY CONSTRUCTION VEHICLE LOADS, AN EXTRA AMOUNT OF COMPACTED COVER MAY BE REQUIRED OVERTHE TOP OF THE PIPE. THE HEIGHT-OF-COVER SHALL MEET THE MINIMUM REQUIREMENTS SHOWN IN THE TABLE BELOW.THE USE OF HEAVY CONSTRUCTION EQUIPMENT NECESSITATES GREATER PROTECTION FOR THE PIPE THAN FINISHEDGRADE COVER MINIMUMS FOR NORMAL HIGHWAY TRAFFIC.PIPE SPAN,INCHES18-50MINIMUM COVER (FT)AXLE LOADS(kips)50-7575-110110-15012-422.02.53.03.04.03.53.048-723.03.078-1203.54.04.04.54.54.0126-1443.5*MINIMUM COVER MAY VARY, DEPENDING ON LOCAL CONDITIONS. THE CONTRACTOR MUST PROVIDE THE ADDITIONALCOVER REQUIRED TO AVOID DAMAGE TO THE PIPE. MINIMUM COVER IS MEASURED FROM THE TOP OF THE PIPE TOTHE TOP OF THE MAINTAINED CONSTRUCTION ROADWAY SURFACE. HEIGHT OFCOVERTEMPORARY COVER FORCONSTRUCTION LOADSFINISHEDGRADE CONSTRUCTION LOADING DIAGRAMNOT TO SCALESCOPETHIS SPECIFICATION COVERS THE MANUFACTURE ANDINSTALLATION OF THE CORRUGATED STEEL PIPE (CSP) DETAILED INTHE PROJECT PLANS.MATERIALTHE ALUMINIZED TYPE 2 STEEL COILS SHALL CONFORM TO THEAPPLICABLE REQUIREMENTS OF AASHTO M274 OR ASTM A929.PIPETHE CSP SHALL BE MANUFACTURED IN ACCORDANCE WITH THEAPPLICABLE REQUIREMENTS OF AASHTO M36 OR ASTM A760. THEPIPE SIZES, GAGES AND CORRUGATIONS SHALL BE AS SHOWN ONTHE PROJECT PLANS.ALL FABRICATION OF THE PRODUCT SHALL OCCUR WITHIN THEUNITED STATES.HANDLING AND ASSEMBLYSHALL BE IN ACCORDANCE WITH RECOMMENDATIONS OF THENATIONAL CORRUGATED STEEL PIPE ASSOCIATION (NCSPA)INSTALLATIONSHALL BE IN ACCORDANCE WITH AASHTO STANDARDSPECIFICATIONS FOR HIGHWAY BRIDGES, SECTION 26, DIVISION IIOR ASTM A798 AND IN CONFORMANCE WITH THE PROJECT PLANSAND SPECIFICATIONS. IF THERE ARE ANY INCONSISTENCIES ORCONFLICTS THE CONTRACTOR SHOULD DISCUSS AND RESOLVEWITH THE SITE ENGINEER.IT IS ALWAYS THE RESPONSIBILITY OF THE CONTRACTOR TOFOLLOW OSHA GUIDELINES FOR SAFE PRACTICES.SPECIFICATION FOR CORRUGATED STEEL PIPE-ALUMINIZED TYPE 2 STEELMATERIAL SPECIFICATIONNOT TO SCALE65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 RISER LADDER DETAILNOT TO SCALEPART NO. HALAGVL16PLANAA3"±6"(2) 14" FILLET WELDS1" LONG FROM EACH ANGLETO LADDER RAILRISER w/ LADDER AND STEPS IF EXTENSION IS REQUIREDPROVIDE MINIMUM OF 4 ATTACHMENTANGLES (2 ON EITHER SIDE OF LADDER RAIL)TO CONNECT LADDER TO RISER EXTENSIONRISER w/ LADDERAND STEPSMAINLINE CMP223 x 12, 5 x 1, 3 x 1, ETC.1'-6"MAX.℄ PIPE ∠5" x 3" x 14" x 16" LONG AT 1'-0"SPACING. LONG LEG TOPROJECT OUT. WELD TOPAND BOTTOM OF 3" LEG TO EACHCORRUGATION CREST(THESE ANGLES SHOULD BE USEDFOR LARGER DIAMETERMAINLINES WHERE ADDITIONALSTEPS ARE NEEDED)6" FROM RUNG TORISER JOINT6" FROM RUNG TORISER JOINT*NOTE: WHEN RISER EXTENSIONSARE USED, THE PLANT SHOULDCUT 3" FROM THE SIDE RAILS ASSHOWN(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELD EACH SIDE)RISER NORMALLY CMPWITH 223" x 12"CORRUGATIONSLADDER RAILS AND RUNGS(2) 14" FILLET WELDS 1" LONGATTACHMENT ANGLEMINIMUM OF 4 ANGLES PERLADDER SECTION, (2 EACH SIDE OFLADDER) 6' MAX. SPACINGVERTICALLYLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONGRISER(4) 116" FILLET WELDS FROMEACH ANGLE CORRUGATIONCREST (2 WELDS EACH SIDE)(4) ∠3" x 3" x 316"512" LONGLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONG(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELDS EACH SIDE)ELEVATIONSECTION A-AFABRICATION TOLERANCE: ±14"FLAT BAR AND REBAR: MILLTOLERANCE APPLIES12" TYP.CENTER TO CENTERRUNG SPACING34" (#6) REBAR CAN BE CUT FLUSHTO OUTSIDE OF RAIL(BAR LENGTH = 1634") OR BAR CANEXTEND BEYOND RAIL 12"±78" HOLE w/ 34" REBAR RUNG,WELD REBAR TO RUNG ONOUTSIDE OF STEEL RAIL212" x 38" FLAT BAR SIDE RAIL1'-4"1'-4"6"212"6"*3" FROM BOTTOM OF LADDERRAIL TO RISER JOINT*3" FROM TOP OF LADDERRAIL TO RISER JOINT1'-0"ALL STEEL PERASTM A361'-0"TYP.PLANSIDENOTE:THIS DRAWING IS INTENDED TO APPLY TO LADDERSINSTALLED IN RISERS HAVING A DIAMETER OF 30" ORLARGER. DUE TO SPACE CONSTRAINTS AND LIMITEDACCESSIBILITY, THE PRACTICALITY AND SUITABILITY OFUTILIZING RISERS SMALLER THAN 30" DIAMETERAND/OR INCORPORATING LADDERS IN THESE SMALLERDIAMETER RISERS SHOULD BE ADDRESSED BY THEOWNER AND PROJECT ENGINEERSTANDARD LADDER DETAILNOT TO SCALENOTES:1.LADDERS CAN BE MADE IN 20'-0" STANDARD LENGTHS AND CUT TO FIT2.ALL MATERIAL TO MEET ASTM A363.LADDER TO BE HOT DIPPED GALVANIZED PER ASTM A-123 AFTERFABRICATION IS COMPLETE3/8"TYP.11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-20-CMP DETENTION\DRAWINGS\624723-020-CMP CONFAB.DWG 3/3/2020 8:40 AM SHEET NO.:59OFJMDDATE:PROJECT No.:624723SEQ. No.:030PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUPC BASIN #3The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXVDEVVVVFVVVVGVVVVHVVVVJVVVVKVVVVLVVMNPRSTUCBA35" x 24" BULKHEADw/ 12"Ø STUBTYP. OF 728'-034"121'-1114"56'-1114"24"Ø RISER E1, F1,G1, H1, J1, K1, L139'-3"6"Ø STUB D17'-0"6"Ø STUB M31'-3" TYP.7-1/2" STONE PERIMETER119'-0"JSD/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-40-CMP DETENTION\DRAWINGS\624723-040-CMP CONFAB.DWG 3/4/2020 8:35 AM SHEET NO.:60OFJSD/JMDDATE:PROJECT No.:624723SEQ. No.:040PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-040FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUCP BASIN #4The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY BAND, TYPICALSEE DETAIL SHEET P3NOTES·ALL RISER AND STUB DIMENSIONS ARE TO CENTERLINE.·ALL ELEVATIONS, DIMENSIONS, AND LOCATIONS OF RISERS AND INLETS, SHALL BE VERIFIEDBY THE ENGINEER OF RECORD (EOR) PRIOR TO RELEASING FOR FABRICATION.· ALL FITTINGS AND REINFORCEMENT COMPLY WITH ASTM A998.· ALL RISERS AND STUBS ARE 223" x 12" CORRUGATION AND 16 GAGE UNLESS OTHERWISENOTED.·RISERS TO BE FIELD TRIMMED TO GRADE AS REQUIRED, BY CONTRACTOR.·QUANTITY OF PIPE SHOWN DOES NOT PROVIDE EXTRA PIPE FOR CONNECTING THE SYSTEM TOEXISTING PIPE OR DRAINAGE STRUCTURES. OUR SYSTEM AS DETAILED PROVIDES NOMINALINLET AND/OR OUTLET PIPE STUB FOR CONNECTION TO EXISTING DRAINAGE FACILITIES. IFADDITIONAL PIPE IS NEEDED IT IS THE RESPONSIBILITY OF THE CONTRACTOR.·ALL ACCESS CASTINGS ARE THE RESPONSIBILITY OF THE CONTRACTOR AND ARE NOTSUPPLIED BY CONTECH.ASSEMBLYSCALE: 1" = 20'PIPE STORAGE: 3,874 CFSTRUCTURAL BACKFILL STORAGE: PER EOR CFTOTAL STORAGE PROVIDED: PER EOR CFLOADING: H20PIPE INV. = 428. ±3/3/2020THE UNDERSIGNED HEREBY APPROVES THE ATTACHED(65) PAGES INCLUDING THE FOLLOWING:CUSTOMER·PIPE STORAGE = 3,874 CF·MAINLINE PIPE GAGE = 16·WALL TYPE = PERFORATED·DIAMETER = 35" X 24"·FINISH = ALT2·CORRUGATION = 2 2/3x1/2DATESTUB INFORMATIONPIECESTUB INVERTSYSTEMINVERT6"Ø STUB D1428.99428.9912"Ø STUB M2428.99428.996"Ø STUB M3428.99428.9912"Ø STUB N2428.99428.9912"Ø STUB P2428.99428.9912"Ø STUB R2428.99428.9912"Ø STUB S2428.99428.9912"Ø STUB T2428.99428.9912"Ø STUB U2428.99428.99RISER INFORMATIONPIECERIM ELEV.SYSTEMINVERT24"Ø RISER E1435.14428.9924"Ø RISER F1435.14428.9924"Ø RISER G1435.14428.9924"Ø RISER H1435.14428.9924"Ø RISER J1435.14428.9924"Ø RISER K1435.14428.9924"Ø RISER L1435.14428.99 1.50"2.8"COIL WIDTHOPEN AREA = 3.76 SQ IN/SQ FTEDGE SPACING EQUAL ON BOTH SIDES2.05"NOTES:1.PERFORATIONS MEET AASHTO AND ASTM SPECIFICATIONS.2.PERFORATION OPEN AREA PER SQUARE FOOT OF PIPE IS BASEDON THE NOMINAL DIAMETER AND LENGTH OF PIPE.3.DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.4.ALL HOLES 3/8"Ø.EXFILTRATION AREASTANDARD PERFORATION PATTERNSAPPROXIMATE AREA PER LINEAR FOOT OF PIPEPIPECORRUGATION PATTERN2 2/3" x 1/2"3" x 1"5" x 1"ULTRA FLO30"Ø30.5 SQ. IN.32.3 SQ. IN.NOTES:·GAGE AND COATING LIMITATIONS APPLY. 