The URL can be used to link to this page

Home My WebLink AboutFinal Agenda Packet CITY OF RENTON AGENDA - City Council Regular Meeting 7:00 PM - Monday, December 14, 2020 Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way Due to the COVID-19 pandemic, Councilmembers are attending this meeting remotely through Zoom. Audience comments will be accommodated through Zoom, but the public is requested to sign up for such testimony by calling 425-430-6501 or emailing cityclerk@rentonwa.gov or jmedzegian@rentonwa.gov by 10 a.m. on the day of the meeting. The public may also submit comments in writing to cityclerk@rentonwa.gov by 5 p.m. on the day of the meeting. For those wishing to attend by Zoom, please (1) click this link: https://us02web.zoom.us/j/87006639675 (or copy the URL and paste into a web browser) or (2) call-in to the Zoom meeting by dialing 253-215-8782 and entering 870 0663 9675, or (3) call 425-430-6501 by 10 a.m. on the day of the meeting to request an invite with a link to the meeting. Those providing audience comments will be limited to 5 minutes each speaker unless an exception is granted by the Council. Attendees will be muted and not audible to the Council except during times they are designated to speak. Advance instructions for how to address the Council will be provided to those who sign up in advance to speak and again during the meeting. 1. CALL TO ORDER 2. ROLL CALL 3. ADMINISTRATIVE REPORT 4. AUDIENCE COMMENTS NOTICE to all participants: Pursuant to state law, RCW 42.17A.555, campaigning for any ballot measure or candidate in City Hall and/or during any portion of the council meeting, including the audience comment portion of the meeting, is PROHIBITED. 5. CONSENT AGENDA The following items are distributed to Councilmembers in advance for study and review, and the recommended actions will be accepted in a single motion. Any item may be removed for further discussion if requested by a Councilmember. a) Approval of Council Meeting minutes of December 7, 2020. Council Concur b) AB - 2776 Mayor Pavone appoints the following individuals to the Renton Airport Advisory Committee: Jeanne DeMund to the Kennydale Neighborhood primary position (moving Ms. DeMund from the Kennydale Neighborhood alternate position) for a term expiring May 7, 2024; and appoints Marcie Palmer to the Kennydale Neighborhood alternate position for an unexpired term expiring on May 7, 2023. Refer to Transportation (Aviation) Committee c) AB - 2778 Community & Economic Development Department recommends approval of the 2021 Lodging Tax Fund allocations in the total amount of $421,500. Council Concur d) AB - 2777 Community Services Department recommends approval of Amendment 1 to CAG-20-101 with McKinstry Essention, in the amount of $2,407,491 for the Renton City Hall - Phase 2 Improvements project. Refer to Finance Committee e) AB - 2775 Public Works Transportation Systems Division requests approval to execute three agreements (when final), with the The Boeing Company: 1) Permanent Easement Agreement in the amount of $640,000; 2) Temporary Construction Easement in the amount of $188,546.95; and 3) The Boeing Compensation Agreement for Park Avenue North Extension in the amount of $1,355,481, with the total compensation to The Boeing Company for the Park Avenue North Extension project set at $2,184,027.95. Refer to Committee of the Whole f) AB - 2774 Public Works Transportation Systems Division submits CAG-14-151, SW Grady Way Overlay project, with Lakeside Industries, Inc., and request acceptance of the project and release of the contract bond after 60 days, once all State approvals are received. Council Concur 6. UNFINISHED BUSINESS Topics listed below were discussed in Council committees during the past week. Those topics marked with an asterisk (*) may include legislation. Committee reports on any topics may be held by the Chair if further review is necessary. a) Finance Committee: Vouchers, Bad Debt Write-off, Lobbyist Contract - Levy, Cedar River Trail Relocation b) Transportation Committee: BHC Lease Amendment, Airport c) Utilities Committee: Green Stormwater Contract Amendment - Osborn, Monroe Av Improvement Contract Amendment - Otak 7. LEGISLATION Ordinances for second and final reading: a) Ordinance No. 5996: Emergency Ordinance Interim Zoning Controls - Homeless Shelters. (NOTE: Proposed Ordinance 5996 attached to the 12/14/2020 Agenda Packet has been revised since first reading occurred on 12/7/2014) b) Ordinance No. 5998: #D-176 Self-Service Storage in Commercial Zones (Docket 15, Group B) (First Reading 12/7/2020) c) Ordinance No. 5999: #D-178 Standalone Solar Structures (Docket 15, Group B) (First Reading 12/7/2020) d) Ordinance No. 6000: #D-179 CD Zone Changes (Docket 15, Group B) (First Reading 12/7/2020) e) Ordinance No. 6001: #D-180 Vesting Regulations (Docket 15, Group B) (First Reading 12/7/2020) f) Ordinance No. 6002: #D-181 Accessory Dwelling Unit (Docket 15, Group B) (First Reading 12/7/2020) g) Ordinance No. 6003: #D-182 SEPA Appeal Process (Docket 15, Group B) (First Reading 12/7/2020) h) Ordinance No. 6004: #D-183 Other Government Uses (Docket 15, Group B) (First Reading 12/7/2020) i) Ordinance No. 6005: 2020 Comprehensive Plan Amendments (First Reading 12/7/2020) j) Ordinance No. 6006: 19-M-01 900 Lind Ave Rezone (First Reading 12/7/2020) k) Ordinance No. 6007: 19-M-02 Zoning and Land Use Reconciliation (First Reading 12/7/2020) l) Ordinance No. 6008: 19-M-03 Benson, Upland Group Rezone (First Reading 12/7/2020) m) Ordinance No. 6009: 1300 Bronson Way Street Vacation (VAC-20-001) (First Reading 12/7/2020) 8. NEW BUSINESS (Includes Council Committee agenda topics; visit rentonwa.gov/cityclerk for more information.) 9. ADJOURNMENT COMMITTEE OF THE WHOLE MEETING AGENDA (Preceding Council Meeting) 6:00 p.m. - 7th Floor - MEETING REMOTELY Hearing assistance devices for use in the Council Chambers are available upon request to the City Clerk CITY COUNCIL MEETINGS ARE TELEVISED LIVE ON GOVERNMENT ACCESS CHANNEL 21 To view Council Meetings online, please visit rentonwa.gov/councilmeetings December 7, 2020 REGULAR COUNCIL MEETING MINUTES CITY OF RENTON MINUTES ‐ City Council Regular Meeting 7:00 PM ‐ Monday, December 7, 2020 Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way CALL TO ORDER Mayor Pavone called the meeting of the Renton City Council to order at 7:00 PM. ROLL CALL Councilmembers Present: Ruth Pérez, Council President Randy Corman, Council Position No. 1 Angelina Benedetti, Council Position No. 2 Valerie O'Halloran, Council Position No. 3 Ryan McIrvin, Council Position No. 4 Ed Prince, Council Position No. 5 Kim‐Khánh Vǎn, Council Position No. 7 (All councilmembers attended remotely) Councilmembers Absent: ADMINISTRATIVE STAFF PRESENT Armondo Pavone, Mayor Ed VanValey, Interim Chief Administrative Officer Shane Moloney, City Attorney Jason Seth, City Clerk Julia Medzegian, Council Liaison Kristi Rowland, Organizational Development Manager Chip Vincent, Community & Economic Development Administrator Martin Pastucha, Public Works Administrator Jan Hawn, Administrative Services Administrator Ellen Bradley‐Mak, Human Resources and Risk Management Administrator Kelly Beymer, Community Services Administrator Kari Roller, Fiscal Services Director Vanessa Dolbee, Planning Director Ron Straka, Public Works Utilities Systems Director Melissa Day, Administrative Assistant – Police Department AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES Commander Dan Figaro, Police Department (All City staff attended remotely except City Clerk Seth) PROCLAMATION a) Mental Health Awareness Month: A proclamation by Mayor Pavone was read declaring December 2020 to be Mental Health Awareness Month in the City of Renton, encouraging all members of the community to fight the stigma of and provide support for mental illness. Pastor Kacey Hahn accepted the proclamation with appreciation. MOVED BY VǍN, SECONDED BY PRINCE, COUNCIL CONCUR IN THE PROCLAMATION. CARRIED. PUBLIC HEARING a) Emergency ORD – Interim Zoning Controls: This being the date set and proper notices having been posted and published in accordance with local and State laws, Mayor Pavone opened the public hearing to consider an Emergency Ordinance for amending and extending Interim Zoning Controls for Economic Recovery related to revocable permits and signs. Assistant Planner Brittany Gillia reported that Emergency Ordinance 5974 was adopted on July 13, 2020 and explained that the ordinance established an interim zoning control to temporarily allow “Economic Recovery Right‐of‐Way Use Permits” and “Economic Recovery signs” until December 31, 2020 or when King County enters Phase 4 of the Governor’s Safe Start Plan. She reported that:  Interim zoning controls are proposed to be extended until June 7, 2021 or until King County enters Phase 4 of the Governor's Safe Start Plan, whichever occurs first;  "Economic Recovery Right‐of‐Way Use Permits" issued as part of Ordinance No. 5974 and remain valid through December 7, 2020 are proposed to be extended to coincide with the new expiration period;  Additionally, a new statement that parklets that are "pre‐fabricated and engineered" as well as parklets without structural components are within the scope of Economic Recovery Revocable Right‐of‐Way permits;  Required Temporary Use Permits for businesses wishing to temporarily expand into an adjacent tenant space are proposed to be waived;  A limited number of short‐term parking stalls are proposed to be established for curbside pick‐up to go orders within the Center Downtown (CD) zone;  City Center Parking Garage fees are proposed to be waived for parking periods up to ten (10) hours Continuing, Ms. Gillia reported:  The ongoing presence of COVID‐19 is affecting businesses;  There is a continued need for economic recovery mitigation measures to assist businesses;  The City is encouraging parklets and pre‐fabricated outdoor spaces as an approach to furthering economic recovery; AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES  Increasing the number of parking stalls within the CD zone may assist struggling businesses;  Any business within City limits may apply for an "Economic Recovery Right‐of‐ Way Use Permit" Concluding, Ms. Gillia displayed several photographs depicting pre‐fabricated and non‐ structural examples of parklets, and recommended that Council adopt the ordinance extending and amending economic recovery permits and signs. Mayor Pavone invited public testimony:  Jon Glenn, Renton, speaking on behalf of the Renton Downtown Partnership, urged Council to adopt the ordinance. He also invited Council to the "Shout Out to Santa" event occurring December 12, 19, and 20 at 4 p.m. in the Cugini parking lot. There being no further comments or discussion, it was MOVED BY CORMAN, SECONDED BY O'HALLORAN, COUNCIL CLOSE THE PUBLIC HEARING. CARRIED. ADMINISTRATIVE REPORT City Clerk Jason Seth reviewed a written administrative report summarizing the City’s recent progress towards goals and work programs adopted as part of its business plan for 2020 and beyond. Items noted were:  The Renton Airport Advisory Committee accepts applications on an ongoing basis for all membership positions. The Committee currently has vacancies for positions representing the following neighborhoods: • Benson Hill (primary position) • Benson Hill (alternate position) • West Hill (alternate position) • South Renton (alternate position) • Highlands (alternate position) For questions, please call 425‐430‐7394 or email us at rentonairport@rentonwa.gov. If interested, please visit our website at http://rentonwa.gov/bcc to apply online or download a PDF version of the application.  The Public Works Department would like to remind residents to help us prevent local residential street flooding by monitoring catch basins near your home and keeping them clear of leaves and other debris. Street sweepers are dispatched daily to clean up debris along major arterials.  Cold weather is on the way. The Public Works Department will be applying deicer to major arterials as needed. Snow is not far away. During snow events, it is imperative that motorists do not park or abandon their vehicles within any portion of the traffic lanes. Abandoned vehicles impair snow and ice removal, impact response of emergency vehicles, and may be towed. Please remember that during snow and ice events the department sanders and snowplows are dispatched to keep major arterials AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES drivable. Visit our website at www.rentonwa.gov/snowroutes to view our deicing and snow route maps.  Preventative street maintenance will continue to impact traffic and result in occasional street closures. AUDIENCE COMMENTS  Dr. Nancy Connelly, Seattle, stated she works at the Red Lion Inn and urged Council to not pass Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Dr. Russell Berg, Seattle, spoke in favor of the Red Lion Inn and urged Council not to pass Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Michael and Zach Wildman, Renton, stated they feel unsafe in their neighborhood which is blocks away from the Red Lion Inn, and urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  April Berry, Renton, stated that she is a current resident at the Red Lion Inn and shared a story of how staying there has helped her. She urged Council not to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Gabriella Duncan, Renton, shared her experiences as a homelessness advocate and documentarian, and urged Council not to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Melody Kroeger, Renton, remarked that the owner of the Red Lion Inn is receiving $370,000 per month to house homeless individuals and questioned whether operating the hotel as a shelter was to generate revenue or help the community. She urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Marvin Rosete, Renton, remarked that he is a human services professional and supports the notion of limiting the number of individuals at a shelter. He urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Diane Dobson, Renton, speaking on behalf of the Renton Chamber of Commerce, spoke about the impacts the shelter at the Red Lion Inn has had on local businesses. She urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Nicole Macri, unknown, speaking on behalf of Downtown Emergency Services Center (DESC), remarked that the City should be working with King County and DESC on this issue. She urged Council to not adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Carolyn Draper, Renton, spoke in opposition of the Red Lion Inn and urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Winter Cashman, Renton, spoke in opposition to Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters. They also spoke in opposition of appointing current employees to new positions without recruiting for the positions.  