5" x 1" IS NOT AVAILABLE INALUMINUM.·DIMENSIONS SUBJECT TO MANUFACTURER'S TOLERANCES.TYPICAL PERFORATION DETAILNOT TO SCALETYPICAL SECTION VIEWNOT TO SCALENOTE: IF SALTING AGENTS FOR SNOW AND ICE REMOVAL ARE USED ON OR NEAR THEPROJECT, A GEOMEMBRANE BARRIER IS RECOMMENDED WITH THE SYSTEM. THEGEOMEMBRANE LINER IS INTENDED TO HELP PROTECT THE SYSTEM FROM THEPOTENTIAL ADVERSE EFFECTS THAT MAY RESULT FROM A CHANGE IN THESURROUNDING ENVIRONMENT OVER A PERIOD OF TIME. PLEASE REFER TO THECORRUGATED METAL PIPE DETENTION DESIGN GUIDE FOR ADDITIONAL INFORMATION.35" x 24" TYP.15"TYP.15" SEE TYPICALBACKFILL DETAILNOTESLIMITS OFREQUIREDBACKFILL20 MIL PEIMPERMEABLELINER OVERTOP OF PIPE(IF REQUIRED)6FINAL BACKFILLINITIAL BACKFILL 6aBEDDINGFOUNDATIONPIPE EMBEDMENT IN SITUSPAN (S)MINIMUM HEIGHT OFCOVER FOR PIPEARCHES IS SPAN/8 BUTNOT LESS THAN 12" FORCORRUGATIONS:·2 2/3" x 1/2"·3" x 1" (SEE NOTE 6)BACKFILL REQUIREMENTS FOLLOW THE GUIDELINES OF AASHTO LRFD BRIDGE DESIGN (SEC 12) AND CONSTRUCTION (SEC 26)1MINIMUM TRENCH WIDTH MUST ALLOW ROOM FOR PROPER COMPACTION OF HAUNCH MATERIALS UNDER THE PIPE ARCH. THE MINIMUM TRENCH WIDTH (12.6.6.1):SPAN > 12": 1.5S + 12"1aMINIMUM EMBANKMENT WIDTH (IN FEET) FOR INITIAL FILL ENVELOPE (12.6.6.2):·SPAN < 24": 3.0S·SPAN 24" - 112": S + 4'-0"2THE FOUNDATION UNDER THE PIPE ARCH AND SIDE BACKFILL SHALL BE ADEQUATE TO SUPPORT THE LOADS ACTING UPON IT (26.5.2).3ENGINEER TO DETERMINE IF BEDDING IS REQUIRED. BEDDING MATERIAL SHALL BE A RELATIVELY LOOSE MATERIAL THAT IS ROUGHLYSHAPED TO FIT THE BOTTOM OF THE PIPE ARCH, AND A MINIMUM OF TWICE THE CORRUGATION DEPTH IN THICKNESS, WITH THEMAXIMUM PARTICLE SIZE OF ONE-HALF OF THE CORRUGATION DEPTH (26.3.8.1). WIDTH OF BEDDING TO BE EXTENTS OF THE INVERT OFTHE PIPE ARCH (26.5.3, FIG. 26.5.3-1).4CORRUGATED ALUMINUM PIPE ARCH (CAPA) [CORLIX PIPE ARCH].5HAUNCH ZONE MATERIAL SHALL BE HAND SHOVELED OR SHOVEL SLICED INTO PLACE TO ALLOW FOR PROPER COMPACTION(26.5.2 & 26.5.4).5aINITIAL BACKFILL FOR PIPE EMBEDMENT TO MEET AASHTO A-1, A-2 OR A-3 CLASSIFICATION, OR APPROVED EQUAL, COMPACTED TO 90%STANDARD PROCTOR (T 99). MAXIMUM PARTICLE SIZE NOT TO EXCEED 3" (12.4.1.2). ALL LIFTS SHALL BE PLACED IN A CONTROLLEDMANNER. IT IS RECOMMENDED THAT LIFTS NOT EXCEED AN 8" UNCOMPACTED LIFT HEIGHT TO PREVENT UNEVEN LOADING, AND THELESSER OF 1/3 THE SPAN OR 24" AS THE MAXIMUM DIFFERENTIAL SIDE-TO-SIDE (26.5.4).6INITIAL BACKFILL ABOVE PIPE ARCH MAY INCLUDE ROAD BASE MATERIAL (AND RIGID PAVEMENT IF APPLICABLE).SEE TABLE ABOVE.INITIAL BACKFILL OF 7.50" PER ENGINEER OF RECORD6aTOTAL HEIGHT OF COMPACTED COVER FOR CONVENTIONAL HIGHWAY LOADS IS MEASURED FROM TOP OF PIPE ARCH TO BOTTOM OFFLEXIBLE PAVEMENT OR TOP OF RIGID PAVEMENT (12.6.6.3).7FINAL BACKFILL MATERIAL SELECTION AND COMPACTION REQUIREMENTS SHALL FOLLOW THE PROJECT PLANS AND SPECIFICATIONSPER THE ENGINEER OF RECORD (26.5.4.1). PER ENGINEER OF RECORD, 10.5" CLEAN ROCK WITH 40% POROSITY.NOTES:·ENGINEER TO DETERMINE IF GEOTEXTILE SHOULD BE CONSIDERED FOR USE TO PREVENT SOIL MIGRATION INTO VARYING SOIL TYPES (PROJECT ENGINEER).·FOR MULTIPLE BARREL INSTALLATIONS THE RECOMMENDED STANDARD SPACING BETWEEN PARALLEL PIPE ARCH RUNS SHALL BE SPAN/3 BUT NO LESS THAN12", OR 36" FOR PIPE ARCH SPANS 108" AND LARGER. CONTACT YOUR CONTECH REPRESENTATIVE FOR NONSTANDARD SPACING (SEE TABLE C12.6.7-1).5a75324TYPICAL BACKFILL DETAILNOT TO SCALEEMBANKMENT CONDITIONTRENCH CONDITIONINITIAL FILL ENVELOPE 1 1a11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJSD/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-40-CMP DETENTION\DRAWINGS\624723-040-CMP CONFAB.DWG 3/4/2020 8:35 AM SHEET NO.:61OFJSD/JMDDATE:PROJECT No.:624723SEQ. No.:040PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-040FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUCP BASIN #4The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY PIPE Ø 2'-6"PIPE Ø2'-6"PIPE Ø FRONTTYPICAL MANWAY DETAILNOT TO SCALE1'-0" MIN.48"Ø to 90"Ø FITTING REINFORCEMENTMAY BE REQUIRED BASED ON HEIGHT OFCOVER AND LIVE LOAD CONDITIONPLAN3/3/2020 11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAX12" TECHCO BAND ANGLES 1/2" DIA. BOLT12" RISER BAND DETAILNOT TO SCALEPLAIN END CMP RISER PIPECONNECTION DETAIL7 1/2" TECHCO SHOWN - MAY VARYSTUB HEIGHT2'-0" RECOMMENDED12" MIN.MAINLINEPIPERISEREXTENSIONFLAT BAND SHOWN,MAY VARY (NOGASKET)GENERAL NOTES:1.DELIVERED BAND STYLE AND FASTENER TYPE MAY VARY BY FABRICATION PLANT.2.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.3.BAND MATERIAL AND GAGE TO BE SAME AS RISER MATERIAL.4.IF RISER HAS A HEIGHT OF COVER OF 10' OR MORE, USE A SLIP JOINT.5.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" 2-PIECES6.ALL RISER JOINT COMPONENTS WILL BE FIELD ASSEMBLED.7.MANHOLE RISERS IN APPLICATIONS WHERE TRAFFIC LOADS ARE IMPOSED REQUIRE SPECIAL DESIGN CONSIDERATIONS.8.DIMENSIONS SUBJECT TO MANUFACTURING TOLERANCES.ELEVATION VIEWOF CMP AND RISERNO GASKETCORRUGATEDBANDCONNECTION DETAIL12" TECHCO2 2/3"x1/2" RIVETED PIPE5-C BAND DETAILNOT TO SCALEGENERAL NOTES:1.JOINT IS TO BE ASSEMBLED PER AASHTO BRIDGE CONSTRUCTION SPECIFICATION SEC 26.4.2.4.2.BAND MATERIALS AND/OR COATING CAN VARY BY LOCATION. CONTACT YOUR CONTECH REPRESENTATIVE FOR AVAILABILITY.3.BANDS ARE SHAPED TO MATCH THE PIPE-ARCH WHEN APPLICABLE.4.BANDS ARE NORMALLY FURNISHED AS FOLLOWS:·12" THRU 48" 1-PIECE·54" THRU 96" 2-PIECES·102" THRU 144" 3-PIECES5.BAND FASTENERS ARE ATTACHED WITH SPOT WELDS, RIVETS OR HAND WELDS.6.ALL CMP IS REROLLED TO HAVE ANNULAR END CORRUGATIONS OF 2 2/3"x1/2"7.DIMENSIONS ARE SUBJECT TO MANUFACTURING TOLERANCES.8.ORDER SHALL DESIGNATE GASKET OPTION, IF REQUIRED (SEE DETAILS ABOVE).TECHCO BAND ANGLES1/2" DIA. BOLT12 1/4"JSD/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-40-CMP DETENTION\DRAWINGS\624723-040-CMP CONFAB.DWG 3/4/2020 8:35 AM SHEET NO.:62OFJSD/JMDDATE:PROJECT No.:624723SEQ. No.:040PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-040FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUCP BASIN #4The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 MANHOLE CAP DETAILNOT TO SCALE8"11" TYP.2" COVER TYP.1" GAP (TYP. ALL SIDES)NOTES:1.DESIGN IN ACCORDANCE WITH AASHTO, 17thEDITION AND ACI 350.2.DESIGN LOAD HS25.3.EARTH COVER = 1' MAX.4.CONCRETE STRENGTH = 4,000 psi5.REINFORCING STEEL = ASTM A615, GRADE 60.6.PROVIDE ADDITIONAL REINFORCING AROUNDOPENINGS EQUAL TO THE BARS INTERRUPTED,HALF EACH SIDE. ADDITIONAL BARS TO BE IN THESAME PLANE.AA 2" COVER(TYP)SECTION VIEWROUND OPTION PLAN VIEWSQUARE OPTION PLAN VIEWØ CMP RISERINTERRUPTED BARREPLACEMENT,SEE NOTE 6.STANDARDREINFORCING,SEE TABLEOPENING INPROTECTIONSLAB FORACESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.AINTERRUPTED BARREPLACEMENT, SEENOTE 6.BOPENING INPROTECTIONSLAB FORACCESS#4 DIAGONAL TRIMBAR (TYP. 4 PLACES),SEE NOTE 7.STANDARDREINFORCING,SEE TABLEGASKET MATERIALSUFFICIENT TO PREVENTSLAB FROM BEARING ONRISER TO BE PROVIDED BYCONTRACTOR.2" COVER(TYP.)ØBREINFORCING TABLEØ CMPRISERAB ØREINFORCING**BEARINGPRESSURE(PSF)24"4'Ø4'x4'26"#5 @ 10" OCEW#5 @ 10" OCEW2,5401,90030"4'-6"Ø4'-6" x 4'-6"32"#5 @ 10" OCEW#5 @ 9" OCEW2,2601,67036"5'Ø5' x 5'38"#5 @ 9" OCEW#5 @ 8" OCEW2,0601,50042"5'-6"Ø5'-6" x 5'-6"44"#5 @ 8" OCEW#5 @ 8" OCEW1,4901,37048"6'Ø6' x 6'50"#5 @ 7" OCEW#5 @ 7" OCEW1,2101,270** ASSUMED SOIL BEARING CAPACITY1'-0"A2 " C O V E R ( T YP . ) 2 " COV ER ( T YP )7.TRIM OPENING WITH DIAGONAL #4 BARS, EXTEND BARS AMINIMUM OF 12" BEYOND OPENING, BEND BARS AS REQUIREDTO MAINTAIN BAR COVER.8.PROTECTION SLAB AND ALL MATERIALS TO BE PROVIDED ANDINSTALLED BY CONTRACTOR.9.DETAIL DESIGN BY DELTA ENGINEERS, ARCHITECTS AND LANDSURVEYORS, ENDWELL, NY.ØB36"Ø MAX., HS-25 ACCESS CASTINGWITH GRADE RINGS AS REQUIRED, TOBE PROVIDED AND INSTALLED BYCONTRACTOR. MAY BE TOP MOUNTED(AS SHOWN) OR RECESSED.CMPPROTECTIONSLABVARIESRIM/FINISHEDGRADEACCESS CASTING NOT SUPPLIED BY CONTECH11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJSD/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-40-CMP DETENTION\DRAWINGS\624723-040-CMP CONFAB.DWG 3/4/2020 8:35 AM SHEET NO.:63OFJSD/JMDDATE:PROJECT No.:624723SEQ. No.:040PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-040FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUCP BASIN #4The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.comCONSTRUCTION LOADSFOR TEMPORARY CONSTRUCTION VEHICLE LOADS, AN EXTRA AMOUNT OF COMPACTED COVER MAY BE REQUIRED OVERTHE TOP OF THE PIPE. THE HEIGHT-OF-COVER SHALL MEET THE MINIMUM REQUIREMENTS SHOWN IN THE TABLE BELOW.THE USE OF HEAVY CONSTRUCTION EQUIPMENT NECESSITATES GREATER PROTECTION FOR THE PIPE THAN FINISHEDGRADE COVER MINIMUMS FOR NORMAL HIGHWAY TRAFFIC.PIPE SPAN,INCHES18-50MINIMUM COVER (FT)AXLE LOADS(kips)50-7575-110110-15012-422.02.53.03.04.03.53.048-723.03.078-1203.54.04.04.54.54.0126-1443.5*MINIMUM COVER MAY VARY, DEPENDING ON LOCAL CONDITIONS. THE CONTRACTOR MUST PROVIDE THE ADDITIONALCOVER REQUIRED TO AVOID DAMAGE TO THE PIPE. MINIMUM COVER IS MEASURED FROM THE TOP OF THE PIPE TOTHE TOP OF THE MAINTAINED CONSTRUCTION ROADWAY SURFACE. HEIGHT OFCOVERTEMPORARY COVER FORCONSTRUCTION LOADSFINISHEDGRADE CONSTRUCTION LOADING DIAGRAMNOT TO SCALESCOPETHIS SPECIFICATION COVERS THE MANUFACTURE ANDINSTALLATION OF THE CORRUGATED STEEL PIPE (CSP) DETAILED INTHE PROJECT PLANS.MATERIALTHE ALUMINIZED TYPE 2 STEEL COILS SHALL CONFORM TO THEAPPLICABLE REQUIREMENTS OF AASHTO M274 OR ASTM A929.PIPETHE CSP SHALL BE MANUFACTURED IN ACCORDANCE WITH THEAPPLICABLE REQUIREMENTS OF AASHTO M36 OR ASTM A760. THEPIPE SIZES, GAGES AND CORRUGATIONS SHALL BE AS SHOWN ONTHE PROJECT PLANS.ALL FABRICATION OF THE PRODUCT SHALL OCCUR WITHIN THEUNITED STATES.HANDLING AND ASSEMBLYSHALL BE IN ACCORDANCE WITH RECOMMENDATIONS OF THENATIONAL CORRUGATED STEEL PIPE ASSOCIATION (NCSPA)INSTALLATIONSHALL BE IN ACCORDANCE WITH AASHTO STANDARDSPECIFICATIONS FOR HIGHWAY BRIDGES, SECTION 26, DIVISION IIOR ASTM A798 AND IN CONFORMANCE WITH THE PROJECT PLANSAND SPECIFICATIONS. IF THERE ARE ANY INCONSISTENCIES ORCONFLICTS THE CONTRACTOR SHOULD DISCUSS AND RESOLVEWITH THE SITE ENGINEER.IT IS ALWAYS THE RESPONSIBILITY OF THE CONTRACTOR TOFOLLOW OSHA GUIDELINES FOR SAFE PRACTICES.SPECIFICATION FOR CORRUGATED STEEL PIPE-ALUMINIZED TYPE 2 STEELMATERIAL SPECIFICATIONNOT TO SCALE65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 RISER LADDER DETAILNOT TO SCALEPART NO. HALAGVL16PLANAA3"±6"(2) 14" FILLET WELDS1" LONG FROM EACH ANGLETO LADDER RAILRISER w/ LADDER AND STEPS IF EXTENSION IS REQUIREDPROVIDE MINIMUM OF 4 ATTACHMENTANGLES (2 ON EITHER SIDE OF LADDER RAIL)TO CONNECT LADDER TO RISER EXTENSIONRISER w/ LADDERAND STEPSMAINLINE CMP223 x 12, 5 x 1, 3 x 1, ETC.1'-6"MAX.℄ PIPE ∠5" x 3" x 14" x 16" LONG AT 1'-0"SPACING. LONG LEG TOPROJECT OUT. WELD TOPAND BOTTOM OF 3" LEG TO EACHCORRUGATION CREST(THESE ANGLES SHOULD BE USEDFOR LARGER DIAMETERMAINLINES WHERE ADDITIONALSTEPS ARE NEEDED)6" FROM RUNG TORISER JOINT6" FROM RUNG TORISER JOINT*NOTE: WHEN RISER EXTENSIONSARE USED, THE PLANT SHOULDCUT 3" FROM THE SIDE RAILS ASSHOWN(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELD EACH SIDE)RISER NORMALLY CMPWITH 223" x 12"CORRUGATIONSLADDER RAILS AND RUNGS(2) 14" FILLET WELDS 1" LONGATTACHMENT ANGLEMINIMUM OF 4 ANGLES PERLADDER SECTION, (2 EACH SIDE OFLADDER) 6' MAX. SPACINGVERTICALLYLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONGRISER(4) 116" FILLET WELDS FROMEACH ANGLE CORRUGATIONCREST (2 WELDS EACH SIDE)(4) ∠3" x 3" x 316"512" LONGLADDER RAILSAND RUNGS∠3" x 3" x 316"512" LONG(4) 116" FILLET WELDSFROM EACH ANGLE TOCORRUGATION CREST(2 WELDS EACH SIDE)ELEVATIONSECTION A-AFABRICATION TOLERANCE: ±14"FLAT BAR AND REBAR: MILLTOLERANCE APPLIES12" TYP.CENTER TO CENTERRUNG SPACING34" (#6) REBAR CAN BE CUT FLUSHTO OUTSIDE OF RAIL(BAR LENGTH = 1634") OR BAR CANEXTEND BEYOND RAIL 12"±78" HOLE w/ 34" REBAR RUNG,WELD REBAR TO RUNG ONOUTSIDE OF STEEL RAIL212" x 38" FLAT BAR SIDE RAIL1'-4"1'-4"6"212"6"*3" FROM BOTTOM OF LADDERRAIL TO RISER JOINT*3" FROM TOP OF LADDERRAIL TO RISER JOINT1'-0"ALL STEEL PERASTM A361'-0"TYP.PLANSIDENOTE:THIS DRAWING IS INTENDED TO APPLY TO LADDERSINSTALLED IN RISERS HAVING A DIAMETER OF 30" ORLARGER. DUE TO SPACE CONSTRAINTS AND LIMITEDACCESSIBILITY, THE PRACTICALITY AND SUITABILITY OFUTILIZING RISERS SMALLER THAN 30" DIAMETERAND/OR INCORPORATING LADDERS IN THESE SMALLERDIAMETER RISERS SHOULD BE ADDRESSED BY THEOWNER AND PROJECT ENGINEERSTANDARD LADDER DETAILNOT TO SCALENOTES:1.LADDERS CAN BE MADE IN 20'-0" STANDARD LENGTHS AND CUT TO FIT2.ALL MATERIAL TO MEET ASTM A363.LADDER TO BE HOT DIPPED GALVANIZED PER ASTM A-123 AFTERFABRICATION IS COMPLETE3/8"TYP.11815 NE Glenn Widing Drive, Portland, OR 97220800-548-4667 503-240-3393 800-561-1271 FAXJSD/JMDJPC/DJBCHECKED:DRAWN:KETDESIGNED:APPROVED:\\AD.CONTECH-CPI.COM\ROOT\MERLIN\PROJECT\ACTIVE\624700\624723\624723-40-CMP DETENTION\DRAWINGS\624723-040-CMP CONFAB.DWG 3/4/2020 8:35 AM SHEET NO.:64OFJSD/JMDDATE:PROJECT No.:624723SEQ. No.:040PROPOSALCONTECHDRAWING35" x 24" PERFORATED UNDERGROUND RETENTION SYSTEM - 624723-040FUPC (FUNDAMENTALIST UKRANIAN PENTECOSTALIST CHURCH)RENTON, WASITE DESIGNATION: FUCP BASIN #4The design and information shown on this drawing is providedas a service to the project owner, engineer and contractor byContech Engineered Solutions LLC ("Contech"). Neither thisdrawing, nor any part thereof, may be used, reproduced ormodified in any manner without the prior written consent ofContech. Failure to comply is done at the user's own risk andContech expressly disclaims any liability or responsibility forsuch use.If discrepancies between the supplied information upon whichthe drawing is based and actual field conditions are encounteredas site work progresses, these discrepancies must be reportedto Contech immediately for re-evaluation of the design. Contechaccepts no liability for designs based on missing, incomplete orinaccurate information supplied by others.www.ContechES.com65REVISION DESCRIPTIONDATEMARKBY 3/3/2020 TED-40-4083 IN COMPLIANCE WITH CITY OF RENTON STANDARDSBASE MAP/TOPOGRAPHY PROVIDED BYOTHERS. ABOSSEIN ENGINEERING (AE)CANNOT BE HELD LIABLE FORACCURACY. CONTRACTOR SHALL FIELDVERIFY GRADES, UTILITIES AND ALLOTHER EX FEATURES & CONDITIONS. IFCONDITIONS ARE NOT AS SHOWN &/ORPLANS CANNOT BE CONSTRUCTED ASSHOWN, CONTACT AE PRIOR TOCONSTRUCTION.CALL 811 (2) BUSINESS DAYSBEFORE YOU DIG(UNDERGROUND UTILITYLOCATIONS ARE APPROXIMATE)FIRST UKRAINIAN PENTECOSTAL CHURCH3811 NE 21ST STRENTON, WA 9805611-19-19AS INDICATEDON DRAWING64C: 19-004330FIRST UKRAINIAN PENTECOSTAL CHURCH LUA:18-000253PR:17-000160-Call before you digSITE DESIGNATION: FUPC BASIN #464R-408351656565 Project Name Fundamentalist Ukranian Pentecostalist Church Date 10/29/2019 Completed By SKJ Upward Force System Envelope Length, ft 194.16 Width, ft 29.16 Height, ft 2.5 Water Displaced Volume, cf 14,154 Weight, lb 883,226 Total Upward Force, lb 883,226 Downward Force Pipe LF 1,344 lb/ ft 24 Weight, lb 32,256 Stone Env Volume, cf 14,154 Pipe Volume, cf 6,599 Stone Volume, cf 7,555 Unit weight of Stone, lb/cf 100 Stone weight, lb 755,522 Soil Cover Length, ft 194.16 Width, ft 29.16 Height, ft 1 Unit Weight of Soil, lb/cf 120 Weight of Soil, lb 679,405 Total Dwonward Force, lb 1,467,183 Resulting Upward Force, lb (583,957) * Floatation should not occur *Resulting force calculated by Contech and should be confirmed by engineer of record These results are submitted to you as a guideline only, without liability on the part of CONTECH Construction Products Inc. for accuracy or suitability to any particular application, and are subject to your verification. PROJECT ID/NAME LOCATION ~Input Data~ Pipe O.D. (Do) =37 in. Pipe I.D. (Di) =36 in. Height of cover (Hc)=1.1 ft. above TOP of pipe Pipe weight (Pw) =25 lbs/ft Unit weight of dry soil (UWd) =120 lbs/ft^3 Unit weight of water (UWw) =62.4 lbs/ft^3 Groundwater elevation (Hw) =0.6 ft. above BOTTOM of pipe Water level in pipe (Lw) =0 in. Void ratio (e) =0.45 (Vv/Vs) Specific Gravity (Gs) =2.65 (density of solids/density of water) ~Calculations~ Area of water in pipe =0.00 ft^2 Pi*Di^2/4 - (2*(theta)/360 x (Pi*Di^2/4) - (Lw-Di/2)^2 x tan(theta)) Weight of water in pipe =0.00 lbs/ft Area of water in pipe x UWw Area of water displaced =1.02 ft^2 2*(theta)/360 x (Pi*Do^2/4)- (Do/2-Hw)^2 x tan(theta) Weight of water displaced =63.79 lbs/ft Area of water displaced x UWw Area of submerged soil =0.00 ft^2 Weight of buoyant soil =0.00 lbs/ft Area of submerged soil x (UWw/(1+e)) x (Gs-1) Dry soil weight =552.55 lbs/ft Hc*(Do) + Do^2/2 - Pi*Do^2/8 - Area of submerged soil Total resisting force =577.55 lbs Buoyant Force =63.79 lbs Flotation should not be a problem Pipe Flotation Calculations FUPC Renton, WA ENGINEERING SERVICES ALPHA THETA Hc ID OD SUBMERGED SOIL DRY SOIL Hw C:\Users\kthomason\OneDrive - Contech Engineered Solutions\Desktop\FUPC 36in Pipe Flotation Calculations.xls 7/15/20192:24 PM These results are submitted to you as a guideline only, without liability on the part of CONTECH Construction Products Inc. for accuracy or suitability to any particular application, and are subject to your verification. PROJECT ID/NAME LOCATION ~Input Data~ Pipe O.D. (Do) =43 in. Pipe I.D. (Di) =42 in. Height of cover (Hc)=1.35 ft. above TOP of pipe Pipe weight (Pw) =37 lbs/ft Unit weight of dry soil (UWd) =120 lbs/ft^3 Unit weight of water (UWw) =62.4 lbs/ft^3 Groundwater elevation (Hw) =0.6 ft. above BOTTOM of pipe Water level in pipe (Lw) =0 in. Void ratio (e) =0.45 (Vv/Vs) Specific Gravity (Gs) =2.65 (density of solids/density of water) ~Calculations~ Area of water in pipe =0.00 ft^2 Pi*Di^2/4 - (2*(theta)/360 x (Pi*Di^2/4) - (Lw-Di/2)^2 x tan(theta)) Weight of water in pipe =0.00 lbs/ft Area of water in pipe x UWw Area of water displaced =1.11 ft^2 2*(theta)/360 x (Pi*Do^2/4)- (Do/2-Hw)^2 x tan(theta) Weight of water displaced =69.40 lbs/ft Area of water displaced x UWw Area of submerged soil =0.00 ft^2 Weight of buoyant soil =0.00 lbs/ft Area of submerged soil x (UWw/(1+e)) x (Gs-1) Dry soil weight =786.71 lbs/ft Hc*(Do) + Do^2/2 - Pi*Do^2/8 - Area of submerged soil Total resisting force =823.71 lbs Buoyant Force =69.40 lbs Flotation should not be a problem Pipe Flotation Calculations FUPC Renton, WA ENGINEERING SERVICES ALPHA THETA Hc ID OD SUBMERGED SOIL DRY SOIL Hw C:\Users\kthomason\OneDrive - Contech Engineered Solutions\Desktop\FUPC 49x33in Pipe Flotation Calculations.xls 7/15/20192:25 PM ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment C Geotech Report ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment D CSWPP/Erosion Control Plan ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment E Bond Quantities Worksheet CED Permit #:######## Unit Reference #Price Unit Quantity Cost Backfill & compaction-embankment ESC-1 6.50$ CY Check dams, 4" minus rock ESC-2 SWDM 5.4.6.3 80.00$ Each Catch Basin Protection ESC-3 35.50$ Each 3 106.50 Crushed surfacing 1 1/4" minus ESC-4 WSDOT 9-03.9(3)95.00$ CY Ditching ESC-5 9.00$ CY Excavation-bulk ESC-6 2.00$ CY Fence, silt ESC-7 SWDM 5.4.3.1 1.50$ LF 130 195.00 Fence, Temporary (NGPE)ESC-8 1.50$ LF Geotextile Fabric ESC-9 2.50$ SY Hay Bale Silt Trap ESC-10 0.50$ Each Hydroseeding ESC-11 SWDM 5.4.2.4 0.80$ SY Interceptor Swale / Dike ESC-12 1.00$ LF Jute Mesh ESC-13 SWDM 5.4.2.2 3.50$ SY Level Spreader ESC-14 1.75$ LF Mulch, by hand, straw, 3" deep ESC-15 SWDM 5.4.2.1 2.50$ SY Mulch, by machine, straw, 2" deep ESC-16 SWDM 5.4.2.1 2.00$ SY Piping, temporary, CPP, 6"ESC-17 12.00$ LF Piping, temporary, CPP, 8"ESC-18 14.00$ LF Piping, temporary, CPP, 12"ESC-19 18.00$ LF Plastic covering, 6mm thick, sandbagged ESC-20 SWDM 5.4.2.3 4.00$ SY Rip Rap, machine placed; slopes ESC-21 WSDOT 9-13.1(2)45.00$ CY Rock Construction Entrance, 50'x15'x1'ESC-22 SWDM 5.4.4.1 1,800.00$ Each 2 3,600.00 Rock Construction Entrance, 100'x15'x1'ESC-23 SWDM 5.4.4.1 3,200.00$ Each Sediment pond riser assembly ESC-24 SWDM 5.4.5.2 2,200.00$ Each Sediment trap, 5' high berm ESC-25 SWDM 5.4.5.1 19.00$ LF Sed. trap, 5' high, riprapped spillway berm section ESC-26 SWDM 5.4.5.1 70.00$ LF Seeding, by hand ESC-27 SWDM 5.4.2.4 1.00$ SY Sodding, 1" deep, level ground ESC-28 SWDM 