Justin Jensen, Renton, expressed appreciation to Council for adopting the Mental Health Awareness Month proclamation. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES  Joshua Janet, Renton, stated he is a Housing and Community Development professional and urged Council to not adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Gabrielle Weidling, Renton, remarked that she feels safe living near the Red Lion Inn and urged Council to not adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Dave McCammon, Renton, spoke in favor of Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Nancy Quinn, Renton, spoke in favor of Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Dave Tilton, Renton, stated that he resents the attitude that Renton residents do not have compassion for the homeless, but noted that Seattle's bad policy should not be left for Renton to fix. He urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Marcie Palmer, Renton, thanked Council and the Administration for their hard work, and urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Max and Jeremy Heller, Renton, spoke in opposition to the continuation of the Red Lion Inn operating as a homeless shelter. They urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  James Alberson, Renton, noted that the Red Lion Inn was supposed to be temporary and King County appears to be attempting to make it a permanent facility. He urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Don Persson, Renton, noted that Renton has been a leader in affordable housing and assisting the homeless, citing the collaboration with the Renton Housing Authority and the Center of Hope Women's Day Shelter located in City Hall as examples. He urged Council to adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters. He also noted that this ordinance will give staff additional time to craft a permanent ordinance.  April Berry, Renton, spoke again about being fortunate to live in the Red Lion Inn. She urged Council to not adopt Emergency Ordinance No. 5996 ‐ Interim Zoning Controls ‐ Homeless Shelters.  Rev. Dr. Linda Smith, Renton, thanked Council for allowing everyone to speak on this issue. She emphasized the importance of thinking about all people, residents of Renton and residents of the Red Lion Inn, during this difficult time. CONSENT AGENDA Items listed on the Consent Agenda were adopted with one motion, following the listing. a) Approval of Council Meeting minutes of November 23, 2020. Council Concur. b) AB ‐ 2772 Administrative Services Department requested approval to write‐off bad debt in the total amount of $36,222.87 per Policy & Procedure 220‐03. Refer to Finance Committee. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES c) AB ‐ 2771 Community & Economic Development Department recommended adoption of an ordinance to amend and extend emergency Ordinance No. 5974 for six (6) additional months to advance economic recovery for businesses in Renton by providing updates to the no‐fee Economic Recovery Revocable Right‐of‐Way Permit, waiving land use requirements for temporary business expansions in adjacent vacant storefronts, establishing short‐term curbside pick‐up stalls in the Center Downtown zone, and waiving fees in the Downtown Parking Garage for up to ten (10) hours until Phase 4 of the Safe Start Plan, or June 7, 2021, whichever occurs first. Council Concur. d) AB ‐ 2766 Community & Economic Development Department recommended further consideration and first reading of an emergency ordinance adopting interim zoning controls to amend Renton Municipal Code regarding "homeless services uses" (including "COVID‐19 deintensification shelters") and related code amendments; and to schedule second reading of the ordinance with any additional requested changes for December 14, 2020. Council Concur. e) AB ‐ 2770 Community Services Department recommended approval of the Agreement for Design, Permitting and Construction Support for Cedar River Trail Relocation and Cedar River Bank Stabilization Project, with GeoEngineers, Inc., in the amount of $375,638. This project is eligible for reimbursement from FEMA, reducing the City's actual cost to approximately $45,077. Refer to Finance Committee. f) AB ‐ 2773 Executive Department recommended approval of a Professional Services contract with Outcomes by Levy, LLC, in the amount of $166,000 per year for lobbying services for 2021 and 2022. Refer to Finance Committee. g) AB ‐ 2768 Public Works Administration recommended approval of Amendment No. 06‐20 to LAG‐93‐004, lease with BHC, Inc., extending the lease to December 31, 2024 and increasing annual lease revenue to $33,998.62 due to a CPI adjustment, for 48,777.51 square foot parcel at the Renton Municipal Airport. Refer to Transportation (Aviation) Committee. h) AB ‐ 2769 Public Works Utility Systems Division recommended approval of Amendment No. 2 to CAG‐19‐313, with Otak, Inc, in the amount of $558,917 for phase two design services for the Monroe Ave NE Storm Improvement project. Refer to Utilities Committee. i) AB ‐ 2759 Public Works Utility Systems Division recommended approval of Amendment No. 1 to CAG‐19‐139, with Osborn Consulting, Inc., in the amount of $128,582 for additional design services for the SE 172nd St and 125th Ave SE Green Stormwater Infrastructure project. Refer to Utilities Committee. MOVED BY PÉREZ, SECONDED BY CORMAN, COUNCIL CONCUR TO APPROVE THE CONSENT AGENDA, AS PRESENTED. CARRIED. UNFINISHED BUSINESS a) Transportation Committee Chair McIrvin presented a report concurring in the staff recommendation to accept the 1300 Bronson Way N Street Vacation appraisal and to set compensation at $0. The Committee further recommended that the related ordinance be presented for first reading. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL CONCUR IN THE COMMITTEE RECOMMENDATION. CARRIED. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES b) Finance Committee Chair Prince presented a report concurring in the staff recommendation to approve the 2021 contract agreement with Davey Resource Group, Incorporated, in the amount of $134,400 for Consulting Certified Arborist Inspector services to assist with the Community Services Department ‐ Urban Forestry Program tree service requests. MOVED BY PRINCE, SECONDED BY VǍN, COUNCIL CONCUR IN THE COMMITTEE RECOMMENDATION. CARRIED. c) Finance Committee Chair Prince presented a report concurring in the staff recommendation to renew the City’s liability insurance coverage with Alliant Insurance Services, at a rate increase of 22.3% for an annual premium cost of $542,239.43, and authorize the Mayor and City Clerk to sign the implementing documents when ready. The liability insurance contract coverage includes excess insurance for liability and insurance coverage for the airport, law enforcement, unmanned aircraft (drones), and underground storage tanks (UST). Rates are secured though Alliant Insurance Services, a third party broker who was approved by Council in 2015. Factors determining premiums include market conditions, the City’s loss run history, levels of coverage and the City’s self‐insured retention. MOVED BY PRINCE, SECONDED BY VǍN, COUNCIL CONCUR IN THE COMMITTEE RECOMMENDATION. CARRIED. d) Committee on Committees Chair Corman presented a report recommending the following Council Committee assignments for 2021: Finance (2nd and 4th Mondays, 4:00 p.m.) Valerie O'Halloran, Chair Ed Prince, Vice Chair Ryan McIrvin, Member Public Safety (3rd Monday, 4:30 p.m.) Ruth Pérez, Chair Ryan McIrvin, Vice Chair Ed Prince, Member Community Services (1st Monday, 4:30 p.m.) Kim‐Khánh Vǎn, Chair Angelina Benedetti, Vice Chair Ruth Pérez, Member Utilities (1st and 3rd Mondays, 3:30 p.m.) Angelina Benedetti, Chair Valerie O'Halloran, Vice Chair Kim‐Khánh Vǎn, Member AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES Planning & Development (2nd and 4th Mondays, 5:00 p.m.) Ed Prince, Chair Ruth Pérez, Vice Chair Valorie O'Halloran, Member Transportation (1st and 3rd Mondays, 5:00 p.m.) Ryan McIrvin, Chair Kim‐Khánh Vǎn, Vice Chair Angelina Benedetti, Member MOVED BY CORMAN, SECONDED BY MCIRVIN, COUNCIL CONCUR IN THE COMMITTEE RECOMMENDATION. CARRIED. LEGISLATION Ordinances for first reading: a) Ordinance No. 5996: An ordinance was read adopting the following interim zoning controls in response to the Renton Red Lion COVID‐19 Deintensification Shelter operating in the City of Renton since April 2020: (1) clarifying and modifying principal, accessory, and unclassified use regulations by amending Subsections 4‐2‐050.A, 4‐2‐050.C.4, 4‐2‐050.C.5, AND 4‐2‐050.C.6 of the Renton Municipal Code; (2) clarifying and modifying certain land use definitions in the Renton Municipal Code by amending Subsection 4‐2‐060.K of the Renton Municipal Code, amending the definition of “Diversion Facility” and removing the definition of “Diversion Interim Service Facility” in Section 4‐11‐040 of the Renton Municipal Code, amending the definition of “hotel” and adding a definition of “hotel, extended‐stay” in Section 4‐11‐080 of the Renton Municipal Code, and amending the definition of “social service organizations” in Section 4‐11‐190 of the Renton Municipal Code; (3) allowing for one COVID‐19 deintensification shelter to temporarily operate in the Commercial Arterial (CA) zoning district by adding a definition of “COVID‐19 Deintensification Shelter” in Section 4‐11‐030 of the Renton Municipal Code and amending Subsections 4‐2‐060.G, 4‐2‐080.A.71, and 4‐2‐ 080.A.101 of the Renton Municipal Code; and (4) allowing for and regulating land uses serving those experiencing homelessness by adding a new Section 4‐4‐045, Homeless Services Use, to the Renton Municipal Code and adding a definition of “Homeless Services Use” to Section 4‐ 11‐080 of the Renton Municipal Code; making a legislative determination that the ordinance is exempt from full compliance with the State Environmental Policy Act (Chapter 43.21.C RCW); providing for severability; declaring an emergency; and establishing an immediate effective date. MOVED BY O'HALLORAN, SECONDED BY PÉREZ, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING.* MOVED BY VǍN, SECONDED BY MCIRVIN, COUNCIL STRIKE THE NUMBER 125 AND INSERT THE NUMBER 175 (PAGE 21, SECTION 101.A) AND STRIKE THE DATE JANUARY 1, 2022 AND INSERT THE DATE JUNE 1, 2022 (PAGE 21, SECTION 101.B) OF ORDINANCE NO. 5996.** AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES Council discussion ensued regarding the compassion Council, the Administration, and the community feels towards those suffering from homelessness, the necessity of changing dates in the ordinance when they may need to be changed again in the future, clarification on whether the motion to amend the main motion refers the issue to the Administration or whether the intent was to modify the ordinance on the floor, Renton residents’ taxing themselves in order to provide additional affordable housing options for the community, the ordinance being a starting point with more permanent legislation being drafted in the future, the desire of some Councilmembers to have a shelter located in Renton, concerns about safety issues at the Red Lion Inn, the need to begin sub‐regional homelessness planning, and clarifying that there that individuals housed at the Red Lion Inn will not have to leave immediately if the ordinance is adopted because the ordinance provides ample time for the County to re‐house the individuals elsewhere. **MOTION TO AMEND MAIN MOTION FAILED. AYES: Vǎn NOES: Pérez, Corman, O’Halloran, Benedetti, McIrvin, Prince. *MOTION TO REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING CARRIED. AYES: Pérez, Corman, O’Halloran, Benedetti, Prince NOES: Vǎn, McIrvin b) Ordinance No. 5998: An ordinance was read amending self‐storage standards in Subsections 4‐2‐060.M, 4‐2‐080.A.17, 4‐2‐080.A.22, and 4‐2‐080.A.59 of the Renton Municipal Code, providing for severability, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY PRINCE, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. c) Ordinance No. 5999: An ordinance was read adding regulations for standalone solar energy structures by amending Subsection 4‐2‐060.O of the Renton Municipal Code, amending Chapter 4‐4 of the Renton Municipal Code by adding a new Section 4‐4‐105 “Solar Energy Systems,” and adding new definitions of “Solar Energy System” and “Solar Energy System, Ground Mounted, Small Scale” to Section 4‐11‐190 of the Renton Municipal Code, providing for severability, and establishing an effective date. MOVED BY O'HALLORAN, SECONDED BY MCIRVIN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. d) Ordinance No. 6000: An ordinance was read updating regulations for the Center Downtown (CD) Zone by amending Subsections 4‐2‐060.L, 4‐2‐080.A.3, 4‐2‐080.A.6, and 4‐2‐120.B; and the definition of “Dwelling, Attached” in Section 4‐11‐040 of the Renton Municipal Code; providing for severability; and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES e) Ordinance No. 6001: An ordinance was read amending Section 4‐1‐045 of the Renton Municipal Code by renaming the section from “Vesting” to “Vesting Regulations,” eliminating Shoreline Development Permits and Conditional Use Permits from the list of applications that vest at complete application, clarifying duration of vesting, providing for severability, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. f) Ordinance No. 6002: An ordinance was read revising Accessory Dwelling Unit (ADU) regulations by amending Subsections 4‐2‐110.C, 4‐2‐110.E, and 4‐2‐116.B.2 of the Renton Municipal Code, providing for severability, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. g) Ordinance No. 6003: An ordinance was read amending Subsection 4‐9‐070.R of the Renton Municipal Code, relating to the State Environmental Policy Act (SEPA) appeals process, providing for severability, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. h) Ordinance No. 6004: An ordinance was read revising regulations relating to government facilities by amending Subsection 4‐2‐060.G of the Renton Municipal Code, amending the definition of “Government Facilities, Other” in Section 4‐11‐070 of the Renton Municipal Code, and adding new definitions of “Government Maintenance Facilities, Other” and “Government Office, Other” to Section 4‐11‐070 of the Renton Municipal Code, providing for severability, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY PRINCE, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. i) Ordinance No. 6005: An ordinance was read adopting the 2020 amendments to the City's 2015 Comprehensive Plan, maps, and data in conjunction therewith, and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. j) Ordinance No. 6006: An ordinance was read changing the zoning classification of one parcel (King County Parcel Number 1923059047) within the City of Renton from Industrial Medium (IM) to Commercial Arterial (CA) (CPA 2019‐M‐01) and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. k) Ordinance