5.4.2.5 8.00$ SY Sodding, 1" deep, sloped ground ESC-29 SWDM 5.4.2.5 10.00$ SY TESC Supervisor ESC-30 110.00$ HR 24 2,640.00 Water truck, dust control ESC-31 SWDM 5.4.7 140.00$ HR 5 700.00 Unit Reference #Price Unit Quantity Cost EROSION/SEDIMENT SUBTOTAL:7,241.50 SALES TAX @ 10%724.15 EROSION/SEDIMENT TOTAL:7,965.65 (A) SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR EROSION & SEDIMENT CONTROL Description No. (A) WRITE-IN-ITEMS Page 1 of 1 Ref 8-H Bond Quantity Worksheet SECTION II.a EROSION_CONTROL Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost GENERAL ITEMS Backfill & Compaction- embankment GI-1 6.00$ CY Backfill & Compaction- trench GI-2 9.00$ CY Clear/Remove Brush, by hand (SY)GI-3 1.00$ SY 417 417.00 Bollards - fixed GI-4 240.74$ Each Bollards - removable GI-5 452.34$ Each Clearing/Grubbing/Tree Removal GI-6 10,000.00$ Acre Excavation - bulk GI-7 2.00$ CY 2780 5,560.00 Excavation - Trench GI-8 5.00$ CY 51 255.00 Fencing, cedar, 6' high GI-9 20.00$ LF Fencing, chain link, 4'GI-10 38.31$ LF Fencing, chain link, vinyl coated, 6' high GI-11 20.00$ LF Fencing, chain link, gate, vinyl coated, 20' GI-12 1,400.00$ Each Fill & compact - common barrow GI-13 25.00$ CY Fill & compact - gravel base GI-14 27.00$ CY 51 1,377.00 Fill & compact - screened topsoil GI-15 39.00$ CY Gabion, 12" deep, stone filled mesh GI-16 65.00$ SY Gabion, 18" deep, stone filled mesh GI-17 90.00$ SY Gabion, 36" deep, stone filled mesh GI-18 150.00$ SY Grading, fine, by hand GI-19 2.50$ SY 107 267.50 Grading, fine, with grader GI-20 2.00$ SY Monuments, 3' Long GI-21 250.00$ Each Sensitive Areas Sign GI-22 7.00$ Each Sodding, 1" deep, sloped ground GI-23 8.00$ SY 100 800.00 Surveying, line & grade GI-24 850.00$ Day 2 1,700.00 Surveying, lot location/lines GI-25 1,800.00$ Acre Topsoil Type A (imported)GI-26 28.50$ CY Traffic control crew ( 2 flaggers )GI-27 120.00$ HR 5 600.00 Trail, 4" chipped wood GI-28 8.00$ SY Trail, 4" crushed cinder GI-29 9.00$ SY Trail, 4" top course GI-30 12.00$ SY Conduit, 2"GI-31 5.00$ LF Wall, retaining, concrete GI-32 55.00$ SF Wall, rockery GI-33 15.00$ SF SUBTOTAL THIS PAGE:10,976.50 (B)(C)(D)(E) SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR STREET AND SITE IMPROVEMENTS Quantity Remaining (Bond Reduction) (B)(C) Page 1 of 6 Ref 8-H Bond Quantity Worksheet SECTION II.b TRANSPORTATION Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR STREET AND SITE IMPROVEMENTS Quantity Remaining (Bond Reduction) (B)(C) ROAD IMPROVEMENT/PAVEMENT/SURFACING AC Grinding, 4' wide machine < 1000sy RI-1 30.00$ SY AC Grinding, 4' wide machine 1000-2000sy RI-2 16.00$ SY AC Grinding, 4' wide machine > 2000sy RI-3 10.00$ SY AC Removal/Disposal RI-4 35.00$ SY 110 3,850.00 Barricade, Type III ( Permanent )RI-5 56.00$ LF Guard Rail RI-6 30.00$ LF Curb & Gutter, rolled RI-7 17.00$ LF Curb & Gutter, vertical RI-8 12.50$ LF 238 2,975.00 Curb and Gutter, demolition and disposal RI-9 18.00$ LF Curb, extruded asphalt RI-10 5.50$ LF Curb, extruded concrete RI-11 7.00$ LF 1008 7,056.00 Sawcut, asphalt, 3" depth RI-12 1.85$ LF 330 610.50 Sawcut, concrete, per 1" depth RI-13 3.00$ LF Sealant, asphalt RI-14 2.00$ LF 330 660.00 Shoulder, gravel, 4" thick RI-15 15.00$ SY Sidewalk, 4" thick RI-16 38.00$ SY 187 7,106.00 Sidewalk, 4" thick, demolition and disposal RI-17 32.00$ SY Sidewalk, 5" thick RI-18 41.00$ SY 28 1,148.00 Sidewalk, 5" thick, demolition and disposal RI-19 40.00$ SY Sign, Handicap RI-20 85.00$ Each 6 510.00 Striping, per stall RI-21 7.00$ Each 181 1,267.00 Striping, thermoplastic, ( for crosswalk )RI-22 3.00$ SF Striping, 4" reflectorized line RI-23 0.50$ LF Additional 2.5" Crushed Surfacing RI-24 3.60$ SY HMA 1/2" Overlay 1.5" RI-25 14.00$ SY HMA 1/2" Overlay 2"RI-26 18.00$ SY HMA Road, 2", 4" rock, First 2500 SY RI-27 28.00$ SY 248 6,944.00 HMA Road, 2", 4" rock, Qty. over 2500SY RI-28 21.00$ SY HMA Road, 4", 6" rock, First 2500 SY RI-29 45.00$ SY 110 4,950.00 HMA Road, 4", 6" rock, Qty. over 2500 SY RI-30 37.00$ SY HMA Road, 4", 4.5" ATB RI-31 38.00$ SY Gravel Road, 4" rock, First 2500 SY RI-32 15.00$ SY Gravel Road, 4" rock, Qty. over 2500 SY RI-33 10.00$ SY Thickened Edge RI-34 8.60$ LF SUBTOTAL THIS PAGE:28,243.50 8,833.00 (B)(C)(D)(E) Page 2 of 6 Ref 8-H Bond Quantity Worksheet SECTION II.b TRANSPORTATION Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR STREET AND SITE IMPROVEMENTS Quantity Remaining (Bond Reduction) (B)(C) PARKING LOT SURFACING No. 2" AC, 2" top course rock & 4" borrow PL-1 21.00$ SY 44795 940,695.00 2" AC, 1.5" top course & 2.5" base course PL-2 28.00$ SY 4" select borrow PL-3 5.00$ SY 1.5" top course rock & 2.5" base course PL-4 14.00$ SY SUBTOTAL PARKING LOT SURFACING:940,695.00 (B)(C)(D)(E) LANDSCAPING & VEGETATION No. Street Trees LA-1 500.00$ 3 1,500.00 Median Landscaping LA-2 Right-of-Way Landscaping LA-3 2,000.00$ 1 2,000.00 Wetland Landscaping LA-4 SUBTOTAL LANDSCAPING & VEGETATION:3,500.00 (B)(C)(D)(E) TRAFFIC & LIGHTING No. Signs TR-1 Street Light System ( # of Poles)TR-2 Traffic Signal TR-3 Traffic Signal Modification TR-4 SUBTOTAL TRAFFIC & LIGHTING: (B)(C)(D)(E) WRITE-IN-ITEMS SUBTOTAL WRITE-IN ITEMS: STREET AND SITE IMPROVEMENTS SUBTOTAL:31,743.50 19,809.50 SALES TAX @ 10%3,174.35 1,980.95 STREET AND SITE IMPROVEMENTS TOTAL:34,917.85 21,790.45 (B)(C)(D)(E) Page 3 of 6 Ref 8-H Bond Quantity Worksheet SECTION II.b TRANSPORTATION Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost DRAINAGE (CPE = Corrugated Polyethylene Pipe, N12 or Equivalent) For Culvert prices, Average of 4' cover was assumed. Assume perforated PVC is same price as solid pipe.) Access Road, R/D D-1 26.00$ SY * (CBs include frame and lid) Beehive D-2 90.00$ Each 8 720.00 Through-curb Inlet Framework D-3 400.00$ Each CB Type I D-4 1,500.00$ Each 4 6,000.00 CB Type IL D-5 1,750.00$ Each CB Type II, 48" diameter D-6 2,300.00$ Each 4 9,200.00 for additional depth over 4' D-7 480.00$ FT 4 1,920.00 CB Type II, 54" diameter D-8 2,500.00$ Each for additional depth over 4'D-9 495.00$ FT CB Type II, 60" diameter D-10 2,800.00$ Each for additional depth over 4'D-11 600.00$ FT CB Type II, 72" diameter D-12 6,000.00$ Each for additional depth over 4'D-13 850.00$ FT CB Type II, 96" diameter D-14 14,000.00$ Each for additional depth over 4'D-15 925.00$ FT Trash Rack, 12"D-16 350.00$ Each Trash Rack, 15"D-17 410.00$ Each Trash Rack, 18"D-18 480.00$ Each Trash Rack, 21"D-19 550.00$ Each Cleanout, PVC, 4"D-20 150.00$ Each Cleanout, PVC, 6"D-21 170.00$ Each 2 340.00 Cleanout, PVC, 8"D-22 200.00$ Each Culvert, PVC, 4" D-23 10.00$ LF Culvert, PVC, 6" D-24 13.00$ LF 869 11,297.00 Culvert, PVC, 8" D-25 15.00$ LF Culvert, PVC, 12" D-26 23.00$ LF 337 7,751.00 Culvert, PVC, 15" D-27 35.00$ LF Culvert, PVC, 18" D-28 41.00$ LF Culvert, PVC, 24"D-29 56.00$ LF Culvert, PVC, 30" D-30 78.00$ LF Culvert, PVC, 36" D-31 130.00$ LF Culvert, CMP, 8"D-32 19.00$ LF