No. 6007: An ordinance was read changing the zoning classification of 14 parcels within the City of Renton and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES l) Ordinance No. 6008: An ordinance was read changing the zoning classification of twenty‐nine parcels bounded by SE Petrovitsky Road to the north, 118th Avenue SE to the East, SE 180th Street to the south, and 116th Avenue SE to the west within the City Of Renton from Residential Four (R‐4) to Residential Six (R‐6) (CPA 2019‐M‐03) and establishing an effective date. MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. m) Ordinance No. 6009: An ordinance was read vacating a portion of an alley, located near 1300 Bronson Way N and situated east of Garden Avenue N, west of Meadow Avenue N, north of Bronson Way N, and south of N 2nd Street (1300 Bronson Way N Street Vacation; VAC‐20‐ 001). MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL REFER THE ORDINANCE FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED. Ordinance for first and advancement to second and final reading: n) Ordinance No. 5997: An ordinance was read extending and amending the interim zoning control established by Ordinance No. 5974 in response to the operational limits on businesses during the COVID‐19 declared public health emergency by (1) extending the temporary “Economic Recovery Revocable Right‐of‐Way Permit” for businesses; (2) extending the temporary “Economic Recovery Signs” for businesses; and (3) amending the interim zoning control to waive the requirement to obtain a temporary use permit for the temporary expansion of a business into an adjacent vacant space in a multi‐tenant building; authorizing the temporary designation of a limited number of existing public parking stalls within the Center Downtown zoning district to support parking for short‐term curbside pick‐up or to go orders from businesses; temporarily waiving parking fees for parking for periods of up to 10 hours within the City’s City Center Parking Garage located at 655 South 2nd Street; providing for severability; declaring an emergency; and establishing an immediate effective date. MOVED BY CORMAN, SECONDED BY MCIRVIN, COUNCIL ADVANCE THE ORDINANCE FOR SECOND AND FINAL READING AT TONIGHT'S MEETING. CARRIED. Following a second and final reading, it was MOVED BY CORMAN, SECONDED BY MCIRVIN, COUNCIL ADOPT THE ORDINANCE AS READ. ROLL CALL: ALL AYES. CARRIED. Ordinance for second and final reading: o) Ordinance No. 5995: An ordinance was read amending the City of Renton fiscal years 2019/2020 Biennial Budget as adopted by Ordinance No. 5898, in the amount of $12,166,453, adopting an amended 2020 City of Renton Salary Table, and establishing an effective date. MOVED BY PRINCE, SECONDED BY CORMAN, COUNCIL ADOPT THE ORDINANCE AS READ. ROLL CALL: ALL AYES. CARRIED. NEW BUSINESS Please see the attached Council Committee Meeting Calendar. AGENDA ITEM #5. a) December 7, 2020 REGULAR COUNCIL MEETING MINUTES ADJOURNMENT MOVED BY PRINCE, SECONDED BY CORMAN, COUNCIL ADJOURN. CARRIED. TIME: 9:39 P.M. Jason A. Seth, MMC, City Clerk Jason Seth, Recorder 07 Dec 2020 AGENDA ITEM #5. a) Council Committee Meeting Calendar December 7, 2020 December 14, 2020 Monday 2:00 PM Planning and Development Committee, Chair Corman - VIDEOCONFERENCE 1. 2020 Year-end Wrap-up 2. Emerging Issues in CED 3:15 PM Utilities Committee, Chair O’Halloran - VIDEOCONFERENCE 1. Monroe Storm Improvement Project, OTAK Contract 2. Green Stormwater Project, Osborn Contract 3. Emerging Issues in Utilities 4:00 PM Finance Committee, Chair Prince - VIDEOCONFERENCE 1. Bad Debt Write-off 2. Cedar River Trail Relocation 3. Lobbyist Contract, Doug Levy 4. Vouchers 5. Emerging Issues in Finance 4:30 PM Transportation Committee, Chair McIrvin - VIDEOCONFERENCE 1. Airport Annual Lease with BHC 2. Emerging Issues in Transportation 5:15 PM Public Safety Committee, Chair Benedetti - VIDEOCONFERENCE 1. Emerging Issues in Public Safety - Including Transition Updates 6:00 PM Committee of the Whole, Chair Pérez - VIDEOCONFERENCE 1. LTAC Funding Recommendations 7:00 PM City Council Meeting, Chair Pérez – VIDEOCONFERENCE AGENDA ITEM #5. a) AB - 2776 City Council Regular Meeting - 14 Dec 2020 SUBJECT/TITLE: Appointments to Renton Airport Advisory Committee (RAAC): Jeanne DeMund & Marcie Palmer RECOMMENDED ACTION: Refer to Transportation (Aviation) Committee DEPARTMENT: Executive Department STAFF CONTACT: April Alexander, Executive Assistant EXT.: 6520 FISCAL IMPACT SUMMARY: No impact SUMMARY OF ACTION: Mayor Pavone appoints Jeanne DeMund to the Kennydale Neighborhood primary position (moving Ms. DeMund from the Kennydale alternate position) for a term expiring 5/7/24; and appoints Marcie Palmer to the Kennydale Neighborhood alternate position for an unex pired term that expires on 5/7/23. EXHIBITS: A. Recommendation Memo B. Application - Jeanne DeMund C. Application - Marcie Palmer STAFF RECOMMENDATION: Confirm Mayor Pavone's appointments of Jeanne DeMund and Marcie Palmer to the Renton Airport Advis ory Committee. AGENDA ITEM #5. b) PUBLICWORKSDEPARTMENTMEMORANDUMDATE:December7,2020TO:ArmondoPavone,MaYortOFROM:MartinPastucha,Public‘ofksAdministratorSTAFFCONTACT:JasonAnderson,InterimAirportManager,ext.7476SUBJECT:RecommendationforRentonAirportAdvisoryCommitteeMembershipAppointmentsThePublicWorksDepartmentanditsAirportDivisionwouldliketorecommendthefollowingappointmentstotheRentonAirportAdvisoryCommittee(RAAC).Iftheappointmentsareapproved,werequesttheytakeeffectimmediatelyduetovacancies.ThenextRAACmeetingisscheduledforTuesday,February9.KennydaleNeighborhoodPrimaryPosition:TheAirportDivisionisrecommendingappointmentofJeanneDeMund.Ms.DeMundhasheldtheRAAC’sKennydalealternatepositionsinceFebruary2018.SheholdsaBachelorofArtsdegreeinEastAsianStudiesfromYaleUniversity,isasmallbusinessownerandservesonseveralnon-cityrelatedvolunteercommittees.Ms.DeMundisconsideredamemberofgoodstandingandwillassumetheseatbeingvacatedbyRAACmemberMarleenMandt,whosetermwouldhaveexpiredMay7,2021.Ms.MandtservedontheRAACsinceitsinceptionin2001.Ifappointed,Ms.DeMund’snexttermwouldexpireMay7,2024.KennydaleNeighborhoodAlternatePosition:ShouldMs.DeMundbeapprovedtoserveastheKennydaleprimarymember,theKennydalealternatepositionwouldbecomevacant.Earlierthisyear,aRMCapplicationwasreceivedfromMarciePalmer.Ms.PalmerisalongtimeKennydaleresidentwhoservedastheKennydaleprimarymemberfromMay2001through2004.ShethenresignedasaresultofbeingelectedtoserveontheCityCouncil.FollowingtheconclusionofherCouncilcareer,Ms.PalmerservedastheKennydalealternatememberfromFebruary1,2016-May7,2017,whenthatparticulartermexpired.InthepastMs.PalmerhasbeenheavilyinterestedintheRentonAirportandasaCouncilmemberandtheTransportation/AviationCommitteeChairshewasengagedintheAirportMasterPlandevelopment.ThetermMs.PalmerwouldfilliscurrentlyscheduledtoexpireMay7,2023.ThiswouldalsobetheexpirationdateofthetermifMs.Palmerisappointed.AGENDA ITEM #5. b) MayorPavonePage2of2December7,2020TheRentonAirportAdvisoryCommitteesolicitsmembershipapplicationsonanongoingbasis.RecentlyPublicWorksstaffmetwiththecity’sNeighborhoodProgramteamtodiscussworkingtogethertopromotetheRAACmembershipopportunitiestotheneighborhoods.Wehaverecentlystartedthispartnershipandhopetoseeanincreaseinthenumberofapplicationsreceived.TheRAACcurrentlyhasthefollowingvacancies:BensonHillPrimary.BensonHillAlternate.HighlandsAlternate.SouthRentonAlternate.WestHillAlternate.AirportLeaseholdersAlternate.InMay2021thefollowingseventermsarescheduledtoexpire:KennydalePrimary(unlessextendedwiththeappointmentofMs.DeMund).RentonHill/MontereyTerracePrimary.WestHillPrimary.Airport-at-LargePrimary.AirportOperatorsandPilotsAssociationPrimaryandAlternate.WashingtonPilotsAssociationPrimary.PublicWorksAdministrationandAirportDivisionmanagementarecurrentlyconsultingwiththesememberstodetermineifanyareinterestedinreappointment.cc:EdVanValey,InterimChiefAdministrativeOfficerJasonSeth,CityClerkJasonAnderson,ActingAirportManagerAprilAlexander,ExecutiveAssistantLindaMoschetti-Newing,AdministrativeAssistanth:\filesys\air-airport,transportationservicesdivision\01administration\02committees\airportadvisory\10-2020appointments&reapppointments\raacappointmentsdemundpalmer120320.docxAGENDA ITEM #5. b) CAUTION This email originated from outside the City of Renton Do not click links reply or open attachments unless you know the content is safe Application for Boards/Commissions/Committees 2020-10-13 06:20 PM(PST)was submitted by Guest on 10/13/2020 9:20:05 PM (GMT-O8:00)Canada/Pacific Name Value Airport Advisory Committee*Airport Advisory Committee* Civil Service Commission* Community Plan Advisory Board -Benson Hill Community Plan Advisory Board -City Center Historical/Museum Board* Housing Authority* Human Services Advisory Committee* Parks Commission* Planning Commission* Municipal Arts Commission* Senior Citizens Advisory Board* Sister City Committee -Cuautla Sister City Committee -Nishiwaki Gender Ms. Name Jeanne DeMund Address:Jill l.Lt.’-C,titf11T .majJSF$LPIJ riIjn “noneiL.JiflhIf AltPhoue: Resident Yes ResidentSince 2009 formerresidence T __ iducafionBackgroundiWl ‘•—----y-.- Owner,Echo Products,Import and Distribution of Motorcycle Accessories,2008-present Founder and Owner of Vega Helmet,Import and Distribution of Motorcycle OccupationalBackground Helmets,1994-2004 Washington State Department of Trade and Economic Development/Department of Community, Trade and Economic Development Trade Specialist and Division Director 1984-1994. Employer:Echo Products Currently Alternate,RAAC CENSE,Coalition of Eastside CommunityActivities Neighborhoods for Sensible Energy,VP Renton Shoreline Coalition,Secretary I believe the airport is a unique asset to the Renton Community,and wish to facilitate relations between the Reasonforapplying airport and the wider community,and increase understanding of the airport’s contribution to our community. Day Meetings Day Meetings 2 AGENDA ITEM #5. b) Night Meetings Night Meetings To view this form submission online,please follow the link below: tosubmissions 3 AGENDA ITEM #5. b) AIRPORT ADVISORY COMMITTEE Q CIVIL SERVICE COMMISSION E1 COMMUNITY PLAN ADVISORY BOARD —Benson Hill fl COMMUNITY PLAN ADVISORY BOARD —City Center fl HISTORICAL/MUSEUM BOARD U HOUSING AUTHORITY j HUMAN SERVICES ADVISORY COMMITTEE Office of the Mayor City of Renton 10555 Grady Way Renton,WA 92057 U PARKS COMMISSION Q PLANNING COMMISSION jj RENTON MUNICIPAL ARTS COMMISSION E]SENIOR Cfl1ZEN5 ADVISORY BOARD []SISTER CITY COMMITTEE -CUAUTIA C SISTER CITY COMMITTEE -NISHIWAKI CITY OF FORMER RESIDENCE - EDUCATIONAL BACKGROUND I 1 OCCUPATION fow,o C.rj..y (jIrwiI EMPLOYER I A OCCUPATIONAL BACKGROUND (OlAV’t I iAoe r;‘R v’ctZv C k&we’r ‘ COMMUNITY ACflVITIES (organizations/clubs/service groups,etc.)4 )C;ke’i&y’1fe k wfi REASON FOR APPLYING FOR THIS BOARD/COMMISSIONICOMMITCEE9 f/Wi i’r47A,% 1/PJix CAN ATTEND DAY MEETINGS?Ys CAN ATTEND NIGHT MEETINGS? Applications will be kept on file for one year.If you have questions about serving on a board, commission,or committee,please feel free to contact the mayor’s office at 425430-6500. CITY OF RENTON APPLICATION FOR BOARDS /COMMISSIONS /COMMITTEES If you are interested in participating in local government by membership on any of the following City boards,commissions or committees,please complete this application and return it to: Check the boards/commissIons/commIttees In which you are interested: Special membership requirements may apply for certain boards/commIssions/committees.Call 425430-6500 for details.Your application will be given every consideration as vacancies occur. Mc&&‘FieMR.fl MS.NAME ADDRESS__________ -- PHONE:DAY_______ RENTON RESIDENT? _______ DATE I-7-2.ô _______ ZIPCODE____________ EMAlL IF SO,SINCE WHEN? -v 6/2019 AGENDA ITEM #5. b) AB - 2778 City Council Regular Meeting - 14 Dec 2020 SUBJECT/TITLE: Allocation of Lodging Tax Funding for 2021 RECOMMENDED ACTION: Council Concur DEPARTMENT: Community & Economic Development Department STAFF CONTACT: Cliff Long, Economic Development Director EXT.: 6591 FISCAL IMPACT SUMMARY: Expenditure Required: $421,500 SUMMARY OF ACTION: The Lodging Tax Advisory Committee met on October 5, 2020, to approve and set a timeline for the application process. The deadline to apply was November 30, 2020. Fourteen applications totaling $551,500 were received. The Lodging Tax Advisory Committee recommends Renton City Council approval 2021 expenditures from the Lodging Tax Fund as follows: • Renton Chamber of Commerce, Operation of Visitor Center operations: $150,000 • Renton Community Marketing Campaign: $100,000 • Seattle TISI Sangam, 2021 Sangam Festival: $40,000 • LTAC selected community event sponsorships: $25,000 • Northwest Entertainment Foundation, KingCon NW: $25,000 • REELRenton, 2021 Seattle Film Summit: $25,000 • AmPowering, 2021 Women’s Show: $20,000 • AmPowering, 2021 North American Fashion Week: $20,000 • Renton Downtown Partnership, Downtown Marketing package: $15,000 • WA State Geocaching Association: $1,500 Total Recommendation: $421,500 EXHIBITS: A. Issue Paper_2021 LTAC Allocations B. 2021 LTAC Applicant Summary STAFF RECOMMENDATION: Approve allocations for the 2021 Lodging Tax Fund as recommended by the Lodging Tax Advisory Committee and authorize the Mayor and City Clerk to execute contracts with the successful applicants to expend budgeted funds on the proposed additional marketing initiatives. AGENDA ITEM #5. c) h:\ced\edn\ltac\2021\2021 ltac funding allocation.docx DEPARTMENT OF COMMUNITY & ECONOMIC DEVELOPMENT M E M O R A N D U M DATE: December 8, 2020 TO: Ruth Perez, Council President Members of Renton City Council CC: Armondo Pavone, Mayor Ed VanValey, Chief Administrative Officer FROM: Cliff Long, Economic Development Director (x6591) STAFF CONTACT: Jessie Kotarski (x7271) SUBJECT: Allocation of Lodging Tax Funding for 2021 ISSUE Should money from Lodging Tax funds be allocated to applicants to support tourism marketing and operations as recommended by Renton’s Lodging Tax Advisory Committee (LTAC)? RECOMMENDATION Support the recommendation of the Lodging Tax Advisory Committee to allocate an $421,500 in lodging tax funding for 2021 as detailed in the attached matrix and summarized below. Additionally, staff recommends that the Mayor and City Clerk be allowed to execute contracts with the successful applicants to expend budgeted funds on the proposed additional marketing initiatives outlined below. BACKGROUND SUMMARY In accordance with RCW 67.28.1817, the City of Renton has established a Lodging Tax Advisory Committee to recommend the allocation of lodging tax funds to Renton City Council. The Committee was chaired by Councilmember Corman and members include:  Angela Mose, Best Western Plus, Renton  Cathy Martinez, Legacy Hospitality (Hampton)  Jeff Kelly, Renton Downtown Partnership  Menka Soni, AmPowering  Pina Purpero, Hyatt Regency Lake Washington at Seattle’s Southport  Preeti Shridhar, City of Renton