Culvert, CMP, 12"D-33 29.00$ LF SUBTOTAL THIS PAGE:37,228.00 (B)(C)(D)(E) SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR DRAINAGE AND STORMWATER FACILITIES Quantity Remaining (Bond Reduction) (B)(C) Page 1 of 5 Ref 8-H Bond Quantity Worksheet SECTION II.c DRAINAGE Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR DRAINAGE AND STORMWATER FACILITIES Quantity Remaining (Bond Reduction) (B)(C) DRAINAGE (Continued) Culvert, CMP, 15"D-34 35.00$ LF Culvert, CMP, 18"D-35 41.00$ LF Culvert, CMP, 24"D-36 56.00$ LF Culvert, CMP, 30"D-37 78.00$ LF 4440 346,320.00 Culvert, CMP, 36"D-38 130.00$ LF Culvert, CMP, 48"D-39 190.00$ LF Culvert, CMP, 60"D-40 270.00$ LF Culvert, CMP, 72"D-41 350.00$ LF Culvert, Concrete, 8"D-42 42.00$ LF Culvert, Concrete, 12"D-43 48.00$ LF Culvert, Concrete, 15"D-44 78.00$ LF Culvert, Concrete, 18"D-45 48.00$ LF Culvert, Concrete, 24"D-46 78.00$ LF Culvert, Concrete, 30"D-47 125.00$ LF Culvert, Concrete, 36"D-48 150.00$ LF Culvert, Concrete, 42"D-49 175.00$ LF Culvert, Concrete, 48"D-50 205.00$ LF Culvert, CPE Triple Wall, 6" D-51 14.00$ LF Culvert, CPE Triple Wall, 8" D-52 16.00$ LF Culvert, CPE Triple Wall, 12" D-53 24.00$ LF Culvert, CPE Triple Wall, 15" D-54 35.00$ LF Culvert, CPE Triple Wall, 18" D-55 41.00$ LF Culvert, CPE Triple Wall, 24" D-56 56.00$ LF Culvert, CPE Triple Wall, 30" D-57 78.00$ LF Culvert, CPE Triple Wall, 36" D-58 130.00$ LF Culvert, LCPE, 6"D-59 60.00$ LF Culvert, LCPE, 8"D-60 72.00$ LF Culvert, LCPE, 12"D-61 84.00$ LF Culvert, LCPE, 15"D-62 96.00$ LF Culvert, LCPE, 18"D-63 108.00$ LF Culvert, LCPE, 24"D-64 120.00$ LF Culvert, LCPE, 30"D-65 132.00$ LF Culvert, LCPE, 36"D-66 144.00$ LF Culvert, LCPE, 48"D-67 156.00$ LF Culvert, LCPE, 54"D-68 168.00$ LF SUBTOTAL THIS PAGE:346,320.00 (B)(C)(D)(E) Page 2 of 5 Ref 8-H Bond Quantity Worksheet SECTION II.c DRAINAGE Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR DRAINAGE AND STORMWATER FACILITIES Quantity Remaining (Bond Reduction) (B)(C) Specialty Drainage Items Ditching SD-1 9.50$ CY Flow Dispersal Trench (1,436 base+)SD-3 28.00$ LF 50 2,836.00 French Drain (3' depth)SD-4 26.00$ LF Geotextile, laid in trench, polypropylene SD-5 3.00$ SY 485 1,455.00 Mid-tank Access Riser, 48" dia, 6' deep SD-6 2,000.00$ Each 5 10,000.00 Pond Overflow Spillway SD-7 16.00$ SY Restrictor/Oil Separator, 12"SD-8 1,150.00$ Each Restrictor/Oil Separator, 15"SD-9 1,350.00$ Each Restrictor/Oil Separator, 18"SD-10 1,700.00$ Each 1 1,700.00 Riprap, placed SD-11 42.00$ CY Tank End Reducer (36" diameter)SD-12 1,200.00$ Each 4 4,800.00 Infiltration pond testing SD-13 125.00$ HR Permeable Pavement SD-14 Permeable Concrete Sidewalk SD-15 Culvert, Box __ ft x __ ft SD-16 SUBTOTAL SPECIALTY DRAINAGE ITEMS:20,791.00 (B)(C)(D)(E) STORMWATER FACILITIES (Include Flow Control and Water Quality Facility Summary Sheet and Sketch) Detention Pond SF-1 Each Detention Tank SF-2 Each Detention Vault SF-3 Each Infiltration Pond SF-4 Each Infiltration Tank SF-5 Each Infiltration Vault SF-6 Each Infiltration Trenches SF-7 Each Basic Biofiltration Swale SF-8 Each 635 Wet Biofiltration Swale SF-9 Each Wetpond SF-10 Each Wetvault SF-11 Each Sand Filter SF-12 Each Sand Filter Vault SF-13 Each Linear Sand Filter SF-14 Each Proprietary Facility AquaFilter SF-15 Each Bioretention Facility SF-16 Each SUBTOTAL STORMWATER FACILITIES: (B)(C)(D)(E) Page 4 of 5 Ref 8-H Bond Quantity Worksheet SECTION II.c DRAINAGE Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR DRAINAGE AND STORMWATER FACILITIES Quantity Remaining (Bond Reduction) (B)(C) WRITE-IN-ITEMS (INCLUDE ON-SITE BMPs) WI-1 WI-2 WI-3 WI-4 WI-5 WI-6 WI-7 WI-8 WI-9 WI-10 WI-11 WI-12 WI-13 WI-14 WI-15 SUBTOTAL WRITE-IN ITEMS: DRAINAGE AND STORMWATER FACILITIES SUBTOTAL:404,339.00 SALES TAX @ 10%40,433.90 DRAINAGE AND STORMWATER FACILITIES TOTAL:444,772.90 (B)(C)(D)(E) Compost Amended Biofiltration Swale for water quality only Page 5 of 5 Ref 8-H Bond Quantity Worksheet SECTION II.c DRAINAGE Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 CED Permit #:######## Existing Future Public Private Right-of-Way Improvements Improvements (D) (E) Description No. Unit Price Unit Quant.Cost Quant.Cost Quant.Cost Quant.Cost Connection to Existing Watermain W-1 2,000.00$ Each 2 4,000.00 Ductile Iron Watermain, CL 52, 4 Inch Diameter W-2 50.00$ LF Ductile Iron Watermain, CL 52, 6 Inch Diameter W-3 56.00$ LF 285 15,960.00 Ductile Iron Watermain, CL 52, 8 Inch Diameter W-4 60.00$ LF 35 2,100.00 Ductile Iron Watermain, CL 52, 10 Inch Diameter W-5 70.00$ LF Ductile Iron Watermain, CL 52, 12 Inch Diameter W-6 80.00$ LF Gate Valve, 4 inch Diameter W-7 500.00$ Each Gate Valve, 6 inch Diameter W-8 700.00$ Each 3 2,100.00 Gate Valve, 8 Inch Diameter W-9 800.00$ Each 6 4,800.00 Gate Valve, 10 Inch Diameter W-10 1,000.00$ Each Gate Valve, 12 Inch Diameter W-11 1,200.00$ Each Fire Hydrant Assembly W-12 4,000.00$ Each 2 8,000.00 Permanent Blow-Off Assembly W-13 1,800.00$ Each Air-Vac Assembly, 2-Inch Diameter W-14 2,000.00$ Each Air-Vac Assembly, 1-Inch Diameter W-15 1,500.00$ Each Compound Meter Assembly 3-inch Diameter W-16 8,000.00$ Each Compound Meter Assembly 4-inch Diameter W-17 9,000.00$ Each Compound Meter Assembly 6-inch Diameter W-18 10,000.00$ Each Pressure Reducing Valve Station 8-inch to 10-inch W-19 20,000.00$ Each WATER SUBTOTAL:36,960.00 SALES TAX @ 10%3,696.00 WATER TOTAL:40,656.00 (B)(C)(D)(E) SITE IMPROVEMENT BOND QUANTITY WORKSHEET FOR WATER Quantity Remaining (Bond Reduction) (B)(C) Page 1 of 1 Ref 8-H Bond Quantity Worksheet SECTION II.d WATER Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 Planning Division |1055 South Grady Way – 6 th Floor | Renton, WA 98057 (425) 430-7200 Date: Name:Project Name: PE Registration No:CED Plan # (LUA): Firm Name:CED Permit # (U): Firm Address:Site Address: Phone No.Parcel #(s): Email Address:Project Phase: Site Restoration/Erosion Sediment Control Subtotal (a) Existing Right-of-Way Improvements Subtotal (b)(b)34,917.85$ Future Public Improvements Subtotal (c)-$ Stormwater & Drainage Facilities (Public & Private) Subtotal (d)(d)444,772.90$ (e) (f) Site Restoration Civil Construction Permit Maintenance Bond 95,938.15$ Bond Reduction 2 Construction Permit Bond Amount 3 Minimum Bond Amount is $10,000.00 1 Estimate Only - May involve multiple and variable components, which will be established on an individual basis by Development Engineering. 2 The City of Renton allows one request only for bond reduction prior to the maintenance period. Reduction of not more than 70% of the original bond amount, provided that the remaining 30% will cover all remaining items to be constructed. 