AGENDA ITEM #5. c) Ruth Perez, Council President Page 2 of 2 December 8, 2020 h:\ced\edn\ltac\2021\2021 ltac funding allocation.docx Council "may only choose recipients from the list of candidates and recommended amounts provided by the local lodging tax advisory committee." However, Council does not have to fund the full list as recommended by the LTAC and can choose to make awards in the recommended amounts to all, some, or none of the candidates on this list. The Lodging Tax Advisory Committee met on October 5, 2020, to approve and set a timeline for the 2021 Lodging Tax application process. Applications were due on November 30, 2020. Fourteen applications were received. The Committee heard presentations from qualified applicants on December 3, 2020, and conducted a debriefing following the interviews to finalize its recommendations. The Committee has elected to set aside funds in the amount of $25,000 to support community events hosted by non-profit entities with limited budgets that will help support the potential growth of activities/events in the future. All sponsorship recipients will feature the Renton marketing logo and web address (visitrentonwa.com). The Lodging Tax Advisory Committee recommends Renton City Council approve 2021 expenditures from the Lodging Tax Fund as follows:  Renton Chamber of Commerce, Operation of Visitor Center operations: $150,000  Renton Community Marketing Campaign: $100,000  Seattle TISI Sangam, 2021 Sangam Festival: $40,000  LTAC selected community event sponsorships: $25,000  Northwest Entertainment Foundation, KingCon NW: $25,000  REELRenton, 2021 Seattle Film Summit: $25,000  AmPowering, 2021 Women’s Show: $20,000  AmPowering, 2021 North American Fashion Week: $20,000  Renton Downtown Partnership, Downtown Marketing package: $15,000  WA State Geocaching Association: $1,500 Total Recommendation: $421,500 Staff appreciates the thorough review given to each application by the Committee and finds their recommendations are consistent with the goals of the City’s Business Plan and Economic Development Strategic Plan. AGENDA ITEM #5. c) Grant Applicant Event Name Contact Information Date of Event Summary of Project or Event Amount Requested Amount Recommended LTAC notes 1 Renton Chamber of Commerce Operation of Tourism Organization, marketing support and event sponsorship Diane Dobson diane@gorenton.com 425‐226‐4560 Ongoing Operation costs to run the Visitor's Center in downtown Renton, plus additional funds requested for a tourism marketing video and holiday experience in downtown Renton. $190,000.00 $150,000 funding intended to support the operations of the visitor's center 2 City of Renton Renton Community Marketing Cliff Long clong@rentonwa.gov 425‐ 430‐6591 425‐ 757‐2649 (cell) Ongoing The campaign include marketing communications, digital and social media services, advertising, branding,public relations, communications strategy and planning and website development, design and maintenance to create and supportan effective Visit Renton brand to promote the City as the ideal destination to live, work and play. $100,000 $100,000 3 Seattle TISI Sangam 2021 Sangam Festival Bal Ram bal929@hotmail.com 253‐632‐2440 May 29 ‐ 30, 2021 Cultural sporting and education event held every and attracting people from Australia, New Zealand, Fiji, Canada and India. $45,000 $40,000 4 reelRenton 2021 Seattle Film Summit Ben Andrews bena@seattlefilmsummit.com 253‐861‐ 7755 Nov 1‐ Nov 14, 2021 The Seattle Film Summit (SFS) is the premier film event in the Pacific Northwest, bringing together regional film and digital media partners with A‐list production professionals from Hollywood and adjoining states to cultivate and expand the local film market. The Summit appeals to writers, directors, producers, distributors, acquisition executives, talent agents, attorneys, festival directors, and all those who provide services to the motion picture industry. $50,000 $25,000 5 Northwest Entertainment Foundation KingCon NW Brian Morris admin@kingconnw.com 206‐ 914‐8054 Oct 1 ‐ Oct 3, 2021 Moving into year 6 and post a covid year, Kingcon NW plans to create a hybrid event that will not only bring physical guests into Renton from the West Coast and beyond, but also to highlight Renton around the world via the internet. Our event will consist of our main three tracks: Science, Gaming, and Cosplay all based upon education, supporting and encouraging artists, and providing a solid financial foundation through the gaming world. This event will allow us to not only put heads in bed and feet on the street but have a world‐wide presence to show what Renton has to offer. $50,000.00 $25,000 6 AmPowering Women's Show Menka Soni soni_menka@hotmail.com 425‐ 301‐2255 425‐ 418‐7181 (cell) November 2021 This annual show features the Miss, Mrs., and Miss Teen India Washington, Oregon & Albama pageant. It also includes food and non‐food vendors, and entertainment. Plans are to host the event at the Hyatt. $25,000.00 $20,000 7 AmPowering North American Fashion Week Menka Soni soni_menka@hotmail.com 425‐ 301‐2255 425‐ 418‐7181 (cell) Aug 1 ‐ Aug 31, 2021 A celebration of art and culture designed to promote local fashion designers and put Renton on the map as an industry hotspot while connecting local and international designers. NAFW is a great platform to promote tourism and commerce while supporting the arts and multiculturalism. $25,000.00 $20,000 8 City of Renton Farmers Market Carrie Olson clolson@rentonwa.gov 425‐ 430‐7214 Jun ‐ Sept 2021 The goal for the 2021 Renton Farmers Market (RFM) will be to meet State guidelines for farmers markets and return to ‘normal operations’ as much as the COVID19 pandemic will allow. ‘Normal operations’ would include ready‐to‐eat foods, cooking demonstrations, kids activities, community booths and live entertainment; these were not allowed during the 2020 season. RFM will work closely with Public Health – Seattle &King County (PHSKC) to develop Market events that follow recommended safety guidelines and requirements, while continuing to operate a marketplace for farmers and small businesses. $20,000 $5,000 Sponsorship 9 City of Renton Renton Multicultural Festival (virtual) Benita Horn BHorn@Rentonwa.gov (425) 430‐6526 Jan ‐ Oct 2021 The Renton Multicultural Festival is a two‐day event planned by the Mayor’s Inclusion Task Force and City of Renton staff. This event brings together people of different races, ages, genders, religions, sexual orientations and social economic status toembrace our diverse community and promote unity through world‐class performances. We plan to expand our infusion of nationalartists and promote hotel stays during the filming of performances.. $7,500 $5,000 Sponsorship 10 City of Renton Renton River Days Sonja Mejlaender smejlaender@rentonwa.gov 425‐430‐6514 Jul 23‐25, 2021 Renton River Days (RRDs) will celebrate its 36th Anniversary in 2021. As the State of Washington's and King County's phase compliance may allow next year, RRDs is making plans to provide a scalable community event, centered largely in downtown Renton and at Piazza Park. As may be possible, RRDs plans to feature culturally diverse entertainment, food, arts, and all‐ages activities. The festival's volunteer Board of Directors is looking at options which provide in‐person and pick‐up/experience‐at‐home options. $5,000 $5,000 Sponsorship 11 Tasveer Tasveer Arts Festival Rita Meher rita@tasveer.org 206‐349‐4478 31‐Oct‐21 With response to COVID, Tasveer has created a new unique festival called TAF: Tasveer Arts Festival (TAF). We will include more than 60 films, more than 10 South Asian American authors, and storytelling by 7 local South Asian women. Festival programmers will spend months selecting films with those of the highest artistic quality. Our events in 2020 attracted more than 10000 participants nationally. $10,000 $5,000 Sponsorship 12 Renton Downtown Partnership Fall in Love with Renton (virtual box events) Jon Glenn RDP@gorenton.com 425‐430‐7271 Feb 20 and March 25, 2021 This two part project is an event in a box featuring specially curated items from downtown retailers along with an online music presentation showcasing local artists with short vendor spots throughout the evening. This event will be held on two nights. February 20 will be marketed as a date night in a box. The March 25 event will feature items from Women Owned Businesses in order to promote Women's History Month. $7,500.00 $5,000 Sponsorship 13 Renton Downtown Partnership Downtown promotion package Jon Glenn RDP@gorenton.com 425‐430‐7271 Ongoing Requesting funds to a year‐long marketing campaign to promote Downtown Renton as a vibrant destination to live, work and play. The proposed Homepage Takeover and Native Advertising campaign with KIRO will hit a broad audience outside of Renton and attract new visitors to the City Center. $15,000.00 $15,000 14 WA State Geocaching Association 2021 Valley Cities GeoTour Annette Bails annettepbailes@aol.com 206‐890‐4043 May 15 ‐ Dec 15, 2021 Support for the 2021 GeoTour drawing geocache tourists to the region for an outdoor activity marketed through the popular national platform; geocaching.com $1,500.00 $1,500 Total $551,500.00 $421,500 AGENDA ITEM #5. c) AB - 2777 City Council Regular Meeting - 14 Dec 2020 SUBJECT/TITLE: Renton City Hall - Phase 2 Improvements (ESCO) CAG-20-101 RECOMMENDED ACTION: Refer to Finance Committee DEPARTMENT: Community Services Department STAFF CONTACT: Russ Woodruff, Capital Project Coordinator EXT.: 425-430-6602 FISCAL IMPACT SUMMARY: Total project costs including design, construction, warranty, performance measurement/verification and sales tax are $2,407,491.00. A separate contract with the Washington State Department of Enterprise Services (DES) in the amount of $62,500.00 will be executed for DES to provide essential project management per the ESCO agreement. This project is budget neutral and has been approved by council in the 6 year CIP 2019-2020 adopted budget. SUMMARY OF ACTION: The Renton City Hall Phase 2 project will include replacements of the failing fire pumps and boilers which are long past life expectancy. In addition, the work will include replacing the essential cooling system in the City’s main computer room which is currently tied to the main building HVAC system. The new cooling system will be independent and on building emergency power to allow the computer system to function during power outages. Lastly, the 2 aged emergency generators will be replaced with 1 new generator sized to accommodate all building life safety requirements and the additional power requirements of the new computer server room cooling. EXHIBITS: A. Amendment 1 to CAG-20-101 STAFF RECOMMENDATION: Approve the Amendment 1 to CAG-20-101, with McKinstry Essention, in the amount of $2,407,491, for the Renton City Hall - Phase 2 Improvements (ESCO) project. AGENDA ITEM #5. d) AMENDMENT NO.1TO AGREEMENT FOR CAG 20-101 RENTON CITY HALL PHASE 2 . CONSTRUCTION THIS AMENDMENT, dated November !7,?OZA, is by and between the City of Renton (the "City"), a Washington municipal corporation, and McKinstry Essention ("Consultant"), o Washington Corporation. The City and the Consultant are referred to collectively in this Amendment as the "Parties." Once fully executed by the Parties, this Amendment is effective as of the last date signed by both parties. Whereas, the City engaged the services of the Consultant under Agreement CAG-20-101, dated June22,2}z},to provide necessary services for the Renton City Hall Phase 2 (ESCO) (referred to herein as the "Agreement"); Whereas, the Parties wish to amend the Agreement to undertake all work as defined in Exhibit B-1 and revise fee per Exhibit A-1 in order to complete all work. NOW THEREFORE, lt is mutually agreed upon that CAG-20-101 is arnended as follows: Scope of Work: Section 1, Scope of Work, is amended to add work as specified in Exhibit B-1, which is attached and incorporated herein. Time of Performance: Section 3, Time of Performance is revised. AII Work shall be performed by no later December 3J., 2023. Co{npensation: Section 4, Compensation, is amended so that the maximum amount of compensation payable to Consultant is increased by 52,407,49L from $130,115.00 to $2,537,6A6, including any applicable state and local sales taxes. The additional compensation shall be paid based upon Work actually performed according to the rate(s) or amounts specified in Exhibit B-1 and Exhibit C-l which are attached and incorporated herein. All terms of the Agreement not explicitly modified herein shall remain in full force and effect and such terms shall apply to Work performed according to this Amendment as if fully set forth herein. !N WITNESS WHEREOF, the Parties have voluntarily entered into this Amendment as of the date last signed by the Parties below. 1. 2. 3. 4. AGENDA ITEM #5. d) CITY OF RENTON By: Armondo Pavone Mayor \\/zstz- DateDate Attest Jason A. Seth City Clerk Approved as to Legal Form Shane Moloney City Attorny Contract Template Updated 01-15-2020 CONSULTANT : Justin Fallstrom Title: Regional Director PAGE2 oF 2 By: AGENDA ITEM #5. d) 11/24/2020 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WZK:dED ^Zs/^K&&Zͮϭ ŝƚǇŽĨZĞŶƚŽŶ DƵůƚ͘WƌŽƉĞƌƚŝĞƐWŚϭϮϬϭϴͲϬϮϳ;ϮͿ ŶĞƌŐǇ^ĞƌǀŝĐĞƐWƌŽƉŽƐĂů ZEdKE͕t^,/E'dKE EKsDZϱ͕ϮϬϮϬʹZs/^/KEϯ)257+(/,)(2)<285%8,/',1*y,//dϭ AGENDA ITEM #5. d) THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚŽŶƚĂĐƚƐ ZK&Z^WKE^//>/dz ED KEddEhDZ D/> ZĞŶƚŽŶWƌŝŵĂƌǇŽŶƚĂĐƚͲ ĂƉŝƚĂůWƌŽũĞĐƚŽŽƌĚŝŶĂƚŽƌ ZƵƐƐtŽŽĚƌƵĨĨ ϰϮϱ͘ϰϯϬ͘ϲϲϬϮ ZtŽŽĚƌƵĨĨΛZĞŶƚŽŶǁĂ͘ŐŽǀ ZĞŶƚŽŶ&ĂĐŝůŝƚŝĞƐŝƌĞĐƚŽƌ:ĞĨĨDŝŶŝƐĐŝ ϰϮϱ͘ϰϯϬ͘ϲϲϰϯ :DŝŶŝƐĐŝΛZĞŶƚŽŶǁĂ͘ŐŽǀ t^ZĞƉƌĞƐĞŶƚĂƚŝǀĞŽƵŐ<ŝůƉĂƚƌŝĐŬ ϯϲϬ͘ϰϬϳ͘ϵϯϴϬ ĚŽƵŐ͘ŬŝůƉĂƚƌŝĐŬΛĚĞƐ͘ǁĂ͘ŐŽǀ ĐĐŽƵŶƚǆĞĐƵƚŝǀĞŶĚƌĞǁtŝůůŝĂŵƐŽŶ ϮϬϲ͘ϴϯϮ͘ϴϰϴϵ ĂŶĚƌĞǁǁŝΛŵĐŬŝŶƐƚƌǇ͘ĐŽŵ WƌŽŐƌĂŵDĂŶĂŐĞƌDĂƌŬEŝĞŵĂŶ ϮϬϲ͘ϴϯϮ͘ϴϭϱϮ ŵĂƌŬŶΛŵĐŬŝŶƐƚƌǇ͘ĐŽŵ ŶĞƌŐǇŶŐŝŶĞĞƌDĂƌŬEŝĞŵĂŶ ϮϬϲ͘ϴϯϮ͘ϴϭϱϮ ŵĂƌŬŶΛŵĐŬŝŶƐƚƌǇ͘ĐŽŵ DĞĐŚĂŶŝĐĂůŶŐŝŶĞĞƌŵŝůǇtŽŶŐ ϮϬϲ͘ϳϲϰ͘ϭϲϵϳ ĞŵŝůǇǁΛDĐ<ŝŶƐƚƌǇ͘ĐŽŵ ůĞĐƚƌŝĐĂůŶŐŝŶĞĞƌĂŶ^ƚĞŝŶĞƌƚ ϮϬϲ͘ϳϲϰ͘ϭϳϬϮ ĚĂŶƐƚΛŵĐŬŝŶƐƚƌǇ͘ĐŽŵ WĞƌĨŽƌŵĂŶĐĞƐƐƵƌĂŶĐĞ ^ƉĞĐŝĂůŝƐƚ :ĂŬĞ>ĂŶĚƐŝĞĚĞů ϱϬϵ͘ϲϮϱ͘ϯϭϭϱ ũĂŬĞůΛŵĐŬŝŶƐƚƌǇ͘ĐŽŵ ŽŶƐƚƌƵĐƚŝŽŶDĂŶĂŐĞƌĂǀĞZŽďŝŶĂƵŐŚ ϮϬϲ͘ϴϯϮ͘ϴϯϱϮ ĂǀĞZŽΛDĐ<ŝŶƐƚƌǇ͘ĐŽŵ AGENDA ITEM #5. d) THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŽŶƚĞŶƚƐ ^d/KEϭ͘yhd/s^hDDZz͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ϭ͘ϭKsZs/t ϭ͘ϮhZZEd^/dhd/KE ϭ͘ϯ^K>hd/KE^ ϭ͘ϰ^hDDZzK&E&/d^ ϭ͘ϱD</E^dZz/&&ZEd/dKZ^ ^d/KEϮ͘^KWK&tKZ<͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ Ϯ͘ϭ&/>/dz/DWZKsDEdD^hZ;&/DͿ>/^d Ϯ͘ϮD</E^dZz^Zs/^ Ϯ͘ϯydEdK&^hKEdZd/E' Ϯ͘ϰWZK:d^,h> d/>^KWK&tKZ< ^d/KEϯ͘EZ'z^s/E'^'hZEd͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϱ ϯ͘ϭ'hZEdKsZs/t ϯ͘Ϯ&/D^W/&/WZ&KZDE^^hZEDd,KK>K'z ϯ͘ϯhd/>/dzZd^ ϯ͘ϰ^dEZ^K&KD&KZd^Zs/ ϯ͘ϱKE'K/E'KtEZZ^WKE^//>/d/^ ϯ͘ϲEKEͲWZ&KZDE ϯ͘ϳ,E'K&h^ d>ϯ͘ϭͲEZ'z^s/E'^^hDDZz d>ϯ͘ϮͲD^hZDEdEsZ/&/d/KE;DΘsͿW>EKhd>/E d>ϯ͘ϯͲ^hd/>/dzZd^ ^d/KEϰ͘WZK:d&/EE/>^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϯ ϰ͘ϭDy/DhDWZK:d>>Kt>K^d ϰ͘ϮWZK:dK^dd> ϰ͘ϯ/dD^/E>h/EDy/DhDWZK:dK^d ϰ͘ϰKE^dZhd/KEKEd/E'Ez ϰ͘ϱ>>KtE^ ϰ͘ϲKE'K/E'^Zs/^ ϰ͘ϳKhEd/E'ZKZ^ ϰ͘ϴZKE/>/d/KEK&>KZΘDdZ/>K^d^ ϰ͘ϵKDWE^d/KE ϰ͘ϭϬ&/EE/E' ϰ͘ϭϭdZD/Ed/KEs>h ϰ͘ϭϮdZD^K&'ZDEd ϰ͘ϭϯ/E^hZEΘKE/E' ϰ͘ϭϰ/sZ^h^/E^^WZd//Wd/KE'K>^&KZd,/^WZK:d d>ϰ͘ϭʹh'd^hDDZz d>ϰ͘Ϯʹ&/>/dz/DWZKsDEdD^hZ;&/DͿ^hDDZz ^d/KEϱ͘/Es^dDEd'Zh/d͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϴϯ AGENDA ITEM #5. d) THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ǆĞĐƵƚŝǀĞ^ƵŵŵĂƌǇ ϭ͘ϭKǀĞƌǀŝĞǁ dŚƌŽƵŐŚƚŚĞtĂƐŚŝŶŐƚŽŶ^ƚĂƚĞĞƉĂƌƚŵĞŶƚŽĨŶƚĞƌƉƌŝƐĞ^ĞƌǀŝĐĞƐ;^ͿŶĞƌŐǇ ^ĂǀŝŶŐƐWĞƌĨŽƌŵĂŶĐĞŽŶƚƌĂĐƚŝŶŐ;^WͿƉƌŽŐƌĂŵ͕DĐ<ŝŶƐƚƌǇŚĂƐĐŽŵƉůĞƚĞĚĂŶ ĞǆƚĞŶƐŝǀĞƐƚƵĚǇĂŶĚŝŶǀĞƐƚŝŐĂƚŝŽŶŽĨĞŶĞƌŐǇƵƉŐƌĂĚĞƐĨŽƌƚŚĞŝƚǇŽĨZĞŶƚŽŶ͘KƵƌ ŶĞƌŐǇ^ĞƌǀŝĐĞƐWƌŽƉŽƐĂůƉƌĞƐĞŶƚƐĂŚŽůŝƐƚŝĐƉƌŽũĞĐƚƐŽůƵƚŝŽŶĨŽƌŝŵƉƌŽǀŝŶŐƚŚĞ ŽǀĞƌĂůůĨĂĐŝůŝƚǇĞĨĨŝĐŝĞŶĐǇĂŶĚŽƉĞƌĂƚŝŽŶ͘KƵƌƉƌŽƉŽƐĞĚƐŽůƵƚŝŽŶƐǁŝůůƌĞƐƵůƚŝŶ ůŽǁĞƌƵƚŝůŝƚǇƵƐĞĂŶĚĐŽƐƚĂůŽŶŐǁŝƚŚŝŵƉƌŽǀĞĚďƵŝůĚŝŶŐƐǇƐƚĞŵƉĞƌĨŽƌŵĂŶĐĞĂŶĚ ŽĐĐƵƉĂŶƚƉƌŽĚƵĐƚŝǀŝƚǇ͘ ϭ͘ϮƵƌƌĞŶƚ^ŝƚƵĂƚŝŽŶ ,>>E'^ dŚĞŝƚǇŽĨZĞŶƚŽŶŵĂŝŶƚĂŝŶƐŵĂŶǇĨĂĐŝůŝƚŝĞƐǁŝƚŚĂŐŝŶŐŝŶĨƌĂƐƚƌƵĐƚƵƌĞƚŚĂƚŝƐĂƚƚŚĞ ĞŶĚŽĨŝƚƐƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘dŚŝƐĞƋƵŝƉŵĞŶƚŝƐĂůƐŽůĞƐƐĞĨĨŝĐŝĞŶƚĂŶĚŝƐŵŽƌĞ ĞǆƉĞŶƐŝǀĞƚŽŽƉĞƌĂƚĞĂŶĚŵĂŝŶƚĂŝŶ͘ 'K>^ dŚĞĨĂĐŝůŝƚǇŝŵƉƌŽǀĞŵĞŶƚŵĞĂƐƵƌĞƐ;&/D͛ƐͿǁŝƚŚŝŶƚŚŝƐŶĞƌŐǇ^ĞƌǀŝĐĞWƌŽƉŽƐĂů ;^WͿĂŶĚ/ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ;/'ͿĂĚĚƌĞƐƐƚŚĞŝƚǇ͛ƐŶĞĞĚƐƚŽƌĞƉůĂĐĞĂŶĚ ƵƉŐƌĂĚĞƚŚĞŵŽƐƚƵƌŐĞŶƚĨĂŝůŝŶŐĞƋƵŝƉŵĞŶƚǁŝƚŚŚŝŐŚͲĞĨĨŝĐŝĞŶĐǇĞƋƵŝƉŵĞŶƚ͘dŚĞƐĞ ŵĞĂƐƵƌĞƐǁŝůůĂůƐŽƌĞĚƵĐĞŽŶͲŐŽŝŶŐŽƉĞƌĂƚŝŽŶƐĂŶĚŵĂŝŶƚĞŶĂŶĐĞĐŽƐƚƐĨŽƌƚŚĞ ŝƚǇ͘ ϭ͘ϯ^ŽůƵƚŝŽŶƐ dŚŝƐƉƌŽũĞĐƚŝŶĐůƵĚĞƐ͗ &/DϬϭ͘ϬϭͲZ,͗hƉŐƌĂĚĞŽŝůĞƌƐ͕WƵŵƉƐĂŶĚ^ƚŽƌĂŐĞdĂŶŬƐ ZĞƉůĂĐĞŵĞŶƚŽĨƚŚĞŝƚǇ,ĂůůďŽŝůĞƌƐ͕ƉƵŵƉƐĂŶĚĚŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌƐƚŽƌĂŐĞ ƚĂŶŬƐ͘ &/DϬϯ͘ϬϰͲZ,͗hƉŐƌĂĚĞ/dZŽŽŵŽŽůŝŶŐ ZĞƉůĂĐĞŵĞŶƚŽĨƚŚĞŝƚǇ,Ăůů/dZŽŽŵĐŽŽůŝŶŐƐǇƐƚĞŵ &/DϬϵ͘ϬϭͲW'͗hƉŐƌĂĚĞ>ŝŐŚƚŝŶŐƚŽ> ZĞƚƌŽĨŝƚƚŝŶŐŽĨƚŚĞŝƚǇĞŶƚĞƌWĂƌŬŝŶŐ'ĂƌĂŐĞůŝŐŚƚŝŶŐƚŽ>͘ &/DϮϬ͘ϬϭͲZ,͗hƉŐƌĂĚĞ&ŝƌĞWƵŵƉ ZĞƉůĂĐĞŵĞŶƚŽĨƚŚĞŝƚǇ,ĂůůĨŝƌĞƉƵŵƉƐƚŽĂĚĚƌĞƐƐƐĂĨĞƚǇĂŶĚƌĞůŝĂďŝůŝƚǇŝƐƐƵĞƐ͘ ϭϭ͘ϬϭͲZ,͗hƉŐƌĂĚĞƵŝůĚŝŶŐ'ĞŶĞƌĂƚŽƌ ZĞƉůĂĐĞŵĞŶƚŽĨƚŚĞŝƚǇ,ĂůůďĂĐŬͲƵƉƉŽǁĞƌŐĞŶĞƌĂƚŽƌƐǁŝƚŚĂŶĞǁƐŝŶŐůĞ ŐĞŶĞƌĂƚŽƌƚŽĂĚĚƌĞƐƐĐĂƉĂĐŝƚǇ͕ƐĂĨĞƚǇĂŶĚƌĞůŝĂďŝůŝƚǇŝƐƐƵĞƐ͘ůƐŽ͕ŝŶĐƌĞĂƐĞƚŚĞ ĐĂƉĂĐŝƚǇŽĨƚŚĞƐǇƐƚĞŵďǇϱϬŬtĨŽƌĂŶĞǁ<ŝŶŐŽƵŶƚǇĞŵĞƌŐĞŶĐǇƌĂĚŝŽƐǇƐƚĞŵ͘ KhdKD^EW^,Kd dŚŝƐƉƌŽũĞĐƚƌĞƉƌĞƐĞŶƚƐĂŶĞǆĐĞůůĞŶƚ ŽƉƉŽƌƚƵŶŝƚǇƚŽƐŝŐŶŝĨŝĐĂŶƚůǇ ŝŵƉƌŽǀĞĨĂĐŝůŝƚŝĞƐǁŚŝůĞƐĂǀŝŶŐ ĞŶĞƌŐǇĂŶĚƚƌŝŵŵŝŶŐƵƚŝůŝƚǇ ƐƉĞŶĚŝŶŐ͘DĐ<ŝŶƐƚƌǇůŽŽŬƐĨŽƌǁĂƌĚ ƚŽŵĂŬŝŶŐƚŚŝƐƉƌŽũĞĐƚĂƐƵĐĐĞƐƐ͘ DĐ<ŝŶƐƚƌǇĞƐƚŝŵĂƚĞƐƚŚĞƐĞƐĂǀŝŶŐƐ ŝĨƉƌŽƉŽƐĞĚĨĂĐŝůŝƚǇŝŵƉƌŽǀĞŵĞŶƚ ŵĞĂƐƵƌĞƐ;&/DƐͿĂƌĞŝŶƐƚĂůůĞĚ͗ Ψϭϵ͕ϵϵϳ hƚŝůŝƚǇĐŽƐƚ ƐĂǀŝŶŐƐͬǇĞĂƌ Ψϭϵ͕ϵϮϭ KƉĞƌĂƚŝŽŶƐΘ ŵĂŝŶƚĞŶĂŶĐĞ ĐŽƐƚƐͬǇĞĂƌ ϮϬϰ͕ϱϳϬ 'ƵĂƌĂŶƚĞĞĚ ŬtŚͬǇĞĂƌ ϴϳϭ 'ƵĂƌĂŶƚĞĞĚ dŚĞƌŵƐͬǇĞĂƌ ĂƌďŽŶĚŝŽǆŝĚĞĞŵŝƐƐŝŽŶƐ ƌĞĚƵĐƚŝŽŶƐǁŽƵůĚĞƋƵĂů͗ ϰϬ ĐƌĞƐŽĨƚƌĞĞƐ ƉůĂŶƚĞĚ ϯϮϯ͕ϵϳϬ ůďƐ͘KϮͬǇĞĂƌ AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ǆĞĐƵƚŝǀĞ^ƵŵŵĂƌǇ ϭ͘ϰ^ƵŵŵĂƌǇŽĨĞŶĞĨŝƚƐ &/EE/>E&/d^ ^ĞĐƚŝŽŶϰŽĨƚŚŝƐĚŽĐƵŵĞŶƚƉƌŽǀŝĚĞƐĂĚĞƚĂŝůĞĚůŽŽŬĂƚƚŚĞƉƌŽũĞĐƚĨŝŶĂŶĐŝĂůƐ͘dŚĞ ŐƵĂƌĂŶƚĞĞĚŵĂǆŝŵƵŵƉƌŽũĞĐƚĂůůŽǁĂďůĞĐŽƐƚŝƐΨϮ͕ϯϰϳ͕ϱϱϭ͘/ŶĐůƵĚŝŶŐƐĂůĞƐƚĂǆ ĂŶĚ^ŵĂŶĂŐĞŵĞŶƚĨĞĞƐĂŶĚƉƌŝŽƌƚŽĂŶǇƵƚŝůŝƚǇŝŶĐĞŶƚŝǀĞƐ͕ƚŚĞĨŝŶĂůƉƌŽũĞĐƚ ĐŽƐƚŝƐΨϮ͕ϲϰϰ͕ϴϬϲ͘dŚŝƐĨŝŶĂůƉƌŽũĞĐƚĐŽƐƚŝŶĐůƵĚĞƐĂΨϭϰϰ͕ϬϬϭĂĚĚĨŽƌŝŶĐƌĞĂƐĞĚ ƐǇƐƚĞŵĐĂƉĂĐŝƚǇƚŽĂĐĐŽŵŵŽĚĂƚĞƚŚĞϱϬŬt<ŝŶŐŽƵŶƚǇĞŵĞƌŐĞŶĐǇƌĂĚŝŽ ƐǇƐƚĞŵŝŶƐƚĂůůĂƚŝŽŶ͘dŚĞĂŶŶƵĂůĞŶĞƌŐǇƐĂǀŝŶŐƐĂƌĞΨϭϵ͕ϵϳϳ͘KƉĞƌĂƚŝŽŶĂůĂŶĚ ŵĂŝŶƚĞŶĂŶĐĞƐĂǀŝŶŐƐŚĂǀĞďĞĞŶŝŶĐůƵĚĞĚŝŶƚŚĞĐĂƐŚĨůŽǁƐĂƐĂŐƌĞĞĚƚŽďǇƚŚĞ ^ĞŶĞƌŐǇƉƌŽũĞĐƚŵĂŶĂŐĞƌĂŶĚdŚĞŝƚǇŽĨZĞŶƚŽŶͲƚŚĞƐĞƉƌŽũĞĐƚŝŽŶƐĂƌĞ ďĂƐĞĚŽŶƌĞĚƵĐĞĚƌĞƉĂŝƌĐŽƐƚƐĂŶĚĨƵƚƵƌĞĂǀŽŝĚĞĚĐĂƉŝƚĂůĞǆƉĞŶĚŝƚƵƌĞƐĂŶĚ ƌĞƉƌĞƐĞŶƚΨϭϵ͕ϵϮϭŝŶĂŶŶƵĂůƐĂǀŝŶŐƐ͘dŽƚĂůĨŝƌƐƚͲǇĞĂƌƐĂǀŝŶŐƐĂƌĞĞƐƚŝŵĂƚĞĚĂƚ Ψϯϵ͕ϴϵϴ͘dŚĞĞƐƚŝŵĂƚĞĚƵƚŝůŝƚǇƌĞďĂƚĞƐĨŽƌƚŚĞƉƌŽũĞĐƚĂƌĞΨϮϯ͕ϬϬϬ͘ Es/ZKEDEd>E&/d^ ǇƚĂŬŝŶŐƚŚĞŶĞĐĞƐƐĂƌǇƐƚĞƉƐƚŽƌĞĚƵĐĞĞŶĞƌŐǇĐŽŶƐƵŵƉƚŝŽŶƚŚƌŽƵŐŚƚŚĞ ŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨƚŚĞǀĂƌŝŽƵƐĨĂĐŝůŝƚǇŝŵƉƌŽǀĞŵĞŶƚŵĞĂƐƵƌĞƐĚĞƚĂŝůĞĚŝŶƚŚŝƐ ƌĞƉŽƌƚ͕dŚĞŝƚǇŽĨZĞŶƚŽŶǁŝůůĂƚƚĂŝŶƚŚĞƐĂǀŝŶŐƐŽƵƚůŝŶĞĚŝŶƚŚĞŽƵƚĐŽŵĞ ƐŶĂƉƐŚŽƚŽŶƚŚĞůĞĨƚ͘dŚŝƐŝƐĞƋƵŝǀĂůĞŶƚƚŽ͗ ͻϭϰĂǀĞƌĂŐĞͲƐŝǌĞĚŚŽŵĞƐďĞŝŶŐƌĞŵŽǀĞĚĨƌŽŵƚŚĞƉŽǁĞƌŐƌŝĚ͖Žƌ ͻϮϴǀĞŚŝĐůĞƐƌĞŵŽǀĞĚĨƌŽŵƚŚĞƌŽĂĚ͖Žƌ ͻϱϰϵ͕ϭϬϮŵŝůĞƐŶŽƚĚƌŝǀĞŶďǇĂŶĂǀĞƌĂŐĞƐŝǌĞǀĞŚŝĐůĞ͘ Eyd^dW^ EĞǆƚƐƚĞƉƐŝŶĐůƵĚĞƌĞǀŝĞǁďǇt^ĂŶĚƚŚĞŝƚǇŽĨZĞŶƚŽŶĨŽƌĂƉƉƌŽǀĂůŽĨƚŚŝƐ ^WĂŶĚ/'͘hƉŽŶĂƉƉƌŽǀĂů͕DĐ<ŝŶƐƚƌǇĐĂŶƐƚĂƌƚĞƐŝŐŶĂŶĚŽŶƐƚƌƵĐƚŝŽŶŽĨƚŚĞ ĂƉƉƌŽǀĞĚ&/D͛Ɛ͘ ϭ͘ϱDĐ<ŝŶƐƚƌǇŝĨĨĞƌĞŶƚŝĂƚŽƌƐ KDWEzKsZs/t DĐ<ŝŶƐƚƌǇŚĂƐŽǀĞƌϱϬǇĞĂƌƐŽĨĞǆƉĞƌŝĞŶĐĞĂƐƐĞƐƐŝŶŐĂŶĚŝŵƉƌŽǀŝŶŐĨĂĐŝůŝƚŝĞƐŝŶ ƚŚĞWĂĐŝĨŝĐEŽƌƚŚǁĞƐƚ͘tŝƚŚŵŽƌĞƚŚĂŶϭ͕ϱϬϬƐƵĐĐĞƐƐĨƵůĞŶĞƌŐǇĂŶĚĨĂĐŝůŝƚǇ ŝŵƉƌŽǀĞŵĞŶƚƉƌŽũĞĐƚƐĐŽŵƉůĞƚĞĚŝŶƚŚĞƉĂƐƚϭϱǇĞĂƌƐ͕DĐ<ŝŶƐƚƌǇŚĂƐƚŚĞ ĞǆƉĞƌƚŝƐĞƚŽŽĨĨĞƌĐŽŵƉƌĞŚĞŶƐŝǀĞƐŽůƵƚŝŽŶƐƚŽƚŚĞŝƚǇŽĨZĞŶƚŽŶ͘DĐ<ŝŶƐƚƌǇŝƐ ŵŽƌĞƚŚĂŶũƵƐƚĂŶŽƚŚĞƌĞŶĞƌŐǇƐĞƌǀŝĐĞƐĐŽŵƉĂŶǇ͕ǁĞďĞůŝĞǀĞŝŶƐĞƌǀŝŶŐĂƐǇŽƵƌ ƚƌƵƐƚĞĚĂĚǀŝƐŽƌ͞&ŽƌƚŚĞ>ŝĨĞŽĨzŽƵƌƵŝůĚŝŶŐ͘͟ D</E^dZzWWZK,sEd'^ ͻsĞŶĚŽƌͲĂŶĚƉƌŽĚƵĐƚͲŶĞƵƚƌĂůĨŽƌƚƌƵůǇĐŽŶƐƵůƚĂƚŝǀĞƌŽůĞ ͻdƌĂŶƐƉĂƌĞŶƚƉƌŝĐŝŶŐ ͻdŽƚĂůĐŽƐƚŽĨŽǁŶĞƌƐŚŝƉĐŽŶƐŝĚĞƌĂƚŝŽŶ ͻEŽ͞ƐŚĂƌĞĚƐĂǀŝŶŐƐ͟ŵŽĚĞů KDWEzdͲͲ'>E •ƐƚĂďůŝƐŚĞĚϭϵϲϬ •KǀĞƌϮ͕ϬϬϬĞŵƉůŽǇĞĞƐ •ϮϯŽĨĨŝĐĞƐ •ϱϱнWƌŽĨĞƐƐŝŽŶĂůŶŐŝŶĞĞƌƐ •ϴϬн>ĐĐƌĞĚŝƚĞĚWƌŽĨĞƐƐŝŽŶĂůƐ D</E^dZzyWZ/E ΨϮϬŵŝůůŝŽŶ ƵƐƚŽŵĞƌƵƚŝůŝƚǇ ƐĂǀŝŶŐƐ ŐƵĂƌĂŶƚĞĞĚ ΨϭϬϬŵŝůůŝŽŶ 'ƌĂŶƚƐΘ ƌĞďĂƚĞƐƐĞĐƵƌĞĚ ĨŽƌĐůŝĞŶƚƐ ϲϯϲŵŝůůŝŽŶ<ŝůŽǁĂƚƚŚŽƵƌƐ ƐĂǀĞĚ ϰϱϯ ƚŚŽƵƐĂŶĚ DĞƚƌŝĐƚŽŶƐŽĨ KϮƐĂǀĞĚ ϵϭŵŝůůŝŽŶ'ĂƐdŚĞƌŵƐ ƐĂǀĞĚ KϮĞŵŝƐƐŝŽŶƌĞĚƵĐƚŝŽŶƐƌĞƐƵůƚŝŶŐ ĨƌŽŵDĐ<ŝŶƐƚƌǇƉƌŽũĞĐƚƐŚĂǀĞ ĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƐĞƋƵĂůƚŽ͗ ϯ͕ϭϲϳĂĐƌĞƐ &ŽƌĞƐƚĂĐƌĞƐ ƐĂǀĞĚĨƌŽŵ ĚĞƐƚƌƵĐƚŝŽŶ ϱϭ͘ϱŵŝůůŝŽŶ'ĂůůŽŶƐŽĨŐĂƐ ŶŽƚƵƐĞĚ ϴϯн ƚŚŽƵƐĂŶĚ ĂƌƐƚĂŬĞŶŽĨĨ ƚŚĞƌŽĂĚ ϰϬн ƚŚŽƵƐĂŶĚ ,ŽŵĞƐƚĂŬĞŶŽĨĨ ƚŚĞƉŽǁĞƌŐƌŝĚ AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ^ĐŽƉĞŽĨtŽƌŬ Ϯ͘ϭ&ĂĐŝůŝƚǇ/ŵƉƌŽǀĞŵĞŶƚDĞĂƐƵƌĞ;&/DͿ>ŝƐƚ &ŽƌĨƵůůĚĞƐĐƌŝƉƚŝŽŶƐŽĨƚŚĞƐĐŽƉĞŽĨǁŽƌŬŽĨĞĂĐŚŵĞĂƐƵƌĞ͕ƉůĞĂƐĞƌĞĨĞƌƚŽ^ĞĐƚŝŽŶϮͲĞƚĂŝůĞĚ^ĐŽƉĞŽĨtŽƌŬ͘ Ϭϭ͘ϬϭͲZ,͗hƉŐƌĂĚĞŽŝůĞƌƐ͕WƵŵƉƐĂŶĚ^ƚŽƌĂŐĞdĂŶŬƐ Ϭϯ͘ϬϰͲZ,͗hƉŐƌĂĚĞ/dZŽŽŵŽŽůŝŶŐ Ϭϵ͘ϬϭͲW'͗hƉŐƌĂĚĞ>ŝŐŚƚŝŶŐƚŽ> ϮϬ͘ϬϭͲZ,͗hƉŐƌĂĚĞ&ŝƌĞWƵŵƉ ϭϭ͘ϬϭͲZ,͗hƉŐƌĂĚĞƵŝůĚŝŶŐ'ĞŶĞƌĂƚŽƌ Ϯ͘ϮDĐ<ŝŶƐƚƌǇ^ĞƌǀŝĐĞƐ DĐ<ŝŶƐƚƌǇǁŝůůŝŶĐůƵĚĞƚŚĞĨŽůůŽǁŝŶŐƐĞƌǀŝĐĞƐƌĞůĂƚĞĚƚŽƚŚŝƐƉƌŽũĞĐƚ͗ ϭ͘ŶĞƌŐǇƵĚŝƚ͗ dŚĞĞŶĞƌŐǇĂƵĚŝƚŝƐĐŽŵƉůĞƚĞĂŶĚŝƐƐƵďŵŝƚƚĞĚƵŶĚĞƌ^ĞĐƚŝŽŶϱʹŝƌĞĐƚĞĚŶŐŝŶĞĞƌŝŶŐ^ƚƵĚǇ͘ Ϯ͘ĞƐŝŐŶ^ĞƌǀŝĐĞƐ͗ DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞĂĚĞƚĂŝůĞĚĞŶŐŝŶĞĞƌŝŶŐĚĞƐŝŐŶĂƐŶĞĞĚĞĚƚŽŽďƚĂŝŶƉĞƌŵŝƚƚŝŶŐ͕KǁŶĞƌƌĞǀŝĞǁ͕ĂŶĚ ĂƉƉƌŽǀĂůŽĨƚŚĞƉƌŽƉŽƐĞĚƐǇƐƚĞŵƐ͘/ŶĂĚĚŝƚŝŽŶ͕DĐ<ŝŶƐƚƌǇǁŝůůĂůƐŽƉƌŽǀŝĚĞĐŽŶƐƚƌƵĐƚŝŽŶƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐ͕ ƐƚĂƌƚͲƵƉ͕ƚĞƐƚŝŶŐ͕ĂƐͲďƵŝůƚĚƌĂǁŝŶŐƐŽĨƐǇƐƚĞŵƐŝŶƐƚĂůůĞĚ͕ĂŶĚƉƌŽǀŝĚĞŽƉĞƌĂƚŝŽŶƐĂŶĚŵĂŝŶƚĞŶĂŶĐĞŵĂŶƵĂůƐ͘ ϯ͘ŽŶƐƚƌƵĐƚŝŽŶ͗ WƌŽǀŝĚĞ͕ŽƌĐĂƵƐĞƚŽďĞƉƌŽǀŝĚĞĚ͕ĂůůŵĂƚĞƌŝĂů͕ůĂďŽƌ͕ĂŶĚĞƋƵŝƉŵĞŶƚ͕ŝŶĐůƵĚŝŶŐƉĂǇŝŶŐĨŽƌƉĞƌŵŝƚƐ͕ĨĞĞƐ͕ ďŽŶĚƐ͕ĂŶĚŝŶƐƵƌĂŶĐĞ͕ƌĞƋƵŝƌĞĚĨŽƌƚŚĞĐŽŵƉůĞƚĞĂŶĚǁŽƌŬŝŶŐŝŶƐƚĂůůĂƚŝŽŶŽĨDĐ<ŝŶƐƚƌǇ͛ƐĞƋƵŝƉŵĞŶƚ͘ Ă͘DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞĂƐŝƚĞƐƵƉĞƌŝŶƚĞŶĚĞŶƚǁŚŽǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌƚŚĞŽŶƐŝƚĞƐƵƉĞƌǀŝƐŝŽŶ ĂŶĚĐŽŽƌĚŝŶĂƚŝŽŶŽĨƚƌĂĚĞƐĂŶĚƐƵďĐŽŶƚƌĂĐƚŽƌƐ͘dŚŝƐŝŶĚŝǀŝĚƵĂů͛ƐƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐǁŝůůĂůƐŽŝŶĐůƵĚĞ ƌĞŐƵůĂƌǁŽƌŬŽďƐĞƌǀĂƚŝŽŶƐ͕ƋƵĂůŝƚǇĐŽŶƚƌŽů͕ƐŝƚĞƐĞĐƵƌŝƚǇ͕ĞŶĨŽƌĐĞŵĞŶƚŽĨƚŚĞƐŝƚĞͲƐƉĞĐŝĨŝĐƐĂĨĞƚǇ ƉůĂŶ͕ĂƐǁĞůůĂƐĐŽŽƌĚŝŶĂƚŝŶŐĂŶǇŝŵƉĂĐƚƵƉŽŶďƵŝůĚŝŶŐƚĞŶĂŶƚƐǁŝƚŚƚŚĞKǁŶĞƌ͘ ď͘DĐ<ŝŶƐƚƌǇŵĂǇƉĞƌĨŽƌŵƉŽƌƚŝŽŶƐŽĨƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶǁŽƌŬŽƌŵĂǇƐƵďĐŽŶƚƌĂĐƚƉŽƌƚŝŽŶƐƚŽ ƋƵĂůŝĨŝĞĚĨŝƌŵƐ͘/ŶĞŝƚŚĞƌĐĂƐĞ͕DĐ<ŝŶƐƚƌǇǁŝůůƐŚĂƌĞŝŶĨŽƌŵĂƚŝŽŶƌĞŐĂƌĚŝŶŐĂĐƚƵĂůĐŽƐƚƐŽĨƚŚĞ ǁŽƌŬǁŝƚŚƚŚĞKǁŶĞƌĂŶĚ^͘ Đ͘tŚĞŶDĐ<ŝŶƐƚƌǇŚĂƐĐŽŵƉůĞƚĞĚƚŚĞŝŶƐƚĂůůĂƚŝŽŶŽĨƚŚĞĞƋƵŝƉŵĞŶƚ͕ŝŶĐůƵĚŝŶŐƐƚĂƌƚͲƵƉ͕ŽƉĞƌĂƚŝŽŶƐ ǀĞƌŝĨŝĐĂƚŝŽŶ͕ĂŶĚƚƌĂŝŶŝŶŐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞWƌŽƉŽƐĂů͕DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞƚŽKǁŶĞƌĂŶĚ ^Ă͞EŽƚŝĐĞŽĨŽŵŵĞŶĐĞŵĞŶƚŽĨŶĞƌŐǇ^ĂǀŝŶŐƐ͘͟ Ě͘ƚƚŚĞĐŽŶĐůƵƐŝŽŶŽĨƚŚĞƉƌŽũĞĐƚ͕DĐ<ŝŶƐƚƌǇǁŝůůƐƵďŵŝƚĂ͞EŽƚŝĐĞŽĨ^ƵďƐƚĂŶƚŝĂůŽŵƉůĞƚŝŽŶ͟ƚŽ ƚŚĞKǁŶĞƌĂŶĚ^͘ ϰ͘ŽŶƐƚƌƵĐƚŝŽŶDĂŶĂŐĞŵĞŶƚ͗ DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞĂĚĞĚŝĐĂƚĞĚĐŽŶƐƚƌƵĐƚŝŽŶŵĂŶĂŐĞƌǁŚŽǁŝůůƉƌŽǀŝĚĞĐŽŶƚƌĂĐƚĂĚŵŝŶŝƐƚƌĂƚŝŽŶƐĞƌǀŝĐĞƐ ĨŽƌƚŚĞƉƌŽũĞĐƚ͘dŚĞŽǁŶĞƌŝƐĞǆƉĞĐƚĞĚƚŽĐŽŽƌĚŝŶĂƚĞĚĂǇͲƚŽͲĚĂǇĐŽŵŵƵŶŝĐĂƚŝŽŶƐǁŝƚŚƚĞŶĂŶƚƐĂŶĚĂŶǇ ƐĐŚĞĚƵůŝŶŐŽĨƚĞŶĂŶƚƌĞůŽĐĂƚŝŽŶƐŝŶĂŶĚĂƌŽƵŶĚŽĐĐƵƉŝĞĚĂƌĞĂƐ͘ ϱ͘KƉĞƌĂƚŝŽŶdƌĂŝŶŝŶŐ͗ DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞƌĞůĞǀĂŶƚƚƌĂŝŶŝŶŐŽĨďƵŝůĚŝŶŐƐƚĂĨĨĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶĂƐĂŐƌĞĞĚƚŽďǇƚŚĞKǁŶĞƌĂŶĚ ^͘ AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ^ĐŽƉĞŽĨtŽƌŬ ϲ͘WĞƌĨŽƌŵĂŶĐĞDĂŝŶƚĞŶĂŶĐĞ͗ DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞŽŶŐŽŝŶŐŵŽŶŝƚŽƌŝŶŐĂŶĚƐƵƉƉŽƌƚƐĞƌǀŝĐĞƐƚŽŚĞůƉĞŶƐƵƌĞƚŚĂƚŐƵĂƌĂŶƚĞĞĚƐĂǀŝŶŐƐĂƌĞ ĂĐŚŝĞǀĞĚƚŚƌŽƵŐŚŽƵƚƚŚĞƚĞƌŵŽĨƚŚĞĂŐƌĞĞŵĞŶƚ͘KŶŐŽŝŶŐƐĞƌǀŝĐĞƐƐŚĂůůďĞƵŶĚĞƌƐĞƉĂƌĂƚĞĂŐƌĞĞŵĞŶƚ͘ KŶŐŽŝŶŐƐĞƌǀŝĐĞƐƐŚĂůůďĞĂƚƚŚĞĚŝƐĐƌĞƚŝŽŶŽĨƚŚĞKǁŶĞƌĂŶĚ^ƚŽƚĞƌŵŝŶĂƚĞ͘^ƉĞĐŝĨŝĐƚĂƐŬƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚ ƉƌŽƉŽƐĞĚŽŶŐŽŝŶŐDĞĂƐƵƌĞŵĞŶƚĂŶĚsĞƌŝĨŝĐĂƚŝŽŶ;DΘsͿĐĂŶďĞĨŽƵŶĚŝŶdĂďůĞϯ͘ϮͲDΘsWůĂŶKƵƚůŝŶĞ͘ &ŽƌƚŚŝƐƉƌŽũĞĐƚ͕DĐ<ŝŶƐƚƌǇŚĂƐƌĞĐŽŵŵĞŶĚĞĚĂŶŝŶŝƚŝĂůDΘsƚĞƌŵŽĨŽŶĞǇĞĂƌƚŽƚŚĞKǁŶĞƌĂŶĚ^͘dŚĞ ƌĞĂƐŽŶŝƐƚŚĂƚƚŚĞĞĨĨŝĐŝĞŶĐǇŽĨƚŚĞƉƌŽƉŽƐĞĚĞƋƵŝƉŵĞŶƚŝƐŶŽƚĞǆƉĞĐƚĞĚƚŽĐŚĂŶŐĞĂĨƚĞƌƚŚĞĨŝƌƐƚǇĞĂƌŽĨ ƉĞƌĨŽƌŵĂŶĐĞŚĂƐďĞĞŶǀĞƌŝĨŝĞĚ͘ ϳ͘ƋƵŝƉŵĞŶƚDĂŝŶƚĞŶĂŶĐĞ͗ DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞŶŽĞƋƵŝƉŵĞŶƚŵĂŝŶƚĞŶĂŶĐĞŽƌƌĞƉĂŝƌƐĂĨƚĞƌƚŚĞǁĂƌƌĂŶƚǇƉĞƌŝŽĚ͘&ŽůůŽǁŝŶŐƚŚĞ ĐŽŵƉůĞƚŝŽŶŽĨƚŚĞŝŶƐƚĂůůĂƚŝŽŶĂŶĚKǁŶĞƌĂĐĐĞƉƚĂŶĐĞŽĨƚŚĞĞƋƵŝƉŵĞŶƚ͕ƚŚĞKǁŶĞƌƐŚĂůůƉƌŽǀŝĚĞĂůů ŶĞĐĞƐƐĂƌǇƐĞƌǀŝĐĞ͕ƌĞƉĂŝƌƐ͕ĂŶĚĂĚũƵƐƚŵĞŶƚƐƚŽƚŚĞĞƋƵŝƉŵĞŶƚƐŽƚŚĂƚƚŚĞĞƋƵŝƉŵĞŶƚǁŝůůƉĞƌĨŽƌŵŝŶƚŚĞ ŵĂŶŶĞƌĂŶĚƚŽƚŚĞĞǆƚĞŶƚƐĞƚĨŽƌƚŚŝŶƚŚĞWƌŽƉŽƐĂů͘DĐ<ŝŶƐƚƌǇƐŚĂůůŚĂǀĞŶŽŽďůŝŐĂƚŝŽŶƚŽƐĞƌǀŝĐĞŽƌŵĂŝŶƚĂŝŶ ƚŚĞĞƋƵŝƉŵĞŶƚĂĨƚĞƌƚŚĞǁĂƌƌĂŶƚǇƉĞƌŝŽĚ͘ ϴ͘tĂƌƌĂŶƚǇ͗ DĐ<ŝŶƐƚƌǇǁŝůůǁĂƌƌĂŶƚĞƋƵŝƉŵĞŶƚĨŽƌŽŶĞǇĞĂƌĨŽůůŽǁŝŶŐEŽƚŝĐĞŽĨŽŵŵĞŶĐĞŵĞŶƚŽĨŶĞƌŐǇ^ĂǀŝŶŐƐ͘ ^ƉĞĐŝĨŝĐŝŶĨŽƌŵĂƚŝŽŶƌĞŐĂƌĚŝŶŐĞƋƵŝƉŵĞŶƚǁĂƌƌĂŶƚǇǁŝůůďĞƉĂƐƐĞĚŽŶƚŽŽǁŶĞƌ͘ Ϯ͘ϯǆƚĞŶƚŽĨ^ƵďĐŽŶƚƌĂĐƚŝŶŐ DĐ<ŝŶƐƚƌǇŵĂǇƐƵďĐŽŶƚƌĂĐƚƚŚĞĞŶĞƌŐǇĂƵĚŝƚ͕ĚĞƐŝŐŶ͕ĐŽŶƐƚƌƵĐƚŝŽŶŵĂŶĂŐĞŵĞŶƚ͕ƐƚĂƌƚͲƵƉ͕ĂŶĚƚƌĂŝŶŝŶŐƉŽƌƚŝŽŶƐ ŽĨƚŚŝƐŽŶƚƌĂĐƚƚŽƋƵĂůŝĨŝĞĚĨŝƌŵƐƵƉŽŶƌĞǀŝĞǁĂŶĚĂƉƉƌŽǀĂůďǇŽǁŶĞƌ͘ŽŶƐƚƌƵĐƚŝŽŶƐƵďĐŽŶƚƌĂĐƚƐǁŝůůďĞ ĂǁĂƌĚĞĚĐŽŵƉĞƚŝƚŝǀĞůǇ͘DĐ<ŝŶƐƚƌǇǁŝůůĞŶĚĞĂǀŽƌƚŽƐĂƚŝƐĨǇƚŚĞŝǀĞƌƐĞƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞƵƚŝůŝǌĂƚŝŽŶŐŽĂůƐŽĨƚŚĞ KǁŶĞƌĂŶĚ^͘ Ϯ͘ϰWƌŽũĞĐƚ^ĐŚĞĚƵůĞ dŚĞƉƌŽƉŽƐĞĚĚĞƐŝŐŶĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶĚƵƌĂƚŝŽŶŝƐϰϭϬĐĂůĞŶĚĂƌĚĂǇƐ͘DĐ<ŝŶƐƚƌǇǁŝůůĚĞǀĞůŽƉĂĚĞƚĂŝůĞĚƐĐŚĞĚƵůĞ ŽƵƚůŝŶŝŶŐĂůůŽĨƚŚĞǀĂƌŝŽƵƐĚĞƐŝŐŶ͕ƉƌĞͲĐŽŶƐƚƌƵĐƚŝŽŶ͕ĐŽŶƐƚƌƵĐƚŝŽŶ͕ĂŶĚĐůŽƐĞŽƵƚƚĂƐŬƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞƉƌŽũĞĐƚ ĂŶĚƚŚĂƚŝŶƚĞƌĨĂĐĞƐǁŝƚŚŽƚŚĞƌĐŽŶƐƚƌƵĐƚŝŽŶǁŽƌŬŶŽƚƵŶĚĞƌƚŚŝƐƉƌŽƉŽƐĂů͘ƉƌĞůŝŵŝŶĂƌǇƐĐŚĞĚƵůĞĨŽůůŽǁƐ͘ AGENDA ITEM #5. d) ,'7DVN1DPH 'XUDWLRQ 6WDUW )LQLVK 3UHGHFHVVRUV 5HVRXUFH1DPHV ZĞŶƚŽŶZ, ŽŶƚƌĂĐƚ ϳϴĚĂǇƐ DŽŶϮͬϭϬͬϮϬ dŚƵϱͬϮϴͬϮϬ ĞǀĞůŽƉ^W ϳǁŬƐ DŽŶϮͬϭϬͬϮϬ &ƌŝϯͬϮϳͬϮϬ ĞůŝǀĞƌ^WƚŽůŝĞŶƚ ϭϴĚĂǇƐ DŽŶϯͬϯϬͬϮϬ tĞĚϰͬϮϮͬϮϬ ϯ KǁŶĞƌ^WZĞǀŝĞǁ ϮǁŬƐ dŚƵϰͬϮϯͬϮϬ tĞĚϱͬϲͬϮϬ ϰ ŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚ ϯǁŬƐ dŚƵϱͬϳͬϮϬ dŚƵϱͬϮϴͬϮϬ ϱ EdW ϬĚĂǇƐ dŚƵϱͬϮϴͬϮϬ dŚƵϱͬϮϴͬϮϬ ϲ ĞƐŝŐŶ ϳϬĚĂǇƐ &ƌŝϱͬϮϵͬϮϬ dŚƵϵͬϯͬϮϬ ĞƐŝŐŶZĞǀŝĞǁƌĂǁŝŶŐƐ ϴǁŬƐ &ƌŝϱͬϮϵͬϮϬ dŚƵϳͬϮϯͬϮϬ ϳ KǁŶĞƌĞƐŝŐŶZĞǀŝĞǁ ϮǁŬƐ &ƌŝϳͬϮϰͬϮϬ dŚƵϴͬϲͬϮϬ ϵ &ŝŶĂůĞƐŝŐŶƌĂǁŝŶŐƐ ϰǁŬƐ &ƌŝϴͬϳͬϮϬ dŚƵϵͬϯͬϮϬ ϭϬ WƌĞĐŽŶƐƚƌƵĐƚŝŽŶ ϵϴĚĂǇƐ dƵĞϭϬͬϮϬͬϮϬ dƵĞϯͬϵͬϮϭ KǁŶĞƌZĞǀŝĞǁŽĨ^WZĞǀŝƐŝŽŶϮZĞǀŝĞǁ ϭϰĚĂǇƐ dƵĞϭϬͬϮϬͬϮϬ &ƌŝϭϭͬϲͬϮϬ ZĞǀŝƐŝŽŶŽĨ^ŽŶƚƌĂĐƚ ϯϬĚĂǇƐ DŽŶϭϭͬϵͬϮϬ dƵĞϭϮͬϮϮͬϮϬ ϭϯ EdWŽĨŽŶƐƚƌƵĐƚŝŽŶ ϭϰĚĂǇƐ tĞĚϭϮͬϮϯͬϮϬ dƵĞϭͬϭϮͬϮϭ ϭϰ ^ƵďŵŝƚƚĂůƐ ϮǁŬƐ tĞĚϭͬϭϯͬϮϭ dƵĞϭͬϮϲͬϮϭ ϭϱ ^ƵďĐŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚ ϯǁŬƐ tĞĚϭͬϭϯͬϮϭ dƵĞϮͬϮͬϮϭ ϭϱ WůĂŶZĞǀŝĞǁĂŶĚWĞƌŵŝƚ ϲǁŬƐ tĞĚϭͬϭϯͬϮϭ dƵĞϮͬϮϯͬϮϭ ϭϱ Z,ƋƵŝƉŵĞŶƚWƌŽĐƵƌĞŵĞŶƚ ϲǁŬƐ tĞĚϭͬϮϳͬϮϭ dƵĞϯͬϵͬϮϭ ϭϲ ŽŶƐƚƌƵĐƚŝŽŶ ϱϲĚĂǇƐ tĞĚϯͬϭϬͬϮϭ tĞĚϱͬϮϲͬϮϭ DŽďŝůŝǌĂƚŝŽŶ ϭĚĂǇ tĞĚϯͬϭϬͬϮϭ tĞĚϯͬϭϬͬϮϭ ϭϴ͕ϭϳ͕ϭϵ Z,ͲŽŝůĞƌZĞƉůĂĐĞŵĞŶƚ ϯǁŬƐ dŚƵϯͬϭϭͬϮϭ tĞĚϯͬϯϭͬϮϭ ϭϵ͕Ϯϭ ŝƚǇĞŶƚĞƌ'ĂƌĂŐĞͲ>>ŝŐŚƚŝŶŐ ϯǁŬƐ dŚƵϯͬϭϭͬϮϭ tĞĚϯͬϯϭͬϮϭ ϭϵ͕Ϯϭ Z,ͲhƉŐƌĂĚĞ/dZŽŽŵŽŽůŝŶŐ ϮǁŬƐ dŚƵϰͬϭͬϮϭ tĞĚϰͬϭϰͬϮϭ ϮϮ Z,Ͳ&ŝƌĞWƵŵƉ ϰǁŬƐ dŚƵϰͬϭͬϮϭ tĞĚϰͬϮϴͬϮϭ Ϯϰ^^ Z,Ͳ'ĞŶĞƌĂƚŽƌ ϲǁŬƐ dŚƵϰͬϭϱͬϮϭ tĞĚϱͬϮϲͬϮϭ Ϯϰ ůŽƐĞŽƵƚ ϯϬĚĂǇƐ tĞĚϱͬϮϲͬϮϭ tĞĚϳͬϳͬϮϭ ^ƵďƐƚĂŶƚŝĂůŽŵƉůĞƚŝŽŶ ϬĚĂǇƐ tĞĚϱͬϮϲͬϮϭ tĞĚϱͬϮϲͬϮϭ Ϯϲ ůŽƐĞŽƵƚŽĐƵŵĞŶƚƐ ϯϬĚĂǇƐ dŚƵϱͬϮϳͬϮϭ tĞĚϳͬϳͬϮϭ Ϯϴ &ŝŶĂůŽŵƉůĞƚŝŽŶ ϬĚĂǇƐ tĞĚϳͬϳͬϮϭ tĞĚϳͬϳͬϮϭ Ϯϵ ϱͬϮϴ ϱͬϮϲ ϳͬϳ )HE 0DU $SU 0D\ -XQ -XO $XJ 6HS 2FW 1RY 'HF -DQ )HE 0DU $SU 0D\ -XQ -XO 7DVN 6SOLW 0LOHVWRQH 6XPPDU\ 3URMHFW6XPPDU\ ,QDFWLYH7DVN ,QDFWLYH0LOHVWRQH ,QDFWLYH6XPPDU\ 0DQXDO7DVN 'XUDWLRQRQO\ 0DQXDO6XPPDU\5ROOXS 0DQXDO6XPPDU\ 6WDUWRQO\ )LQLVKRQO\ ([WHUQDO7DVNV ([WHUQDO0LOHVWRQH 'HDGOLQH 3URJUHVV 0DQXDO3URJUHVV WĂŐĞϭ WƌŽũĞĐƚ͗ZĞŶƚŽŶZĂŶĚZ,ϮϬϮ ĂƚĞ͗dƵĞϭϬͬϮϬͬϮϬ AGENDA ITEM #5. d) Page 12 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) WƌŽũĞĐƚEĂŵĞ͗ŝƚǇŽĨZĞŶƚŽŶͲŝƚǇƵŝůĚŝŶŐƐ ĂƚĞ͗ϰͬϮϮͬϮϬϮϬ dĂƐŬ ĞƉƚϰϬϬ DĞĐŚĂŶŝĐĂů ŽŶƚƌŽůƐ ůĞĐƚƌŝĐĂů DĞĐŚĂŶŝĐĂů ŽŶƚƌŽůƐ ůĞĐƚƌŝĐĂů WŝƉŝŶŐ ŽŝůĞƌ y y WƵŵƉƐ y y ŝƌͬŝƌƚ^ĞƉĂƌĂƚŽƌ yy ǆƉĂŶƐŝŽŶdĂŶŬƐ y y ŚĞŵŝĐĂůWŽƚ&ĞĞĚĞƌ y y sŝďƌĂƚŝŽŶ/ƐŽůĂƚŝŽŶΘ^ĞŝƐŵŝĐ^ƵƉƉŽƌƚƐ y y ^ƚƌƵĐƚƵƌĂů^ƵƉƉŽƌƚƐ y y WŝƉĞ͕ǀĂůǀĞƐ͕ĨŝƚƚŝŶŐƐ͕ĂŶĚĂůůĂƉƉƵƌƚĂŶĐĞƐ;ĨŽƌĞƋƵŝƉŵĞŶƚĐŽŶŶĞĐƚŝŽŶƐͿ y y ,ŽƚdĂƉƐ yy ŽŶƚƌŽůsĂůǀĞƐŝĨƌĞƋƵŝƌĞĚ y y dĞƐƚ͕&ůƵƐŚĂŶĚ&ŝůů^ǇƐƚĞŵ y ĞŵŽůŝƚŝŽŶĂƐƌĞƋƵŝƌĞĚ y WĞƌŵŝƚƐͲƉĂǇĂŶĚƉŝĐŬƵƉ y ƌǇƐŝĚĞ ^Ɖůŝƚ^ǇƐƚĞŵ&ĂŶŽŝůhŶŝƚƐĂŶĚĂƐƐŽĐŝĂƚĞĚŽŶĚĞŶƐŝŶŐhŶŝƚƐ y y &ĂŶƐ y y ^ŵŽŬĞ^ĞŶƐŽƌ y y ůĂŶŬŽĨĨWĂŶĞůƐ y y ŽŶƐƚĂŶƚŝƌZĞŐƵůĂƚŽƌ yy ŽŝůĞƌ&ůƵĞ y y ŝƌŝƐƚƌŝďƵƚŝŽŶŝŶĐůƵĚŝŶŐůŽƵǀĞƌƐ y y ŽŶƚƌŽůĂŵƉĞƌƐŝĨƌĞƋƵŝƌĞĚ y y sŝďƌĂƚŝŽŶ/ƐŽůĂƚŝŽŶΘ^ĞŝƐŵŝĐ^ƵƉƉŽƌƚƐ y y ^ƚƌƵĐƚƵƌĂů^ƵƉƉŽƌƚ ĞŵŽůŝƚŝŽŶĂƐƌĞƋƵŝƌĞĚ y y WĞƌŵŝƚƐͲƉĂǇĂŶĚƉŝĐŬƵƉ y WůƵŵďŝŶŐ ŽŵĞƐƚŝĐtĂƚĞƌ,ĞĂƚĞƌƐ yy ůĞĐƚƌŽŶŝĐdŚĞƌŵŽƐƚĂƚŝĐDŝǆŝŶŐsĂůǀĞ y y ĞŵŽůŝƚŝŽŶĂƐƌĞƋƵŝƌĞĚ y WĞƌŵŝƚƐͲƉĂǇĂŶĚƉŝĐŬƵƉ y ŽŶƚƌŽůƐ >ŽǁsŽůƚĂŐĞtŝƌŝŶŐ yy ŽŶƚƌŽůƋƵŝƉŵĞŶƚ yy ŽŶƚƌŽůsĂůǀĞƐŝĨƌĞƋƵŝƌĞĚ y y ĞŵŽůŝƚŝŽŶĂƐƌĞƋƵŝƌĞĚ y WĞƌŵŝƚƐͲƉĂǇĂŶĚƉŝĐŬƵƉ y ůĞĐƚƌŝĐĂů ϮϰsĂŶĚŚŝŐŚĞƌƉŽǁĞƌǁŝƌŝŶŐ yy ůĞĐƚƌŝĐĂůƋƵŝƉŵĞŶƚͲƉĂŶĞůƐ͕ďƌĞĂŬĞƌƐ͕ĞƚĐ͘ y y s&ΖƐ yy ϯϬĂǇDĞƚĞƌŝŶŐĂƐƌĞƋƵŝƌĞĚ yy ĞŵŽůŝƚŝŽŶĂƐƌĞƋƵŝƌĞĚ y WĞƌŵŝƚƐͲƉĂǇĂŶĚƉŝĐŬƵƉ y /ŶƐƵůĂƚŝŽŶ y ŚĞŵŝĐĂůdƌĞĂƚŵĞŶƚ y ŽŶƚƌŽůƐ y ůĞĐƚƌŝĐĂů y dΘͬǆ y ŽŶĐƌĞƚĞ y ŽŶĐƌĞƚĞ^ĐĂŶŶŝŶŐ;ǁŚĞƌĞŝƚĂƉƉůŝĞƐͿ y ĞŵŽůŝƚŝŽŶ;ŽŶůǇŝĨŶŽƚƐĞůĨƉĞƌĨŽƌŵŝŶŐͿ y ^ƚƌƵĐƚƵƌĂů y &ŝƌĞůĂƌŵ y >ŝŐŚƚŝŶŐ y &ĞŶĐŝŶŐ y 'ĞŶĞƌĂůŽŶƐƚƌƵĐƚŝŽŶtŽƌŬͲtĂůůƐ͕ǆĐĂǀĂƚŝŽŶ͕ĂĐŬĨŝůů͕WĂŝŶƚŝŶŐ͕ĞƚĐ͘ y ZŽŽĨŝŶŐ y WƵƌĐŚĂƐĞ /ŶƐƚĂůů WƌŽũĞĐƚZĞƐƉŽŶƐŝďŝůŝƚǇDĂƚƌŝǆ ^ƵďĐŽŶƚƌĂĐƚ Page 13 of 107 AGENDA ITEM #5. d) Page 14 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ ),0,' $5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV 5HQWRQ&LW\+DOO *(1(5$/ ([LVWLQJ7KHFLW\KDOOLVVHUYHGE\WKUHHKHDWLQJKRWZDWHUERLOHUV7KHVDPHERLOHUV\VWHPDOVRSURYLGHVGRPHVWLFKRWZDWHU '+:IRUWKHORFNHUURRPVDQGVKHOWHU7KLV++:DQG'+:V\VWHPLVDWWKHHQGRILWVVHUYLFHOLIH7KLVPHDVXUHORRNVDW UHSODFLQJWKLVV\VWHPZLWKWZRVHSDUDWH++:DQG'+:V\VWHPV 3URSRVHG8SJUDGHWKH++:ERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJERLOHUV8SJUDGHWKH++:K\GURQLFV\VWHPDQGSURYLGH V\VWHPSXPSV'HPROLVKWKH'+:KHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUVWRUDJHWDQNV3URYLGHWZRKLJKHIILFLHQF\ GRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGHGRPHVWLFZDWHUUHFLUFXODWLQJSXPS'+:ZLOOEHGH FRXSOHGIURPWKHEXLOGLQJ++:ORRS 6&23(2):25.,1&/8'(6 0HFKDQLFDO $'HPR 'HPROLVKWKUHHH[LVWLQJ/RFKLQYDUERLOHUV%%%0%+HDFKGHPROLVKERLOHUVIOXHWKUXZDOO IOXHRSHQLQJVVKDOOEHUHXVHG 'HPROLVKVHFWLRQVRIH[LVWLQJLQVXODWHGK\GURQLFSLSLQJaOIWWRWDO 'HPROLVKH[LVWLQJSXPS&3)/$+3*30)7+'VHUYLQJFRQGHQVHUZDWHUKHDW H[FKDQJHU+;KHDWH[FKDQJHUWRUHPDLQLQVHUYLFH 'HPROLVKSXPS3)/$ò+3VHUYLQJSDUNLQJOHYHOWHUPLQDOXQLWVDQGDVVRFLDWHGFKHPLFDO SRWIHHGHU 'HPROLVKH[LVWLQJDLUVHSDUDWRU$6H[SDQVLRQWDQNVHUYLQJ++:V\VWHP(7VKDOOUHPDLQLQVHUYLFH 'HPROLVKH[LVWLQJGRPHVWLFZDWHUKHDWH[FKDQJHU+;DQGDVVRFLDWHGSXPS&3$03 +3*30)7+' 'HPROLVKH[LVWLQJWZR*$/GRPHVWLFZDWHUVWRUDJHWDQNV6767DQGLQVXODWHGGRPHVWLFZDWHU SLSHIURPWDQNVWRZDOOaOIWWRWDO 'HPROLVKGRPHVWLFZDWHUUHFLUFXODWLQJSXPS&3)/$+3*30)7+' 'HPROLVKH[LVWLQJH[SDQVLRQWDQNVHUYLQJ'+:V\VWHP(7 'HPROLVKGRPHVWLFKRWZDWHUUHFLUFXODWLQJSXPS&3 %1HZ:RUN ,QVWDOOWZR$HUFR$0ERLOHUV%%DQGWKHLULQVWUXPHQWDWLRQRU5LHOOR(TXLSPHQWE\RWKHUV ,QVWDOOWZRERLOHUSXPSV%3%3±7DFRPRGHO95*30)7+'(&0(TXLSPHQW E\RWKHUV )XUQLVKDQGLQVWDOO/&IOXHYHQWWKUXZDOO±UHXVHH[LVWLQJRSHQLQJVaOIWHDFK ,QVWDOOV\VWHPSXPSV33VHUYLQJJDUDJHPRXQWHG$+8¶V±XVH7DFRPRGHO95 *30)7+'(&0(TXLSPHQWE\RWKHUV 3URYLGHLQVXODWHG´KHDWLQJZDWHUSLSLQJaOIWWRWDO ,QVWDOODLUGLUWVHSDUDWRU$69'7&)$HTXLSPHQWE\RWKHUV ,QVWDOOFKHPLFDOSRWIHHGHU&3):HVVHOV&3)7$JDOORQ(TXLSPHQWE\RWKHUV ,QVWDOOWZR*$/FRQGHQVLQJGRPHVWLFZDWHUKHDWHU':+':+39,/$*&/DQG UHFLUFXODWLQJSXPS&3+3(&0(TXLSPHQWE\RWKHUV )XUQLVKDQGLQVWDOO´&39&YHQWIRU':+¶VOIWHDFK ,QVWDOOGRPHVWLFZDWHUH[SDQVLRQWDQN(7$PWURO679&''(TXLSPHQWE\RWKHUV )XUQLVKDQGLQVWDOOHOHFWURQLFWKHUPRVWDWLFPL[LQJYDOYHò´ 3URYLGH´LQVXODWHGVXSSO\GRPHVWLFZDWHUSLSLQJaOIWDQGô´LQVXODWHGZDWHUUHWXUQaOIW )XUQLVKDQGLQVWDOO´JDVOLQHaOIWDQGIRXUJDVUHJXODWRUV([LVWLQJJDVPHWHULVDGHTXDWH &RQWUROV $5HIHUWRDWWDFKHGSRLQWVOLVW (OHFWULFDO $%DVLF6FRSH(OHFWULFDOZRUNDVVRFLDWHGZLWKWKHUHSODFHPHQWRIH[LVWLQJ%RLOHUVDQGDVVRFLDWHGSXPSV %'D\0HWHULQJ,WLVDVVXPHGWKDWWKLVSURMHFWZLOOUHVXOWLQDORDGGHFUHDVH'D\0HWHULQJZLOOQRWEH UHTXLUHG &)RU'HPRDQG1HZ6FRSHSOHDVHUHIHUWR'HPRDQG1HZ(TXLSPHQW6FKHGXOH 6WUXFWXUDO5HSODFLQJJDOORQZDWHUWDQNVZLWKQHZJDOORQZDWHUKHDWHUDQGUHSODFLQJERLOHUVZLWK QHZERLOHUV$OORWKHUPHFKHTXLSPHQWUHSODFHPHQWDUHOLNHIRUOLNH$WWKHILQDOGHVLJQWKHPLGOHYHOVODEZLOOEH FRQILUPHGIRUUHYLVHGLQFRPLQJORDGVDVVRFLDWHZLWKPHFKHTXLSPHQWUHSODFHPHQW 5HIUHVK7&2'DWD 7KLV),0 2SHQ),0LQ7&2 /RDG(QWLUH3URMHFW ,QVWUXFWLRQV 3XVK*HQHUDOWR7&2 3ULQW 5), Page 15 of 107 AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ $%RLOHUV 3URYLGHVHLVPLFDWWDFKPHQWFRQQHFWLRQWRFRQF +.SDG$VVXPHGH[LVWLQJFRQFSDGWRUHPDLQDQGUHXVH %$LUVHSDUDWRU 3URYLGHVHLVPLFFDEOHEUDFHZLWK0(%NLWKXQJWRFRQFVODEDERYH &:DWHUKHDWHUV 3URYLGH46VHLVPLFVWUDSWRH[LVWLQJVWXGZDOOODWHUDOFRQQ 2SWLRQ$3URYLGH8QLVWUXWUDLVHGIUDPHWRVXSSRUWZDWHUKHDWHUPD[LPXPIUDPHKHLJKWLV¶´ 2SWLRQ%3URYLGH´QHZFRQF+.SDG 2SWLRQ&3URYLGHGULSSDQZLWKIRDPXQGHUWKHZDWHUKHDWHU '([SDQVLRQWDQN 3URYLGHVHLVPLFDWWDFKPHQWFRQQHFWLRQWRFRQF +.SDG$VVXPHGH[LVWLQJFRQFSDGWRUHPDLQDQGUHXVH (3XPSV 3URYLGHVHLVPLFDWWDFKPHQWFRQQHFWLRQWRFRQF +.SDG$VVXPHGH[LVWLQJFRQFSDGWRUHPDLQDQGUHXVH )0HFKSLSH3URYLGHVHLVPLFEUDFLQJIRUDOO03WKDWWULJJHUVVHLVPLFEUDFLQJSHUVWUXFWXUDOFRGH$6&(FKDSWHU 3URYLGHVHLVPLFEUDFLQJIRUòJDVOLQHDSSUR[/)7 *&RUHGULOOLQJ 3URYLGHWZR´GLDRSHQLQJVIRU´&39&':+YHQW ,PDJHWKHFRQFZDOOEHIRUHILQDOL]LQJWKHFRUHORFDWLRQ +6SHFLDOLQVSHFWLRQ 3RVWLQVWDOOFRQFUHWHDQFKRUVVSHFLDOSHULRGLFLQVSHFWLRQ (SR[\GRZHO#QHZ+.SDGVSHFLDOSHULRGLFLQVSHFWLRQ 7HVWLQJ$GMXVWLQJDQG%DODQFLQJ7$% $3URYLGHHTXLSPHQWOHYHOWHVWDQGEDODQFH &RPPLVVLRQLQJ $3URYLGHIXQFWLRQDOSHUIRUPDQFHWHVWDQGVWDUWXS 'HPROLWLRQDQG5HPRYDO6SHFLDOW\&RQWUDFWRU $5HIHUWRRWKHUVHFWLRQVIRUGHPRGRQHE\RWKHUFRQWUDFWRUV 7UDLQLQJ $3URYLGHWUDLQLQJDVUHTXLUHGIRUWKLV),0 &/$5,),&$7,216$1'(;&/86,216 3HUIHGHUDODQGVWDWHODZSURMHFWVWKDWLQFOXGHUHQRYDWLRQRUGHPROLWLRQPXVWKDYHDQDVEHVWRVVXUYH\SURYLGHGE\WKH RZQHUUHJDUGOHVVRIZKHQWKHEXLOGLQJZDVEXLOW7KHVXUYH\RQO\QHHGVWRFRYHUWKHDUHDWKDWZLOOEHGLVWXUEHG,IWKH EXLOGLQJRZQHUFDQSURYLGHSURRIWKDWWKHEXLOGLQJZDVFRQVWUXFWHGZLWKDVEHVWRVIUHHPDWHULDOVWKHQQRVXUYH\LV QHHGHG $0F.LQVWU\GRHVQRWH[HFXWHVXEFRQWUDFWVIRUVXUYH\DQGRUDEDWHPHQWRIDVEHVWRVDQGOHDGSDLQW$EDWHPHQWRI DVEHVWRVDQGOHDGSDLQWVKDOOEHWKHUHVSRQVLELOLW\RIWKHEXLOGLQJRZQHUZKRVKDOOFRQWUDFWGLUHFWO\ZLWKTXDOLILHG DEDWHPHQWVSHFLDOLVWV %7KHEXGJHWIRURZQHUFRQWUDFWHGVXUYH\DQGDEDWHPHQWLIDSSOLFDEOHLVVKRZQDVD1RWLQ&RQWUDFW1,&URXJK HVWLPDWHLQ7DEOHIRUUHIHUHQFHRQO\ ,IH[LVWLQJHTXLSPHQWRUFRPSRQHQWVDUHUHXVHGUHSDLUVWRH[LVWLQJDUHQRWLQFOXGHGXQOHVVVSHFLILFDOO\QRWHGLQWKH VFRSHDERYH$WWKLVSRLQWDOORWKHUUHODWHGHTXLSPHQWWKDWKDVEHHQLQVSHFWHGLVRSHUDWLQJSURSHUO\ Page 16 of 107 AGENDA ITEM #5. d) EQUIPMENT TO BE DEMOLISHED 2" DHW HHWS AND R TO AHU'S SERVING JAIL DEMOLITION DO NOT DEMOLISH: - EXPANSION TANK SERVING HHW SYSTEM - HX-2 - BACKFLOW PREVENTORS REFERENCE DEMO ONE LINE DIAGRAM FOR POINTS OF DEMO CONNECTIONS. Page 17 of 107 AGENDA ITEM #5. d) 2" DHW HHWS AND R TO AHU'S SERVING JAIL B-1, -2, BOILERS (E) ET-2, EXPANSION TANK ET-1, DWH EXPANSION TANK BP-1, -2, BOILER PUMPS DWH-1, -2, DOMESTIC WATER HEATERS CP-7, DOMESTIC RE-CIRC PUMP AS-1, AIR SEPARATOR (E) BACKFLOW PREVENTORS MF-1, MAGNETIC FILTER P-1, -2, SYSTEM PUMPS CPF-1, CHEMICAL POT FEEDER NEW WORK 2 1/2" GAS 2" DHWS 3/4" DHW RECIRC 2 1/2" HWS/R FLUE Page 18 of 107 AGENDA ITEM #5. d) CP-5 ST-1 ST-1 DHWS HX-1HWR HWS CP-4 DHW DHW CP-7 BACKFLOW PREVENTORBACKFLOW PREVENTORB-1 B-2 AS-1 DCWS HX-2CP-3 CWR CWS DCWS HWR FROM GARAGE LEVEL AHUS HOT WATER RECIRCULATION CPF HWS TO GARAGE LEVEL AHUS ET-1 ET-2 C -3 CP-HHHHXDHW D W T-1S1S CCP-5CCP T-1 B-3 P-6 RENTON CITY HALL PH2 BOILER ROOM DEMO DIAGRAM B-1 B-2 HWR FROM GARAGE LEVEL AHUS HWS TO GARAGE LEVEL AHUS BP-1BP-2 AS-1BACKFLOW PREVENTORBACKFLOW PREVENTORDCWS ET-2 ET-1 HX-2DWH-2 HOT WATER RECIRCULATION DWH-1 CP-7 P-2 P-1 DHWS CWR CWS CPF-1 MF-1 RENTON CITY HALL PH2 BOILER ROOM NEW WORK DIAGRAM NEW EQUIPMENT IN BLUE Page 19 of 107 AGENDA ITEM #5. d) 20-01-13 Renton City Of, Ph 2 - Demo and New Equipment C:\Users\lizs\Desktop\My Project Docs\RENTON CITY OF, PH 2\GMAX\[20-01-13 Renton City Of Ph 2 - Demo and New Equipment - Rev 2.xlsx]38398-BOILERS & PUMPS 1/28/2020 15:19 Project Name:Renton City Of, Ph 2 Location:Renton City Hall, Boiler Room FIM ID Number:38398 Purpose: Notes:Non-Grant FIM NOTE: BOLD TEXT ON DEMO SCHEDULE INDICATES WORK THAT IS TO BE DEMOLISHED. BOLD TEXT ON NEW SCHEDULE INDICATES NEW WORK. EQUIPMENT TAG DESCRIPTION VOLTAGE POLES HP FLA MCA KVA PANEL/CKT CB CONDUIT AND WIRE (ASSUMED)DISCONNECT MOTOR CONTROLLER CONTROL PANEL B-1 BOILER 120 1 -- 12 15 1.44 PNL P2-1(ASSUMED)REUSE FOR NEW BOILER 20/1P (ASSUMED) REUSE EXISTING 3/4"C-2#12,1#12G FOR NEW BOILER SWITCH -- -- B-2 BOILER 120 1 -- 12 15 1.44 PNL P2-1(ASSUMED) REUSE FOR NEW BOILER 20/1P (ASSUMED) REUSE EXISTING 3/4"C-2#12,1#12G FOR NEW BOILER SWITCH -- -- B-3 BOILER 120 1 -- 12 15 1.44 PNL P2-1(ASSUMED)REUSE FOR NEW PUMP, BP- 1, 20/1P (ASSUMED) REUSE EXISTING 3/4"C-2#12,1#12G FOR NEW BOILER PUMP, BP-1 SWITCH -- -- CP-3 CIRCULATION PUMP 120 1 1 9.3 11.63 1.12 PNL P2-1/1 DEMO 15/1P REUSE EXISTING 3/4"C-2#12,1#12G FOR NEW BOILER PUMP, BP-2 BRKR IN PNL RACK COMBO STARTER -- CP-4 CIRCULATION PUMP 120 1 1.5 12.4 15.5 1.49 PNL P2-1/8 DEMO 15/1P REUSE EXISTING 3/4"C, DEMO 2#12,1#12G, SHALL BE REPLACED FOR NEW SYSTEM PUMP, P-1 BRKR IN PNL RACK COMBO STARTER -- CP-5 CIRCULATION PUMP 120 1 0.2 3.6 4.5 0.43 PNL P2-1/6 DEMO 15/1P REUSE EXISTING 3/4"C, DEMO 2#12,1#12G, SHALL BE REPLACED FOR NEW SYSTEM PUMP, P-2 BRKR IN PNL RACK COMBO STARTER -- CP-7 CIRCULATION PUMP UNKNOWN UNKNOWN UNKNOWN UNKNOWN UNKNOWN UNKNOWN UNKNOWN, ASSUMING PNL P2 UNKNOWN ELECTRICAL INFO UNKNOWN, ASSUMING 3/4"C-2#12,1#12G. RETAIN CONDUIT AND WIRE FOR NEW CIRC PUMP, CP-7 ASSUMING BRKR IN PNL -- -- P-6 CIRCULATION PUMP 120 1 1.5 17 21.3 2.04 PNL P2-1/3 REUSE FOR NEW DWH-1 20/1P REUSE EXISTING 3/4"C-2#12,1#12G FOR NEW DWH-1 SWITCH RELAY -- TOTAL DEMOLISHED LOAD 9.40 EQUIPMENT TAG DESCRIPTION VOLTAGE POLES HP FLA MCA KVA PANEL CB CONDUIT AND WIRE DISCONNECT MOTOR CONTROLLER CONTROL PANEL B-1 BOILER, KN-6 120 1 -- 3.6 4.5 0.432 PNL P2-1 (E)20/1P (E) 3/4"C-2#12,1#12G SWITCH -- B-2 BOILER, KN-6 120 1 -- 3.6 4.5 0.432 PNL P2-1 (E)20/1P (E) 3/4"C-2#12,1#12G SWITCH -- BP-1 BOILER PUMP (ECM) 120 1 -- 7.2 9 0.864 PNL P2-1 (E)20/1P (E) 3/4"C-2#12,1#12G BRKR IN PNL -- -- BP-2 BOILER PUMP (ECM) 120 1 -- 7.2 9 0.864 PNL P2-1 (N) 20/1P (E) 3/4"C-2#12,1#12G BRKR IN PNL -- -- P-1 SYSTEM PUMP FOR DWH (ECM) 120 1 -- 7.2 9 0.864 PNL P2-1 (N) 30/1P (E) 3/4"C (N) 2-#10,1#10G BRKR IN PNL -- -- P-2 SYSTEM PUMP FOR DWH (ECM) 120 1 -- 7.2 9 0.864 PNL P2-1 (N) 30/1P (E)3/4"C (N) 2-#10,1#10G BRKR IN PNL -- -- CP-7 CIRCULATION PUMP (ECM) 120 1 0.17 4.4 5.5 0.528 PNL P2-1 (N) 20/1P (E)3/4"C-2#12,1#12G BRKR IN PNL -- -- DWH-1 DOMESTIC WATER HEATER 120 1 -- 5 6.25 0.6 PNL P2-1 (E)20/1P (E)3/4"C-2#12,1#12G BRKR IN PNL -- -- DWH-2 DOMESTIC WATER HEATER 120 1 -- 5 6.25 0.6 PNL P2-1 (N) 20/1P (N)3/4"C-2#12,1#12G BRKR IN PNL -- -- TOTAL NEW LOAD 3.46 NET LOAD Δ -5.94 KVA LOAD CHANGE The following schedules are intended to be referenced in addition to the Electrical FIM summary. EXISTING NEW EC SHALL PROVIDE (2) NEW EPO SWITCHES FOR BOILER SHUTDOWN. EPO SHALL BE INSTALLED AT EACH EXIT FROM THE ROOM IN WHICH THE BOILERS ARE INSTALLED. Page 20 of 107 AGENDA ITEM #5. d) ),0180%(5(48,30(17/,67 7$* 4W\ 0(&+$1,&$/(/(&75,&$/27+(5 %DQG %RLOHUV !$HUFR$0 !93+ %3DQG%3 %RLOHUSXPSV !7DFR! 3DQG3 6\VWHP3XPSV !7DFR! $6 $LUGLUWVHSDUDWRU !6SLURWKHUP 0)!0DJQHWLF)LOWHU%RLOHU0DJ;7%0;7 ':+DQG 'RPHVWLFZDWHUKHDWHU !39,&RQTXHVW ! &3 !'RPHVWLFZDWHUUHFLUFXODWLRQSXPS% *HFRFLUF;/! (7 !'RPHVWLFZDWHUH[SDQVLRQWDQN$PWURO679&'' &3)!&KHPLFDO3RW)HHGHU:HVVHOV&3)7$ RI Page 21 of 107 AGENDA ITEM #5. d) Technical Data Sheet AM Series Boilers The Advanced Modular (AM) Series represents the latest in high efficien- cy, condensing boiler hydronic technology. The AM series of boilers have a unique modular design that provides exceptional reliability, service- ability, and fuel savings from 399 to 1000 MBTU. Each unit is comprised of between two and four independent thermal modules firing up to 250 MBTU each at up to 5:1 individual turndown. This allows for superior tem- perature control and low-cycling operation. This unique design provides the multiple boiler redundancy required in a boiler plant, but with a single unit installation including a single set of water and gas connections and a single vent connection. When needed, multiple units are easily co-located and common vented to provide a boiler plant with the highest efficiency, turndown, and redundancy in the smallest footprint. Multiple units are sequenced via modbus through a Boiler Management System. High efficiencies and low vent temperatures mean the unit can be vented in PVC, cPVC, Polypropylene, and AL29-4C vent materials. The simple front-access design also means the unit is very simple to maintain and service. The AM Series may also be paired with a storage tank for water heating applications. High turndown means the AM requires a smaller storage tank than traditional water heaters. Features • High Efficiency Condensing Boiler • Natural Gas or Propane • Superior Turndown 8:1 to 20:1 depending on unit • Low NOx Emissions <20ppm • Direct or Conventional Vent with PVC, cPVC, Polypropylene, or AL29-4C materials • Concentric Vent Capability • Common Vent Capability • Side wall common venting with no additional draft dampers • Small, Doorway-Size Footprint • Superior Reliability • Minimal Maintenance • Easy Front Access for Serviceability • Supports Integration to BAS System • Modbus Communication Standard AM 399 through AM 1000 Boilers (AMB) Page 22 of 107 AGENDA ITEM #5. d) Thermal Efficiency Comprehensive tests were conducted to confirm the unit’s efficiency over its entire 50,000 to 1,000,000 BTU/ hr. operating range for a variety of operating conditions. These tests indicate that efficiency up to 99% can be achieved when the unit operates at its lowest firing rate (50,000 BTU/Hr input) with 80°F inlet water tempera- ture. Even at full fire (100% input), the AM Series delivers exceptional efficiency. Ratings *Note: max output varies depending on supply and return water temperatures. Please contact a factory representative for greater details. Unbeatable Reliability and Efficiency The Advanced Modular design uses multiple independent thermal modules for high reliability, high turndown, low cycling, and high efficiency. The on-board controller will automatically cycle lead-lag burners to balance run hours and cycles, as well as stage burners to provide multiple burners at the lowest fire rate. In a condensing boiler low fire rates mean higher efficiency, thus the unit is always running at its most efficient. Integrat- ed check valves and automatic shutoff valves on every module means that if a module is off, no heat is lost through either the flue or water side of that module. The innovative design features on each module add up to an industry-leading unit. For example, the AM 1000B boiler combines four independent 250 MBTU, 5:1 turndown boilers for a total input of 1000 MBTU, but a low fire input of one module at 50 MBTU. This means the unit as a whole has 20:1 turndown and can maintain incredibly tight temperature control with minimal temperature overshoot. Emergency tech service visits are a thing of the past with the AM Series boiler. Each module has its own inde- pendent burner, gas valve, ignition system, flame safeguard, check valve, and automatic water shut-off valve. Model Number Min Input BTU/hr Max Input BTU/hr Max Output BTU/hr Efficiency Range AMB AHRI Efficiency AM 399 50,000 399,000 395,000 up to 99% 93.8% AM 500 50,000 500,000 495,000 up to 99% 93.8% AM 750 50,000 750,000 742,500 up to 99% 93.8% AM 1000 50,000 1,000,000 990,000 up to 99% 93.8% Page 23 of 107 AGENDA ITEM #5. d) If one module were to ever go down, the remaining modules would be available to cover the load until sched- uled maintenance can be performed. The AM series boiler provides all of the advantages of a multiple boiler plant with all of the cost savings and simplicity of a single unit installation. Specifications *For applications with return water temperature >145°F, the design ΔT must be >35°F to allow the use of PVC venting. For further informa- tion contact your local sales representative. AM 399 AM 500 AM 750 AM 1000 Boiler Category IV IV IV IV Gas Connections (NPT)1” 1” 1 ¼” 1 ¼” Max. Gas Pressure 13” 13” 13” 13” Min. Gas Pressure 3” 3” 3” 3” Max. Allowed Working Pressure 160 psi 160 psi 160 psi 160 psi Electrical Req: 120V (AMP)1.8 2.5 3.6 4.9 Water Connections (NPT)2” 2” 2 ½” 2 ½” Min. Water Flow (GPM) @ Max. Fire 22 24 36 48 Max. Water Flow (GPM)40 40 60 80 Water Pressure Drop @ 30°F rise (PSI)5.6 10.8 10.0 11.7 Unit Water Volume: Gallons 4479 Thermal Modules 2234 Turndown or Operating Range 8:1 10:1 15:1 20:1 Vent Size (combustion air & vent)4” 4” 6” 6” Vent Materials (as per local code)Can support PVC, CPVC , Polypropylene, or AL29-4C venting materials* Type of Gas Natural Gas or Propane Temperature Control Range Boilers deliver 68°-180°F*, Water Heaters deliver 68°-180°F Maximum Noise Level <50 dBA Condensate Production (gal/hr)3.84 4.62 9.96 9.24 Standard Listings and Approvals ASME, CSA, CSD-1, Mass. Approval, SCAQMD, NSF 372, AHRI Page 24 of 107 AGENDA ITEM #5. d) Dimensions Model Height Width Depth Weight (wet) Weight (shipping) AM 399 45.7” 23.6” 34.8” 300 lbs. 324 lbs. AM 500 45.7” 23.6” 34.8” 310 lbs. 335 lbs. AM 750 71.3” 23.6” 35.3” 530 lbs. 555 lbs. AM 1000 71.3” 23.6” 35.3” 615 lbs. 643 lbs. © 2019 AERCO AERCO International, Inc. • 100 Oritani Drive • Blauvelt, NY 10913 USA: T: (845) 580-8000 • Toll Free: (800) 526-0288 • AERCO.com Heating and Hot Water Solutions Page 25 of 107 AGENDA ITEM #5. d) MODEL T INPUT BTU RECOVERY GPH (Thermal Efficiency) GAS CONNECTION NPT VENT DIAMETER (5 elbows maximum) OPERATING Weight (lbs) 70°F to 140°F c 40°F to 140°F d 20 L 100A-GCL 199,900 326 (95%) 233 (97%) 3/4 3" @ 100 eq. Ō. 1470 25 L 100A-GCL 250,000 408 (95%) 291 (97%) 30 L 100A-GCL 300,000 490 (95%) 349 (97%) cRecoveries and thermal efficiency based upon DOE 10 CFR 431 tesƟng per ANSI Z21.10.3 @ 70°F to 140°F. d Recoveries and thermal efficiency based upon 40°F entering water temperature. Dimensions are in inches unless otherwise indicated. For standard and opƟonal equipment, refer to form PV 8550. Empty weight is 635 pounds and shipping weight is 750 pounds (all models) PV 8551 11-2018 Standard Electrical Service 120VAC, 1Ø, 60 Hz. All models 5 amps. Venting Use a Category IV PVC, CPVC or ETL, UL, ULC or CSA listed stainless steel or Centrotherm InnoFlue SW Polypropylene vent, minimum vent length 5 eq. feet. Do not size vent based only upon connection diameter at the appliance. Refer to installation manual for sizing requirements. Inlet Combustion Air Duct Up to 100 eq. ft. using 3" PVC or galvanized vent pipe. Longer lengths are ETL listed through larger diameter pipe. Refer to installation manual. Gas Pressure - Natural Minimum inlet flow pressure 3.5" W.C. Maximum static pressure 14.0" W.C. For LP gas, refer to installation manual. Minimum Clearance from Combustibles Zero clearance from sides and rear, 24" from front, 15" from top. Can be installed directly on a combustible floor. Recommended Service Clearances 18" from all sides. Check local and national codes for additional clearance requirements. Emissions All models < 20 ppm NOx. CConquest® Semi-Instantaneous GAS CONDENSING WATER HEATER AquaPLEX® Storage Tank and Heat Exchanger (duplex stainless steel) • 100 Gallon Tank PVI reserves the right to change the design and specification without notice. PVI Industries, LLC Fort Worth, TX ▪ (800) 784-8326 ▪ www.pvi.com Page 26 of 107 AGENDA ITEM #5. d) RCH - Upgrade Boilers and Pumps 9/24/2019 1. NETWORK POINTS SHALL REQUIRE MAPPING OF VIRTUAL POINTS AVAILABLE VIA THE BACNET CONNECTION 2. MONITOR POINTS LISTED BELOW GRAPHICALLY ON THE BAS OPERATOR WORKSTATION. 