3 Required Bond Amounts are subject to review and modification by Development Engineering. * Note: The word BOND as used in this document means any financial guarantee acceptable to the City of Renton. ** Note: All prices include labor, equipment, materials, overhead and profit. T (P +R - S) -$ 505,115.33$ P (a) x 100% S (e) x 150% + (f) x 100% R ((b x 150%) + (d x 100%)) Site Address 3811 NE 21st Street Firm Name Abossein Engineering Bond Reduction: Existing Right-of-Way Improvements (Quantity Remaining)2 Bond Reduction: Stormwater & Drainage Facilities (Quantity Remaining)2 Parcel Number 0423059237, 068 and 307 FOR APPROVAL ######## Firm Address 18465 NE 68th Street, Redmond, WA CONSTRUCTION BOND AMOUNT */** (prior to permit issuance) Phone No. 425-462-9441 Email Address shawn_pourazari@abossein.com SITE IMPROVEMENT BOND QUANTITY WORKSHEET BOND CALCULATIONS Date 03/02/2020 Shahram (Shawn) Pourazari, PE PE Registration No. 39659 Prepared by:Project Information Project Name FUPC Sancuary Addition 18-000253 EST1 ((b) + (c) + (d)) x 20% -$ MAINTENANCE BOND */** (after final acceptance of construction) 7,965.65$ 34,917.85$ 497,149.68$ 7,965.65$ -$ 444,772.90$ Page 1 of 1 Ref 8-H Bond Quantity Worksheet SECTION III. BOND WORKSHEET Unit Prices Updated: 06/14/2016 Version: 04/26/2017 Printed 3/4/2020 ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment F Maintenance Requirements ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment G Flow Control and Water Quality Summary Sheet and Sketch ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment I /CABS Detail Sheet Bioretention ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment J Blank ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment K Drainage Control Plan ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment L Main Outflow Pipe System ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment Detention Pipe System Profiles M ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment Grading and Spot Elevations N ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment Composite Utilities Plan O ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment P Detention Piped System #1-4, Outlet flows fromDetention Facilities TOTAL 100 YEAR FLOW COMPUTATION 100-YEAR BASIN #1 = 0.012448 CFS 100-YEAR BASIN #2 = 0.006561 CFS 100-YEAR BASIN #3 = 0.008621 CFS 100-YEAR BASIN #4 = 0.009609 CFS TOTAL = 0.04 CFS ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment Q Study Area Map ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment R Declaration Of Covenant Page 1 of ___ Return Address: City Clerk’s Office City of Renton 1055 S Grady Way Renton, WA 98057 DECLARATION OF COVENANT FOR INSPECTION AND MAINTENANCE OF DRAINAGE FACILITIES AND ON-SITE BMPS Grantor: Grantee: City of Renton, a Washington municipal corporation Legal Description: Assessor's Tax Parcel ID#: IN CONSIDERATION of the approved City of Renton (check one of the following) Residential Building Permit Commercial Building Permit Clearing and Grading Permit Civil Construction or Utility Permit for Permit(s)_____________________ (Construction/Building/Utility Permit #) relating to the real property ("Property") described above, the Grantor(s), the owner(s) in fee of that Property, hereby covenants (covenant) with the City of Renton (“City of Renton” or “City”), a municipal corporation of the state of Washington, that he/she (they) will observe, consent to, and abide by the conditions and obligations set forth and described in Paragraphs 1 through 9 below with regard to the Property, and hereby grants (grant) an easement as described in Paragraphs 2 and 3. Grantor(s) hereby grants (grant), covenants (covenant), and agrees (agree) as follows: 1.The Grantor(s) or his/her (their) successors in interest and assigns ("Owners ") shall at their own cost, operate, maintain, and keep in good repair, the Property's drainage facilities constructed as required in the approved construction plans and specifications __________________ (Project Plan #) on file with the City of Renton and submitted to the City of Renton for the review and approval of permit(s) _____________________________ (Construction/Building/Utility Permit #). The Property's drainage facilities are shown and/or listed on Exhibit A – Site Plan. The Property’s drainage facilities shall be maintained in compliance with the operation and maintenance schedule included and attached herein as Exhibit B – Operations and Maintenance. Drainage facilities include pipes, channels, flow control facilities, water quality facilities, on-site best management practices (BMPs) and other engineered structures designed to manage and/or First Ukrainian Pentecostal Church Revised Legal Descriptions, Lot 1: The east half of the east half of the northeast quarter of the southeast quarter S4, T23N, R5E (See Exh "C" Legal Descriptions) 423059237 and 0423059307 C19004330 C19004330 12 4 4 Page 2 of ___ treat stormwater on the Property. On-site BMPs include dispersion and infiltration devices, bioretention, permeable pavements, rainwater harvesting systems, tree retention credit, reduced impervious surface footprint, vegetated roofs and other measures designed to mimic pre-developed hydrology and minimize stormwater runoff on the Property. 2.City of Renton shall have the right to ingress and egress over those portions of the Property necessary to perform inspections of the stormwater facilities and BMPs and conduct maintenance activities specified in this Declaration of Covenant and in accordance with the Renton Municipal Code. City of Renton shall provide at least thirty (30) days’ written notice to the Owners that entry on the Property is planned for the inspection of drainage facilities. After the thirty (30) days, the Owners shall allow the City of Renton to enter for the sole purpose of inspecting drainage facilities. In lieu of inspection by the City, the Owners may elect to engage a licensed civil engineer registered in the state of Washington who has expertise in drainage to inspect the drainage facilities and provide a written report describing their condition. If the engineer option is chosen, the Owners shall provide written notice to the City of Renton within fifteen (15) days of receiving the City’s notice of inspection. Within thirty (30) days of giving this notice, the Owners, or engineer on behalf of the Owners, shall provide the engineer’s report to the City of Renton. If the report is not provided in a timely manner as specified above, the City of Renton may inspect the drainage facilities without further notice. 3.If City of Renton determines from its inspection, or from an engineer’s report provided in accordance with Paragraph 2, that maintenance, repair, restoration, and/or mitigation work is required to be done to any of the drainage facilities, City of Renton shall notify the Owners of the specific maintenance, repair, restoration, and/or mitigation work (“Work”) required pursuant to the Renton Municipal Code. The City shall also set a reasonable deadline for the Owners to complete the Work, or to provide an engineer’s report that verifies completion of the Work. After the deadline has passed, the Owners shall allow the City access to re-inspect the drainage facilities unless an engineer’s report has been provided verifying completion of the Work. If the Work is not completed within the time frame set by the City, the City may initiate an enforcement action and/or perform the Work and hereby is given access to the Property for such purposes. Written notice will be sent to the Owners stating the City’s intention to perform such Work. This Work will not commence until at least seven (7) days after such notice is mailed. If, within the sole discretion of the City, there exists an imminent or present danger, the seven (7) day notice period will be waived and Work will begin immediately. 4.The Owners shall assume all responsibility for the cost of any Work, or any measures taken by the City to address conditions as described in Paragraph 3. Such responsibility shall include reimbursement to the City within thirty (30) days of the receipt of the invoice for any such Work performed. Overdue payments will require payment of interest at the maximum legal rate allowed by RCW 19.52.020 (currently twelve percent (12%)). If the City initiates legal action to enforce this agreement, the prevailing party in such action is entitled to recover reasonable litigation costs and attorney’s fees. 5.The Owners are required to obtain written approval from City of Renton prior to filling, piping, cutting, or removing vegetation (except in routine landscape maintenance) in open vegetated stormwater facilities (such as swales, channels, ditches, ponds, etc.), or performing any alterations or modifications to the drainage facilities referenced in this Declaration of Covenant. 12 Page 3 of ___ 6.Any notice or consent required to be given or otherwise provided for by the provisions of this Agreement shall be effective upon personal delivery, or three (3) days after mailing by Certified Mail, return receipt requested. 7.With regard to the matters addressed herein, this agreement constitutes the entire agreement between the parties, and supersedes all prior discussions, negotiations, and all agreements whatsoever whether oral or written. 8.This Declaration of Covenant is intended to protect the value and desirability and promote efficient and effective management of surface water drainage of the real property described above, and shall inure to the benefit of all the citizens of the City of Renton and its successors and assigns. This Declaration of Covenant shall run with the land and be binding upon Grantor(s), and Grantor's(s') successors in interest, and assigns. 9.This Declaration of Covenant may be terminated by execution of a written agreement by the Owners and the City that is recorded by King County in its real property records. IN WITNESS WHEREOF, this Declaration of Covenant for the Inspection and Maintenance of Drainage Facilities is executed this _____ day of ____________________, 20_____. GRANTOR, owner of the Property GRANTOR, owner of the Property STATE OF WASHINGTON ) COUNTY OF KING )ss. On this day personally appeared before me: , to me known to be the individual(s) described in and who executed the within and foregoing instrument and acknowledged that they signed the same as their free and voluntary act and deed, for the uses and purposes therein stated. Given under my hand and official seal this _____ day of ___________________, 20_____. Printed name Notary Public in and for the State of Washington, residing at My appointment expires 12 4 OF 124 OF 12 EXHIBIT B 5 OF 12 5 OF 12 6 OF 12 7 OF 127 OF 12 EXHIBIT B 8 OF 12 8 OF 12 Form Revised 12/12/06 RECORDING REQUESTED BY AND WHEN RECORDED MAIL TO: DECLARATION OF COVENANT PROHIBITING USE OF LEACHABLE METALS Grantor: First Pentecostal Church _ Grantee: City of Renton Legal Description: _________________________________________________________________________________ _________________________________________________________________________________ Additional Legal(s) on: Assessor's Tax Parcel ID#: 0420059237 and 0423059307 and 04203059068 IN CONSIDERATION of the approved City of Renton ________________________ permit for application file No. C19004330 relating to real property legally described above, the undersigned as Grantor(s), declares(declare) that the above described property is hereby established as having a prohibition on the use of leachable metals on those portions of the property exposed to the weather for the purpose of limiting metals in stormwater flows and is subject to the following restrictions. The Grantor(s) hereby covenants(covenant) and agrees(agree) as follows: no leachable metal surfaces exposed to the weather will be allowed on the property. Leachable metal surfaces means a surface area that consists of or is coated with a non-ferrous metal that is soluble in water. Common leachable metal surfaces include, but are not limited to, galvanized steel roofing, gutters, flashing, ( SEE EXHIBIT "C" FOR LEGAL DESCRIPTION) 9 OF 12 Revised Legal Descriptions, Lot 1: The east half of the east half of the northeast quarter of the southeast quarter S4, T23N, R5E WILLAMETTE MERIDIAN, IN KING COUNTY, WA; EXCEPT THE SOUTH 15 FEET THEREOF ALSO EXCEPT THAT PORTION DEEDED TO THE CITY OF RENTON 9 OF 12 Form Revised 12/12/06 downspouts, guardrails, light posts, and copper roofing. City of Renton or its municipal successors shall have a nonexclusive perpetual access easement on the Property in order to ingress and egress over the Property for the sole purposes of inspecting and monitoring that no leachable metal is present on the Property. This easement/restriction is binding upon the Grantor(s), its heirs, successors, and assigns unless or until a new drainage or site plan is reviewed and approved by the City of Renton or its successor. 10 OF 12 10 OF 12 Form Revised 12/12/06 IN WITNESS WHEREOF, this Declaration of Covenant is executed this _____ day of ____________________, 20_____. GRANTOR, owner of the Property GRANTOR, owner of the Property STATE OF WASHINGTON ) COUNTY OF KING )ss. On this day personally appeared before me: _____________________________________________, to me known to be the individual(s) described in and who executed the within and foregoing instrument and acknowledged that they signed the same as their free and voluntary act and deed, for the uses and purposes therein stated. Given under my hand and official seal this _____ day of ____________________, 20_____. Printed name Notary Public in and for the State of Washington, residing at My appointment expires 11 OF 12 11 OF 12 12 OF 1212 OF 12 ©2018 Abossein Engineering Technical Information Report First Ukrainian Pentecostal Church Renton, Washington Attachment S Water Quality Design Analysis & Calculations ATTACHMENT T ADDED PARKING AREA EXHIBIT