3. TRENDED POINTS SHALL HAVE THE SAME START TIME. 4. THE TRENDED DURATION SHALL BE EVERY 15 MINUTES (ADJ). POINT DESCRIPTION TAG(S) EXISTING POINT NEW POINT AI AO DI DO VP HARDWIRED NETWORK TREND ALARM NOTES BOILER ENABLE / DISABLE 221,2 BOILERS STATUS 2 1 BOILERS ALARM 2 2 1 SYSTEM PUMP ON OFF 221 SYSTEM PUMP STATUS 2 2 1 LEAVING WATER TEMPERATURE 1 1 1 ENTERING WATER TEMPERATURE 1 1 1 CHILLED WATER PUMP START / STOP 1111 PUMP STATUS 111 TOTAL 02 75 6 7 NOTES: 1 - SOME OF THE POINTS MAYBE EXISTING 2- LEAD BOILER CONTROL PANEL STAGES BOILERS AND ENABLES BOILER PUMPS Page 27 of 107 AGENDA ITEM #5. d) Page 28 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ ),0,' 5&+8SJUDGH,75RRP&RROLQJ 5HQWRQ&LW\+DOO *(1(5$/ ([LVWLQJ7KH,75RRPLVVHUYHGE\VSOLWV\VWHPIDQFRLOXQLWVORFDWHGDERYHWKHVHUYHUUDFNVDQGFRQGHQVHUXQLWV ORFDWHGLQWKH3DUNLQJ*DUDJH9HQWLODWLRQLVSURYLGHGE\WKHFHQWUDOEXLOGLQJYHQWLODWLRQV\VWHP7KHH[LVWLQJV\VWHPLVWLHG LQWRWKHFHQWUDOILUHDODUPV\VWHPDQGVKXWVGRZQGXULQJWHVWLQJ 3URSRVHG'HPROLVKH[LVWLQJIDQFRLOXQLWVDQGFRQGHQVHUXQLWVVHUYLQJWKH,7URRP3URYLGHRXWVLGHDLUDQGH[KDXVWORXYUHV IRUWKH,75RRPZKLFKZLOODOORZIRUDLUVLGHHFRQRPL]LQJDQGGHFRXSOHGYHQWLODWLRQ3URYLGHZDOOPRXQWHGVSOLWV\VWHP FRROLQJRQO\XQLWVWRVHUYHWKH,7URRP,IDOORZHGFRROLQJDQGYHQWLODWLRQV\VWHPWREHGHFRXSOHGIURPWKHFHQWUDOILUH DODUPV\VWHP 6&23(2):25.,1&/8'(6 0HFKDQLFDO $'HPR±EDVHVFRSH 5HPRYHRQHRIWKHGRXEOHJOD]HGZLQGRZSDQHOVa¶[¶ 'HPROLVKH[LVWLQJWZR7VSOLWV\VWHPVIDQFRLO7:(D&$)/$ô+3$QGWZR &RQGHQVHUXQLWV77$$$$)/$DUHRQIORRUEHORZ'HPROLVKUHIULJHUDQWOLQHVDQG LQWHUQDOFRQGHQVDWHSXPSV %1HZ:RUN±EDVHVFRSH )XUQLVKDQGLQVWDOO¶;¶UDLQSURRIORXYHU3URYLGHEODQNRIISDQHOVIRUORXYHUDUHDLQEHWZHHQRXWVLGHDLUDQG UHOLHIDLUSOHQXPV )XUQLVKDQGLQVWDOO¶[¶LQVXODWHGUHOLHIDLUSOHQXPDQGFODVVRSHQFORVHGDPSHU7KLVSOHQXPVKDOOEH LQVWDOOHGDWWKHWRSRIWKHORXYHUa´EHORZFHLOLQJOLQH )XUQLVKDQGLQVWDOOLQVXODWHG¶[¶LQVXODWHGDLULQWDNHSOHQXPDQGFODVVRSHQFORVHGDPSHUDQGILOWHUER[ Z[´VLGHZDOOGLIIXVHUV7KLVSOHQXPVKDOOEHLQVWDOOHG´DERYHILQLVKHGIORRU ,QVWDOO&)0RXWVLGHDLUVXSSO\IDQ6)*UHHQKHFN649*SURYLGHGE\RWKHUV ,QVWDOOWKUHHVSOLWV\VWHP70LWVXELVKLFRROLQJRQO\XQLWV7KHLQGRRUXQLWV)&8VKDOOEHLQVWDOOHG RQ,7URRPZDOO&RQGHQVHUV&8VKDOOEHLQVWDOOHGRXWVLGHRQWKHHDVWVLGHRIWKHEXLOGLQJ(TXLSPHQW E\RWKHUV )XUQLVKDQGLQVWDOOUHIULJHUDQWSLSLQJWRWKHLQGRRUXQLWVaOLQHDUIHHWUHIULJHUDQWOLQHVHWSHUKHDWSXPS )XUQLVKDQGLQVWDOOFRQGHQVDWHGUDLQVDQGSXPSV9+3IRULQGRRUXQLWV )XUQLVKDQGLQVWDOO&RQVWDQW$LU5HJXODWRU&$5,,´GLDPHWHUFRQQHFWWRH[LVWLQJPHGLXPSUHVVXUHVXSSO\ GXFWZRUNDVVRFLDWHGZLWKH[LVWLQJIDQFRLOXQLW3URYLGHWUDQVLWLRQGXFWZRUNIURPH[LVWLQJ[´PHGLXP SUHVVXUHWRWKH´URXQG&$5$GGD[´VLGHZDOOGLIIXVHUWRVXSSO\YHQWLODWLRQWRURRP%DODQFHWR&)0 &DSVHFRQGIDQFRLOXQLWPHGLXPSUHVVXUHVXSSO\GXFWZRUNFRQQHFWLRQ )XUQLVKDQGLQVWDOOQHZVPRNHVHQVRUORFDWHGLQUHOLHIDLUSOHQXP &RQWUROV $5HIHUWRDWWDFKHGSRLQWVOLVW %5HXVHH[LVWLQJSRLQWV &&RQQHFWQHZVPRNHVHQVRUWRH[LVWLQJILUHDODUPV\VWHP6HQVRUVKRXOGVKXWRII6)DQGFORVH2$DQG5$ GDPSHUVXSRQVHQVLQJVPRNH '$OWHUQDWHSURYLGHQHZHQDEOHGLVDEOHSRLQWVIRUWKUHHVSOLWV\VWHPV±VSOLWV\VWHPVKDOOEHDEDFNXS V\VWHPDQGVKRXOGRSHUDWHGXULQJILUHDODUPWHVWV $UFKLWHFWXUDO $3URYLGHVHFXUHFDJHRUIHQFLQJ¶/[¶:[¶+WRHQFORVHRXWGRRUXQLWV(QFORVXUHWREHFORVHGDWWKHWRSDQGKDYH DPDLQWHQDQFHGRRUHQWUDQFHZLWKORFNLQJFDSDELOLW\ (OHFWULFDO $%DVLF6FRSH(OHFWULFDOZRUNDVVRFLDWHGZLWKGHPROLVKLQJH[LVWLQJVSOLWV\VWHPVDQGIDQFRLOXQLWVDQGSURYLGLQJ QHZVSOLWV\VWHPVIRUWKH,7URRP %'D\0HWHULQJ7KLVSURMHFWZLOOUHVXOWLQDQHWORDGGHFUHDVHGD\PHWHULQJZLOOQRWEHUHTXLUHG &)RU'HPRDQG1HZ:RUNSOHDVHUHIHUWRDWWDFKHG'HPRDQG1HZ(TXLSPHQW6FKHGXOH 6WUXFWXUDO $&RQGHQVHU&8 3URYLGHVHLVPLFDWWDFKPHQWFRQQHFWLRQWRFRQF &RQFIRRWLQJ3URYLGH¶[¶FRQFIRRWLQJSURYLGH´FRQFVODERQJUDGHZLWKSHULPHWHUFRQFEHDP$FWXDO VL]HRIIRRWLQJZLOOEHGHWHUPLQHGLQWKHILQDOGHVLJQ Page 29 of 107 AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ %,QGRRU8QLWV)&8 3URYLGHJUDYLW\DQGVHLVPLFDWWDFKPHQWWRH[LVWLQJZDOOSHUYHQGRUVSHFLILFDWLRQ ([LVWLQJZDOO$VVXPHGH[LVWLQJZDOOZLOOEHDGHTXDWHIRULQFRPLQJORDGDQGZLOOEHFRQILUPHGLQILQDOGHVLJQ &&RUHGULOOLQJ 3URYLGHRSHQLQJVIRUVHWVRIUHIULJHUDQWOLQHV ,PDJH&08ZDOOWRLGHQWLI\WKHH[LVWLQJUHEDU '6SHFLDOLQVSHFWLRQ 3RVWLQVWDOOFRQFUHWHDQFKRUVVSHFLDOSHULRGLFLQVSHFWLRQ )LUH$ODUP $'LVFRQQHFWIURPEXLOGLQJ)$V\VWHPSURYLGHVHSDUDWHFRQQHFWLRQIURPXQLWVVHUYLQJ,7URRPWR)$SDQHO %7KUHHVSOLWV\VWHPVVKDOOEHFRQQHFWHGWR)$V\VWHP 7HVWLQJ$GMXVWLQJDQG%DODQFLQJ7$% $3URYLGHHTXLSPHQWOHYHODLUEDODQFH &RPPLVVLRQLQJ $3URYLGH373DQGSHUIRUPDQFHWHVW 'HPROLWLRQDQG5HPRYDO6SHFLDOW\&RQWUDFWRU $5HIHUWRRWKHUVHFWLRQVIRUGHPRGRQHE\RWKHUFRQWUDFWRUV 7UDLQLQJ $3URYLGHWUDLQLQJDVUHTXLUHGIRUWKLV),0 &/$5,),&$7,216$1'(;&/86,216 3HUIHGHUDODQGVWDWHODZSURMHFWVWKDWLQFOXGHUHQRYDWLRQRUGHPROLWLRQPXVWKDYHDQDVEHVWRVVXUYH\SURYLGHGE\WKH RZQHUUHJDUGOHVVRIZKHQWKHEXLOGLQJZDVEXLOW7KHVXUYH\RQO\QHHGVWRFRYHUWKHDUHDWKDWZLOOEHGLVWXUEHG,IWKH EXLOGLQJRZQHUFDQSURYLGHSURRIWKDWWKHEXLOGLQJZDVFRQVWUXFWHGZLWKDVEHVWRVIUHHPDWHULDOVWKHQQRVXUYH\LV QHHGHG $0F.LQVWU\GRHVQRWH[HFXWHVXEFRQWUDFWVIRUVXUYH\DQGRUDEDWHPHQWRIDVEHVWRVDQGOHDGSDLQW$EDWHPHQWRI DVEHVWRVDQGOHDGSDLQWVKDOOEHWKHUHVSRQVLELOLW\RIWKHEXLOGLQJRZQHUZKRVKDOOFRQWUDFWGLUHFWO\ZLWKTXDOLILHG DEDWHPHQWVSHFLDOLVWV %7KHEXGJHWIRURZQHUFRQWUDFWHGVXUYH\DQGDEDWHPHQWLIDSSOLFDEOHLVVKRZQDVD1RWLQ&RQWUDFW1,&URXJK HVWLPDWHLQ7DEOHIRUUHIHUHQFHRQO\ ,IH[LVWLQJHTXLSPHQWRUFRPSRQHQWVDUHUHXVHGUHSDLUVWRH[LVWLQJDUHQRWLQFOXGHGXQOHVVVSHFLILFDOO\QRWHGLQWKH VFRSHDERYH$WWKLVSRLQWDOORWKHUUHODWHGHTXLSPHQWWKDWKDVEHHQLQVSHFWHGLVRSHUDWLQJSURSHUO\ Page 30 of 107 AGENDA ITEM #5. d) BASE SCOPE - DEMOLISH WINDOW SECTION. PROVIDE 5'X10' WEATHER LOUVER. PROVIDE LOW OA INTAKE PLENUM AND HIGH RELIEF AIR PLENUM. INSTALL NEW SMOKE SENSOR TO THE RELIEF AIR PLENUM. BLANK OFF THE LOUVER IN BETWEEN THE TWO PLENUMS.MSF-1, SUPPLY FAN 12" BELOW SLAB ABOVE. 24" OA DUCT DEMOLISH EXISTING FAN COILS, ASSOCIATED DUCTWORK/DIFFUSERS, AND THEIR CONDENSERS ON FLOOR BELOW. REPLACE REFRIGERANT LINES AND CONDENSATE PUMPS. DEMOLISH CONDENSING UNITS AND ASSOCIATED PIPING AT FLOOR BELOW PROVIDE FILTER BANK AT THE OA INTAKE MERV-8 MIN. PROVIDE OUTDOOR UNITS CU-1, -2, -3, INCLUDE NEW CONCRETE HOUSEKEEPING PADS FOR ALL 3 CONDENSING UNITS PROVIDE INDOOR UNITS, FCU-1, -2, -3, INCLUDE STRUCTURAL SUPPORT AND BRACINGS (TYPICAL OF 3) CORE DRILL OPENING FOR (3) SETS OF TWO INSULATED REFRIGERANT LINES PROVIDE LOCKING FENCED CAGE WITH TOP FOR OUTDOOR UNITS ADD CAR AND 8X8" SIDEWALL DIFFUSER TO EXISTING FAN COIL UNIT MEDIUM PRESSURE CONNECTION. BALANCE TO 100 CFM.FCU-1FCU-2FCU-3CU-2CU-1 CU-3 CAP EXISTING FAN COIL UNIT SUPPLY AIR CONNECTION PROVIDE (2) 20X20" SIDEWALL DIFFUSERS TO DISTRIBUTE OA TO THE SPACE. Page 31 of 107 AGENDA ITEM #5. d) Page 32 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ ),0,' &&3*8SJUDGH/LJKWLQJWR/(' 5HQWRQ&LW\&HQWHU3DUNLQJ*DUDJH *(1(5$/ ([LVWLQJ7KH&LW\&HQWHU3DUNLQJ*DUDJHLVSULPDULO\OLWE\IOXRUHVFHQW7ODPSV 3URYLGH3URYLGHLQWHULRUOLJKWLQJXSJUDGHWR/('/('XSJUDGHVWRLQFOXGH/('ODPSDQGGULYHUUHSODFHPHQWV 6&23(2):25.,1&/8'(6 /LJKWLQJ $'HPR 'HPRH[LVWLQJODPSVGULYHUVDQGIL[WXUHVDVVHWRXWE\GHWDLOHGOLJKWLQJDXGLWDWWKH&LW\&HQWHU3DUNLQJ *DUDJH %1HZ:RUN 3URYLGH/('ODPSDQGGULYHURU/('IL[WXUHXSJUDGHDVVHWRXWE\GHWDLOHGOLJKWLQJDXGLWDWWKH&LW\&HQWHU 3DUNLQJ*DUDJH &$GGLWLRQDOVFRSHGRFXPHQWDWLRQUHIHUHQFHV 6HHDWWDFKHG/LJKWLQJ$XGLWZRUNERRNIRUOLQHE\OLQHGHWDLOUHJDUGLQJH[LVWLQJIL[WXUHGDWDDQGSURSRVHG XSJUDGHVWUDWHJ\ &/$5,),&$7,216$1'(;&/86,216 3HUIHGHUDODQGVWDWHODZSURMHFWVWKDWLQFOXGHUHQRYDWLRQRUGHPROLWLRQPXVWKDYHDQDVEHVWRVVXUYH\SURYLGHGE\WKH RZQHUUHJDUGOHVVRIZKHQWKHEXLOGLQJZDVEXLOW7KHVXUYH\RQO\QHHGVWRFRYHUWKHDUHDWKDWZLOOEHGLVWXUEHG,IWKH EXLOGLQJRZQHUFDQSURYLGHSURRIWKDWWKHEXLOGLQJZDVFRQVWUXFWHGZLWKDVEHVWRVIUHHPDWHULDOVWKHQQRVXUYH\LV QHHGHG $0F.LQVWU\GRHVQRWH[HFXWHVXEFRQWUDFWVIRUVXUYH\DQGRUDEDWHPHQWRIDVEHVWRVDQGOHDGSDLQW$EDWHPHQWRI DVEHVWRVDQGOHDGSDLQWVKDOOEHWKHUHVSRQVLELOLW\RIWKHEXLOGLQJRZQHUZKRVKDOOFRQWUDFWGLUHFWO\ZLWKTXDOLILHG DEDWHPHQWVSHFLDOLVWV %7KHEXGJHWIRURZQHUFRQWUDFWHGVXUYH\DQGDEDWHPHQWLIDSSOLFDEOHLVVKRZQDVD1RWLQ&RQWUDFW1,&URXJK HVWLPDWHLQ7DEOHIRUUHIHUHQFHRQO\ ,IH[LVWLQJHTXLSPHQWRUFRPSRQHQWVDUHUHXVHGUHSDLUVWRH[LVWLQJDUHQRWLQFOXGHGXQOHVVVSHFLILFDOO\QRWHGLQWKH VFRSHDERYH$WWKLVSRLQWDOORWKHUUHODWHGHTXLSPHQWWKDWKDVEHHQLQVSHFWHGLVRSHUDWLQJSURSHUO\ Page 33 of 107 AGENDA ITEM #5. d) Page 34 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) !" # $ % $ & ' $ # $ % $ & # ( & ' )*+ * ,$ -). ./0'0) './0%' )1 .2/ 3450 !.1 6!,* $ )1 )03 3450 .*+ ,$ -). )-/'0) ')-/%' ) .)0 3450 !3)!,'!)17/68 %.--9 ) )- 3450 4 *+ 6 , -.3 .1!0) 8.1% .5 40 5-10 !30 !,*!!83 %8:);!89 8 )0% .5 )0 5-10 3 *+ ,(% ,$ -). )5!0) 8)5%*! )3 )2 3450 !.0 !,*!!83 %8:);!89 8 -% )3 - 3450 /*+ ,(, , -). .1!0. 8.1% ./ 10 3450 !)5 !,*!!83 %8:.;! 8'< 8)1% ./ )1 3450 1 *+ *+ -.3 3.!04 6= 83.% , 8 41 )4. 5-10 !/.6!,$ 41 3. 5-10 -*+ *+ 6(& > ,(=$ -.3 3.!04 6= 83.% , 8 41 )4. 5-10 !/)6!,$6= 41 3. 41 07/0 3450 5 *+& *+ & ,( $ -). 3.!04 6= 83.% , 8 -- )4. 3450 !/)6!,$6= -- 3. -- 07/0 .)20 2 *+,$ '6 -.3 !,,? ,$!,,$!,( )- 4 5-10 * )- 4 5-10 )0 *+!) /). )5!0) * + 8)5% *! 4 )2 4).2 !.-!,)2!81%8 6 4 1 4).2 ))*+ +" , /). 4. 50., 3@4.% 83@>0A 5 , 8 5 5 /2 4).2 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; 5 .5 &:% 6 =; 4 07./ .431 ).*+,( ,( , -.3 4. 50., 4.% 83@>0A 5 , 8 5 ) /2 5-10 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; ) .5 &:% 6 =; ) 07./ 1/-0 )4 *+= -.3 4. 504, 3@ %4.% 83@>0A 5 , 8 5 . 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; . 3. &:% 6 =; ) 07./ 1/-0 )3 *+* " /). 4. 50., 3@4.% 83@>0A 5 , 8 5 . /2 4).2 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; . .5 &:% 6 =; ) 07./ .431 )/*+* " -.3 4. 504, 4.% 83@>0A 5, 8 5 .2 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; .2 3. & :; 3 07./ 1/-0 )1 *+* " & -.3 4. 504, 4.% 83@>0A 5, 8 5 3 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; 3 3. &:% 6 =; ) 07./ 1/-0 )-*+.,( ,( , -.3 /0)1 '8)1 ). /0 5-10 !.5 !,)18-68* ). - 5-10 )5 *+,$, , , -). /0)1 '8)1./ /0 3450 !.5 !,)18-68* ./ - 3450 )2 *+,$, , , -). )-/'0) ')-/%' .- .)0 3450 !35 6!,&%* + .- /0 3450 .0 0 00 00 0 &, !*&*, C 4)0.0.0Page 35 of 107 AGENDA ITEM #5. d) Page 36 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ ),0,' 5&+8SJUDGH)LUH3XPS 5HQWRQ&LW\+DOO *(1(5$/ ([LVWLQJ7KHHOHFWULFDQGGLHVHOILUHSXPSVDUHERWKDWWKHHQGRUWKHLUVHUYLFHOLIH 3URSRVHG'XHWRFKDQJHVLQFRGHUHTXLUHPHQWVDVLPSOHUHSODFHPHQWRIWKHILUHSXPSVLVQRWSRVVLEOH&XUUHQWFRGH UHTXLUHVXSVL]LQJWKHILUHSXPSVIURPKSWRRUKSUHTXLULQJDQXSJUDGHRIWKHHOHFWULFDOIHHGHUV$OVRGXHWR WKHKSFKDQJHWKHILUHFRQWUROOHUVPXVWEHXSJUDGHG$OVRWKHH[LVWLQJFRQWUROOHUVGRQRWKDYHWKHUHTXLUHGPRQLWRUHG SRLQWVDQGZLOOUHTXLUHUHSODFLQJ5HSODFHERWKWKH'LHVHODQG(OHFWULF)LUH3XPSVZLWKFRGHFRPSOLDQW)LUH3XPSV5HSODFH WKHGLHVHOVWRUDJHWDQNWRFRPSO\ZLWKWKHEXLOGLQJFRGH 6&23(2):25.,1&/8'(6 9LEUDWLRQ,VRODWLRQ $3URYLGHYLEUDWLRQLVRODWRUV 'LHVHO)LUH3XPS $'HPRH[LVWLQJGLHVHOILUHSXPS %3URYLGHDGLHVHOILUHSXPSUDWHGIRUJSPDWIWKGZLWKDQHZJDOIXHOWDQNFRPSDWLEOHZLWK)LUHWURO ,QF'LHVHO)LUH3XPS&RQWUROOHU&DWDORJ1R)7$'/1'&9ROWV1HJDWLYH*URXQG9+] $PSV &5HXVHH[LVWLQJFRPEXVWLRQIOXH3URYLGHQHZFRQQHFWLRQIURPWKHGLHVHOSXPSWRWKHH[LVWLQJIOXH (OHFWULFDO)LUH3XPS $%DVLF6FRSH(OHFWULFDOZRUNDVVRFLDWHGZLWKWKHUHSODFHPHQWRIWKHH[LVWLQJILUHSXPSV7ZRRSWLRQVDUHSURYLGHG %RWKRSWLRQVDUHEDVHGRQHTXLSPHQWLQTXRWHIURP&26&2)LUHGDWHG %'D\0HWHULQJ'D\0HWHULQJZLOOQRWEHQHHGHGIRUWKLVSURMHFWVFRSH &2SWLRQ5HSODFHPHQWRI(OHFWULFDQG'LHVHO)LUH3XPSVDQG&RQWUROOHUV([LVWLQJV\VWHPFRQILJXUDWLRQWRUHPDLQ 'LHVHOILUHSXPSVHUYHVDVEDFNXSIRU(OHFWULFILUHSXPS 'LHVHO)LUH3XPS L'LVFRQQHFWYROWSRZHUIURPGLHVHOILUHSXPSFRQWUROOHU LL5HFRQQHFWYROWSRZHUWRQHZGLHVHOILUHSXPSFRQWUROOHU LLL$OORWKHUZRUNDVVRFLDWHGZLWKGHPRDQGUHSODFHPHQWRIGLHVHOILUHSXPSDQGFRQWUROOHULVE\)LUH 3URWHFWLRQ&RQWUDFWRU (OHFWULF)LUH3XPS L([LVWLQJHOHFWULFILUHSXPSLVYROWSKDVHKS5HSODFHPHQWILUHSXPSLVVDPHYROWDJHDQGKS LL6DIHRIISRZHUWRWKHH[LVWLQJILUHSXPS7KLVZLOOUHTXLUHXWLOLW\VKXWGRZQDVILUHSXPSLVIHGIURP GHGLFDWHGXWLOLW\VHUYLFH LLL'LVFRQQHFWH[LVWLQJFRQGXFWRUVIURPHOHFWULFILUHSXPSFRQWUROOHUDQGHOHFWULFILUHSXPS LY([LVWLQJHOHFWULFILUHSXPSDQGFRQWUROOHUWREHGHPR¶GE\)LUH3URWHFWLRQ&RQWUDFWRU Y0HJJHUDOOFRQGXFWRUVWRFRQILUPLQVXODWLRQLQWHJULW\ YL$IWHULQVWDOORIQHZHOHFWULFDOILUHSXPSDQGFRQWUROOHUE\)LUH3URWHFWLRQ&RQWUDFWRUUHFRQQHFWDOO FRQGXFWRUV 6WUXFWXUDO6WHHO $)LUHSXPSV 3URYLGHVHLVPLFDWWDFKPHQWFRQQHFWLRQWRFRQFUHWH +RXVHNHHSLQJSDG$VVXPHGH[LVWLQJFRQFUHWHSDGWRUHPDLQDQGUHXVH 3URYLGHVSULQJLVRODWLRQVVQXEEHUVDQGSXPSEDVH %0HFK3LSH 3URYLGHVHLVPLFEUDFLQJIRUDOO03DQGSOXPELQJWKDWWULJJHUVVHLVPLFEUDFLQJSHUVWUXFWXUDOFRGH$6&( FKDSWHU &6SHFLDOLQVSHFWLRQ 3RVWLQVWDOOFRQFUHWHDQFKRUVVSHFLDOSHULRGLFLQVSHFWLRQ &RQWUROV $3URYLGHIXQFWLRQDOSHUIRUPDQFHWHVWLQJRIQHZSXPSVZLWKH[LVWLQJILUHFRQWUROOHUV %3URYLGHFRQILGHQFHWHVWLQJRIILUHDODUPV\VWHPDQGWZRILUHSXPSV &RPPLVVLRQLQJ $3URYLGHVWDUWXSDQGFRPPLVVLRQLQJRIRQHHOHFWULFGLHVHOILUHSXPSDQGRQHGLHVHOILUHSXPS 7UDLQLQJ $3URYLGHWUDLQLQJDVUHTXLUHGIRUWKLV),0 AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ &/$5,),&$7,216$1'(;&/86,216 3HUIHGHUDODQGVWDWHODZSURMHFWVWKDWLQFOXGHUHQRYDWLRQRUGHPROLWLRQPXVWKDYHDQDVEHVWRVVXUYH\SURYLGHGE\WKH RZQHUUHJDUGOHVVRIZKHQWKHEXLOGLQJZDVEXLOW7KHVXUYH\RQO\QHHGVWRFRYHUWKHDUHDWKDWZLOOEHGLVWXUEHG,IWKH EXLOGLQJRZQHUFDQSURYLGHSURRIWKDWWKHEXLOGLQJZDVFRQVWUXFWHGZLWKDVEHVWRVIUHHPDWHULDOVWKHQQRVXUYH\LV QHHGHG $0F.LQVWU\GRHVQRWH[HFXWHVXEFRQWUDFWVIRUVXUYH\DQGRUDEDWHPHQWRIDVEHVWRVDQGOHDGSDLQW$EDWHPHQWRI DVEHVWRVDQGOHDGSDLQWVKDOOEHWKHUHVSRQVLELOLW\RIWKHEXLOGLQJRZQHUZKRVKDOOFRQWUDFWGLUHFWO\ZLWKTXDOLILHG DEDWHPHQWVSHFLDOLVWV %7KHEXGJHWIRURZQHUFRQWUDFWHGVXUYH\DQGDEDWHPHQWLIDSSOLFDEOHLVVKRZQDVD1RWLQ&RQWUDFW1,&URXJK HVWLPDWHLQ7DEOHIRUUHIHUHQFHRQO\ ,IH[LVWLQJHTXLSPHQWRUFRPSRQHQWVDUHUHXVHGUHSDLUVWRH[LVWLQJDUHQRWLQFOXGHGXQOHVVVSHFLILFDOO\QRWHGLQWKH VFRSHDERYH$WWKLVSRLQWDOORWKHUUHODWHGHTXLSPHQWWKDWKDVEHHQLQVSHFWHGLVRSHUDWLQJSURSHUO\ AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ ),0,' 5&+8SJUDGH%XLOGLQJ*HQHUDWRU 5HQWRQ&LW\+DOO *(1(5$/ 8SJUDGHWKHWZREXLOGLQJJHQHUDWRUVWRDVLQJOHN:JHQHUDWRUEDVHGRQWKHDWWDFKHG6D]DQGHVLJQGRFXPHQWV3URYLGH DJDOORQGD\WDQNDQGJDOORQGLHVHOWDQN8/FHUWLILHGWDQNZLWKDIXHOSROLVKLQJV\VWHP 6&23(2):25.,1&/8'(6 (TXLSPHQW)XUQLVKHGE\(6&2 $*HQHUDWRU 6L]HDQG%DVLVRI'HVLJQN:&XPPLQV3RZHU6XLWH %7DQNEDVLVRIGHVLJQ(QYLURVDIH JDOORQV 8/FHUWLILHGWDQN 3URYLGHDIXHOSROLVKLQJV\VWHP 0HFKDQLFDO $'HPR 3LSLQJ L'HPRWZRH[LVWLQJJHQHUDWRUIOXHV %1HZ:RUN 3LSLQJ L3URYLGHYHQWLQJIRUJHQHUDWRU LL3URYLGHIXHOOLQHVIURPWDQNSDGWRJHQHUDWRUZLWKIOH[FRXSOLQJVERWKVLGHVIRUVHLVPLF LLL,QVWDOOH[KDXVWV\VWHPIRUJHQHUDWRU (OHFWULFDOVHH6D]DQGHVLJQGUDZLQJVDWWDFKHG $'HPR 'HPRDQGUHPRYHWZRH[LVWLQJJHQHUDWRUV %1HZ:RUN 5HSODFHH[LVWLQJJHQHUDWRUVZLWKVLQJOHJHQHUDWRU L%DVLVRI'HVLJQLVDN:JHQHUDWRU LL/RFDWLRQ*HQHUDWRU5RRP 3URYLGHQHZJHQHUDWRUHOHFWULFDOSDQHOLQJHQHUDWRUURRPWRGLVWULEXWHORDGV$$0% 3URYLGHQHZ$9SPZLUHWUDQVIHUVZLWFKWRVHUYHWKHQHZWKIORRUSDQHO; 3URYLGHSDQHO;$$0%RQWKHWKIORRUSHUWKHDWWDFKHGGUDZLQJV L3URYLGHGLVFRQQHFWWRSDQHO;$$)9SK LL3URYLGHWUDQVIRUPHU;7N9$9WR<9 ,QVWDOOJDOORQWDQNWRWKHQRUWKRIWKH&LW\+DOOORFDWHGLQWKHH[LVWLQJVWDOOSDUNLQJORW 3URYLGHJURXQGURGDQGFRQQHFWLRQVWRQHZGLHVHOIXHOWDQN 3URYLGHFRQWUROVDODUPFRQQHFWLRQVEHWZHHQWDQNDQGJHQHUDWRUDQGWDQNFRQWUROOHUDQG5&+FRPPDQGFHQWHU LQWHUIDFH 3URYLGHDOOSODFDUGVSHUFRGH &LYLO $7UHQFKLQJIURPWDQNWR5&+ %6HGLPHQWFRQWURO &5HSODFHPHQWDVSKDOWRYHUWUHQFKLQJ '3URYLGHEROODUGVDURXQGQHZWDQNHQFORVXUH 6LWH8WLOLWLHVSURYLGHGE\&LW\RI5HQWRQ $3URYLGH*HR7HFKDQDO\VLVRIWDQNORFDWLRQQRUWKRIWKH&LW\+DOO %3URYLGHSULYDWHORFDWHRIXWLOLWLHV &3URYLGHVLWHVXUYH\ 6WUXFWXUDO $6WHHOVXSSRUWVIRUHTXLSPHQW 6HLVPLFVXSSRUWRIJHQHUDWRUH[KDXVWV\VWHP %&RQFUHWHE\RWKHU )RXQGDWLRQVXSSRUWRIWDQNSDGWDQNZW OEV 7DQNSDG¶[¶ AGENDA ITEM #5. d) Detailed Scope of Work 35235,(7$5<$1'&21),'(17,$/ &&RUH'ULOOLQJ &RUHGULOOLQJRIIXHOOLQHLQWRJHQHUDWRUURRP '6DZ&XWWLQJ 3URYLGHVDZFXWWLQJRIQRUWKSDUNLQJORWIXHOOLQHWUHQFK &DUSHQWU\ $'HPR 5HPRYHIHQFLQJDURXQGH[LVWLQJJHQHUDWRUV %*HQHUDO&DUSHQWU\ 7DQNHQFORVXUHZLWKVWHHOIHQFH¶WDOOPDQGRRUDQGVHFXULW\ L6WHHOIHQFLQJZLWKPDQGRRUWRUHSODFHGHPRHGIHQFLQJDURXQGJHQHUDWRU &RPPLVVLRQLQJ $3URYLGHIXQFWLRQDOSHUIRUPDQFHWHVWDQG)DFWRU\VWDUWXSVXSSRUW 7UDLQLQJ $3URYLGHWUDLQLQJDVUHTXLUHGIRUWKLV),0 &/$5,),&$7,216$1'(;&/86,216 3HUIHGHUDODQGVWDWHODZSURMHFWVWKDWLQFOXGHUHQRYDWLRQRUGHPROLWLRQPXVWKDYHDQDVEHVWRVVXUYH\SURYLGHGE\WKH RZQHUUHJDUGOHVVRIZKHQWKHEXLOGLQJZDVEXLOW7KHVXUYH\RQO\QHHGVWRFRYHUWKHDUHDWKDWZLOOEHGLVWXUEHG,IWKH EXLOGLQJRZQHUFDQSURYLGHSURRIWKDWWKHEXLOGLQJZDVFRQVWUXFWHGZLWKDVEHVWRVIUHHPDWHULDOVWKHQQRVXUYH\LV QHHGHG $0F.LQVWU\GRHVQRWH[HFXWHVXEFRQWUDFWVIRUVXUYH\DQGRUDEDWHPHQWRIDVEHVWRVDQGOHDGSDLQW$EDWHPHQWRI DVEHVWRVDQGOHDGSDLQWVKDOOEHWKHUHVSRQVLELOLW\RIWKHEXLOGLQJRZQHUZKRVKDOOFRQWUDFWGLUHFWO\ZLWKTXDOLILHG DEDWHPHQWVSHFLDOLVWV %7KHEXGJHWIRURZQHUFRQWUDFWHGVXUYH\DQGDEDWHPHQWLIDSSOLFDEOHLVVKRZQDVD1RWLQ&RQWUDFW1,&URXJK HVWLPDWHLQ7DEOHIRUUHIHUHQFHRQO\ ,IH[LVWLQJHTXLSPHQWRUFRPSRQHQWVDUHUHXVHGUHSDLUVWRH[LVWLQJDUHQRWLQFOXGHGXQOHVVVSHFLILFDOO\QRWHGLQWKH VFRSHDERYH$WWKLVSRLQWDOORWKHUUHODWHGHTXLSPHQWWKDWKDVEHHQLQVSHFWHGLVRSHUDWLQJSURSHUO\ 8QOHVVRWKHUZLVHQRWHGWKHIROORZLQJDSSOLHV+\GURQLF6\VWHPVH[FHSWVWHDPDQGFRQGHQVDWHUHWXUQò´DQGODUJHU ±6FKHGXOH%63:HOGHG)LWWLQJV´DQGVPDOOHU±&RSSHU7\SH/SLSHDQGILWWLQJV6WHDP±6FKHGXOH%63 &RQGHQVDWH5HWXUQ±6FKHGXOH'RPHVWLF+RWDQG&ROG:DWHU±&RSSHU7\SH/&RQGHQVDWH±&RSSHU7\SH0*DV ±´DQGVPDOOHU%0,ò´DQGODUJHU%63 8QOHVVRWKHUZLVHQRWHGWKHIROORZLQJDSSOLHV$OOGXFWZRUNWREHFRQVWUXFWHG´ZJJDOYDQL]HG ([FOXGHV)XHOSURYLGHGE\&LW\RI5HQWRQ %XGJHWHVWLPDWHVIHHGHUWR$76LVQRORQJHUWKDQ/) ([FOXGHV6RXQG$WWHQXDWLQJ(QFORVXUH$VVXPHLQVWDOOHGLQ*HQHUDWRU5RRPDVQRWHGRQ0DWUL[ AGENDA ITEM #5. d) ABBREVIATIONS GENERAL NOTES: 1. SYMBOLS LEGENDS ARE PROVIDED FOR REFERENCE PURPOSES ONLY. THE SYMBOLS REPRESENT THE TYPE OF DEVICES THAT MAY BE REQUIRED IN THE WORK; QUANTITIES AND LOCATIONS ARE AS SHOWN ON THE PLAN SHEETS. 2. PROVIDE 3/4" CONDUIT & #12 CONDUCTORS UNLESS NOTED OTHERWISE. PROVIDE ONE NEUTRAL CONDUCTOR FOR EACH UNGROUNDED CONDUCTOR OF SINGLE PHASE LINE-NEUTRAL BRANCH CIRCUITS. DO NOT SHARE NEUTRAL CONDUCTORS. 3. EACH FEEDER AND BRANCH CIRCUIT CONDUIT SHALL HAVE AN EQUIPMENT GROUNDING CONDUCTOR SIZED IN ACCORDANCE WITH NFPA 70, ARTICLE 250. 4. ALL ELECTRICAL EQUIPMENT IN PORTIONS OF THE BUILDING NOT BEING REMODELED SHALL BE LEFT IN WORKING CONDITION. RESTORE ANY CIRCUITS INTERRUPTED. 5. ALL NEW LIGHT FIXTURES AND FIXTURES IN AREAS ADJACENT DEMOLITION & CONSTRUCTION AREAS ARE TO BE THOROUGHLY CLEANED IMMEDIATELY PRIOR TO NOTICE OF SUBSTANTIAL COMPLETION. 6. THE FOLLOWING IS PART OF THIS PROJECT AND ALL COSTS PERTAINING THERETO SHALL BE INCLUDED IN THE BASE BID: A. NEW ELECTRICAL EQUIPMENT AND APPARATUS SHALL BE COORDINATED AND CONNECTED INTO THE EXISTING SYSTEM AS REQUIRED. B. POWER WIRING AND CABLE INSTALLATIONS SHALL BE CONCEALED ABOVE ACCESSIBLE CEILINGS AND IN WALLS. EXPOSED WIRING SHALL BE INSTALLED IN APPROVED SURFACE METAL RACEWAY WHERE INDICATED. C. WHERE EXISTING CONDUITS ARE INDICATED FOR REUSE, FIELD VERIFY INTEGRITY OF REUSED RACEWAYS PRIOR TO INSTALLATION OF CONDUCTORS. PROVIDE NEW RACEWAYS WHERE EXISTING ARE UNUSABLE. D. LOCATIONS OF ALL WALL MOUNTED DEVICES SUCH AS SWITCHES, RECEPTACLE, AND OUTLETS ARE SHOWN DIAGRAMMATICALLY. VISIT THE SITE TO CONFIRM EXACT DEVICE LOCATIONS AND COORDINATE INSTALLATIONS WITH FIXED CASEWORK, DOORS AND RELITES. E. PROVIDE PENETRATIONS THROUGH WALLS, FLOORS, AND CEILINGS AS REQUIRED. PROVIDE SUITABLE FIRE RATED MATERIALS AND SEAL ALL CEILING, FLOOR, AND WALL PENETRATIONS TO MATCH FIRE RATING OF SURFACES PENETRATED. DEMOLITION NOTES: A. THE EXISTING CONDITIONS SHOWN WERE TAKEN FROM AVAILABLE RECORD INFORMATION. FIELD VERIFY ALL CONDITIONS THAT MAY AFFECT CONSTRUCTION. IF ANY DISCREPANCIES ARE DISCOVERED, NOTIFY THE ENGINEER IN WRITING AND REQUEST DIRECTION PRIOR TO COMMENCING WORK. B. ANY AND ALL EQUIPMENT HAVING ELECTRICAL CONNECTIONS THAT REQUIRE DISCONNECTING AND/OR RE-CONNECTING AS A RESULT OF CONSTRUCTION SHALL BE INCLUDED AS A PART OF THIS CONTRACT. C. THE EXISTING ELECTRICAL DEVICES, CONDUIT, AND/OR EQUIPMENT THAT FOR ANY REASON OBSTRUCTS CONSTRUCTION SHALL BE RELOCATED UNLESS OTHERWISE NOTED. LOCATION IS TO BE AS CLOSE AS POSSIBLE TO THE ORIGINAL LOCATION. D. ALL CIRCUITS, CONDUIT AND WIRE THAT ARE NOT TO REMAIN IN SERVICE SHALL BE REMOVED BACK TO THE FIRST ACCESSIBLE JUNCTION BOX WHERE IT SHALL BE TIED OFF AND LABELED AS SPARE WITH CIRCUIT NUMBER INDICATED. E. REMOVE ALL ABANDONED WIRE AND CABLING. @ AT &AND A/C AIR CONDITIONING(ER) A (AMP) AMPERE AC ABOVE COUNTER, ALTERNATING CURRENT ADJ ADJUSTABLE ADJT ADJACENT AFF ABOVE FINISHED FLOOR AHJ AUTHORITY HAVING JURISDICTION AIC AMPERE INTERRUPTING CAPACITY ALT ALTERNATE ANN ANNUNCIATOR ARCH ARCHITECT; ARCHITECTURAL ATS AUTOMATIC TRANSFER SWITCH AUTO AUTOMATIC AUX AUXILIARY AWG AMERICAN WIRE GAUGE BKBD BACKBOARD BKR BREAKER BLDG BUILDING C CONDUIT CAP CAPACITY CB CIRCUIT BREAKER CKT CIRCUIT CLG CEILING CLR CLEAR COL COLUMN COM COMMUNICATION CPS CYCLES PER SECOND CT CURRENT TRANSFORMER CTL CONTROL CU COPPER DC DIRECT CURRENT DISC SW DISCONNECT SWITCH DISC DISCONNECT DN DOWN DWG DRAWING E EXIST, EAST EDH ELECTRIC DUCT HEATER EF EXHAUST FAN E.G. EXEMPLI GRATIA, FOR EXAMPLE EGC EQUIPMENT GROUNDING CONDUCTOR EL ELEVATION ELEC ELECTRIC(AL) ELEV ELEVATOR EM EMERGENCY EMT ELECTRICAL METALLIC TUBING ENCL ENCLOSURE ENTR ENTRANCE EP EXPLOSION PROOF EPO EMERGENCY POWER OFF EQUIP/EQP EQUIPMENT EWC ELECTRIC WATER COOLER EWH ELECTRIC WATER HEATER EXH EXHAUST EXT EXTERIOR EXIST EXISTING F FAHRENHEIT,FUSE,FIRE FA FIRE ALARM FAA FIRE ALARM ANNUNCIATOR FACP FIRE ALARM CONTROL PANEL FC FOOTCANDLE FCU FAN COIL UNIT FD FIRE DAMPER FDR FEEDER FIXT FIXTURE FLA FULL LOAD AMPS FSD FIRE/SMOKE DAMPER GEN GENERATOR GFI GROUND FAULT CIRCUIT INTERRUPTER GFR GROUND FAULT RELAY H HEIGHT HID HIGH INTENSITY DISCHARGE HOA HAND OFF AUTOMATIC HOR HORIZONTAL HP HORSEPOWER HR HOUR HT HEIGHT HW HOT WATER HZ HERTZ IBC INTERNATIONAL BUILDING CODE IC INTERCOM I.E. IN ESSENCE, THAT IS IES ILLUMINATING ENGINEERING SOCIETY IEEE INSTITUTE OF ELECTRICAL AND ELECTRONIC ENGINEERS IG ISOLATED GROUND IMC INTERMEDIATE METAL CONDUIT IN INCH JB JUNCTION BOX KCMIL THOUSAND CIRCULAR MILLS KVA KILOVOLT AMPERES KVAR KILOVOLT AMPERES REACTIVE KW KILOWATT KWH KILOWATT HOUR LBS POUNDS LF LINEAR FEET (FEET) LRA LOCKED ROTOR AMPS LS LIFE SAFETY LT LIGHT LTG LIGHTING LV LOW VOLTAGE MAG MAGNETIC MAN MANUAL MAT MATERIAL MAX MAXIMUM MCA MINIMUM CIRCUIT AMPACITY MCB MAIN CIRCUIT BREAKER MECH MECHANICAL MEZZ MEZZANINE MG MOTOR GENERATOR MH METAL HALIDE / MANHOLE MIN MINIMUM MISC MISCELLANEOUS MLD MAIN LINE DISCONNECT MLO MAIN LUG ONLY MOCP MAXIMUM OVERCURRENT PROTECTION MS MAGNETIC STARTER MTD MOUNTED MTG MOUNTING MTR MOTOR N NORTH; NEUTRAL N/A NOT APPLICABLE NC NORMALLY CLOSED NEC NATIONAL ELECTRICAL CODE NEMA NATIONAL ELECTRIC MANUFACTURERS ASSOCIATION NESC NATIONAL ELECTRICAL SAFETY CODE NEUT NEUTRAL NFPA NATIONAL FIRE PROTECTION ASSOCIATION NIC NOT IN CONTRACT NO NORMALLY OPEN NTS NOT TO SCALE OC ON CENTER OFCI OWNER FURNISHED CONTRACTOR INSTALLED OFOI OWNER FURNISHED OWNER INSTALLED OL OVERLOAD OS OPTIONAL STANDBY P PRIMARY PA PUBLIC ADDRESS PAR PARALLEL PB PULL BOX PE PHOTO ELECTRIC PF POWER FACTOR PH PHASE PIV POST INDICATOR VALVE PNL PANEL POC POINT OF CONNECTION PWR POWER QTY QUANTITY R RELOCATE (D), RECESSED RAD RADIUS RECPT RECEPTACLE REF REFRIGERATOR RLA RATED LOAD AMPS RPM REVOLUTIONS PER MINUTE SSOUTH SC SECURITY SCCR SHORT CIRCUIT CURRENT RATING SD SMOKE DETECTOR, SMOKE DAMPER SECT SECTION SF SUPPLY FAN SHT SHEET SPD SURGE PROTECTIVE DEVICE SPEC SPECIFICATION SPL SPECIAL SQ SQUARE STOR STORAGE SW SWITCH SWBD SWITCHBOARD SYM SYMMETRICAL SYS SYSTEM T THERMOSTAT TB TERMINAL BOX TC TIME CLOCK TEL TELEPHONE TV TELEVISION TYP TYPICAL UFC UNIFORM FIRE CODE UG UNDERGROUND UH UNIT HEATER UL UNDERWRITERS LABORATORIES UON UNLESS OTHERWISE NOTED UV UNIT VENTILATOR VVOLT VAV VARIABLE AIR VOLUME VEL VELOCITY VM VOLTMETER VOL VOLUME W WATT, WEST W/ WITH W/O WITHOUT WH WATER HEATER WHM WATT HOUR METER WP WEATHERPROOF X REACTANCE XFMR TRANSFORMER XMTR TRANSMITTER Z IMPEDANCE RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/30/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 E0.0 NOTES, ABBREV. & DRAWING LIST AGENDA ITEM #5. d) S SYMBOL DESCRIPTION SYMBOLS LEGEND - FIRE ALARM VS PS FS F PIV ESR F FIRE ALARM SYSTEM CONTROL PANEL ESR - ELEVATOR STATUS/RECALL FAC - FIRE ALARM COMMUNICATOR FACP - FIRE ALARM CONTROL PANEL FAA OR FARA - FIRE ALARM ANNUNCIATOR HVA - HVAC OR EXHAUST STAIRWELL PRESSURIZATION LCD - FIRE ALARM LCD ANNUNCIATOR FIRE ALARM FLOW SWITCH HI/LO AIR PRESSURE SWITCH VALVE SUPERVISORY SWITCH POST INDICATOR VALVE SUPERVISORY SWITCH FIRE ALARM PULL STATION SMOKE DAMPER FIRE ALARM STROBE ONLY - WALL FIRE ALARM HORN STROBE FIRE ALARM HORN ONLY FIRE ALARM BELL FIRE FIGHTER PHONE JACK HEAT DETECTOR F - FIXED TEMPERATURE R - RATE OF RISE ONLY R/C - RATE COMPENSATION R/F - RATE OF RISE AND FIXED TEMPERATURE SMOKE DETECTOR BT - BEAM TRANSMITTER BR - BEAM RECEIVER I - IONIZATION P - PHOTOELECTRIC FIRE ALARM DUCT SMOKE DETECTOR WITH SAMPLING TUBE FIRE/SMOKE DAMPER SD SD XX F XX FIRE ALARM STROBE ONLY - CEILINGXX FIRE ALARM SPEAKER STROBE XX FIRE ALARM SPEAKER ONLYS S T AS SYMBOL DESCRIPTION SYMBOLS LEGEND - POWER SYMBOL DESCRIPTION SYMBOLS LEGEND - LIGHTING M XXXX M T 65° ST G SV CB SYMBOL DESCRIPTION SYMBOLS LEGEND - POWER B SYMBOL DESCRIPTION SYMBOLS LEGEND - GROUNDING ST SYMBOL DESCRIPTION SYMBOLS LEGEND - POWER XXX SYMBOL DESCRIPTION SYMBOLS LEGEND - POWER SYMBOL DESCRIPTION SYMBOLS LEGEND - POWER J MH HH PB ##### AM G M SDM FSDM CR M C XXXXXX HOME RUN TO SOURCE OF SUPPLY PANEL DESIGNATION BRANCH CIRCUIT NUMBERSA-1,3,5 TRANSFORMER DELTA WYE MEDIUM VOLTAGE CABLE TERMINATOR METER CURRENT TRANSFORMER POTENTIAL TRANSFORMER INDICATING INSTRUMENT kVAR-KILOVAR METER; kWH/D-KILOWATT HOUR DEMAND METER INSTRUMENT SWITCH AS-AMMETER SWITCH; VS-VOLTMETER SWITCH; SS-SYNCHRONIZING SWITCH; SV-SUPERVISORY (LOCAL-REMOTE) SWITCH SEPARABLE CONNECTOR LIGHT FIXTURE IDENTIFIER - REFER TO LIGHTING FIXTURE SCHEDULE 1x4 LUMINAIRE WALL MOUNTED LUMINAIRE STRIP LUMINAIRE DOWNLIGHT BATTERY-POWERED EMERGENCY WALLPACK AIR TERMINAL GROUND WELL GROUND ROD GROUND CONNECTION BATTERY A-AMBER; B-BLUE; G-GREEN; R-RED; W-WHITE INDICATING LIGHT - TYPE AS NOTED TERMINAL BLOCK THERMOSTAT MOTOR-OPERATED VALVE SOLENOID VALVE NORMALLY CLOSED CONTACT NORMALLY OPEN CONTACT MOTOR THERMAL OVERLOADS - (3) UNLESS OTHERWISE NOTED FUSE RESISTOR MOV SURGE PROTECTION SWITCH WITH EXTERNAL GROUND FAULT RELAY AND CT ST - INDICATES SHUNT TRIP CIRCUIT BREAKER 2-POSITION SELECTOR SWITCH 3-POSITION SELECTOR SWITCH HAND-OFF-AUTOMATIC ON-OFF SELECTOR SWITCH 2-CIRCUIT PUSHBUTTON PUSHBUTTON SWITCH MOMENTARY CONTACT EQUIPMENT CONNECTION GENERATOR MOTOR CONNECTION SMOKE DAMPER FIRE SMOKE DAMPER COMBINATION STARTER HP RATED, 3-POLE, NEMA SIZE 1 MINIMUM, UNLESS NOTED OTHERWISE - OVERCURRENT PROTECTION AS REQUIRED BY EQUIPMENT MANUFACTURER OR AS NOTED DISCONNECT SWITCH 3-POLE UNLESS NOTED OTHERWISE FUSED DISCONNECT SWITCH 3-POLE UNLESS NOTED OTHERWISE - OVERCURRENT PROTECTION AS REQUIRED BY EQUIPMENT MANUFACTURER OR AS NOTED CONTACTOR RELAY COIL CR-CONTROL RELAY; TD-TIME DELAY RELAY; UV-UNDERVOLTAGE RELAY; M-MOTOR CONTACTOR; MOTOR-RATED SWITCH - SIZE OL PER MOTOR REQUIREMENTS EQUIPMENT EMERGENCY SHUTDOWN SWITCH FEEDER TAG - REFER TO FEEDER SCHEDULE AMPERES SHORT CIRCUIT AVAILABLE (SYMMETRICAL) TRANSFER SWITCH ( AUTO ) PANELBOARD EQUIPMENT CABINET - TYPE AS NOTED 208Y/120V, 3Ø, 4W PANELBOARD 480Y/277V, 3Ø, 4W PANELBOARD MINIMUM 3/4" CONDUIT CONCEALED IN CEILING SPACE OR IN WALL MINIMUM 3/4" WITH #12 AWG CONDUCTORS WITH DEDICATED NEUTRAL EACH CIRCUIT, UNLESS OTHERWISE NOTED ON PLAN. PROVIDE EQUIPMENT GROUNDING CONDUCTORS SIZED PER NFPA 70. FLEXIBLE METAL CONDUIT CONDUIT - CONCEALED IN OR UNDER FLOOR CONDUIT - ROUTED UNDERGROUND LOW-VOLTAGE WIRING (CLASS B) CONDUIT OR CABLE VERTICAL DOWN CONDUIT OR CABLE VERTICAL UP CONDUIT STUB - TERMINATE WITH BUSHING OR CAP IF UNDERGROUND BREAK LINE CONDUIT SEAL EXPANSION FITTING CONDUCTORS - CONNECTED CONDUCTORS - NOT CONNECTED JUNCTION BOX PULLBOX - SIZE AS INDICATED OR AS REQUIRED BY CODE HANDHOLE MANHOLE DETAIL REFERENCE SECTION REFERENCE ELEVATION REFERENCE 1 X XX.XX X XX.XX X XX.XX SYMBOL DESCRIPTION SYMBOLS LEGEND - GENERAL SECTION IDENTIFICATION NUMBER SHEET WHERE SECTION IS DRAWN ELEVATION IDENTIFICATION NUMBER SHEET WHERE ELEVATION IS DRAWN DETAIL IDENTIFICATION NUMBER SHEET WHERE DETAIL IS DRAWN DRAWING CONSTRUCTION ("FLAG") NOTE MATCHLINE REVISION CLOUD (ENCIRCLES DRAWING CHANGES MADE SINCE THE PREVIOUS RELEASE) REVISION REFERENCE NORTH REFERENCE EQUIPMENT IDENTIFIER POINT OF CONNECTION X-XX EXISTING TO BE REMOVED (HATCH) HEAVY LINEWEIGHT INDICATES NEW WORK LIGHT LINEWEIGHT INDICATES EXISTING INFORMATION 1 N XX SYMBOL DESCRIPTION SYMBOLS LEGEND - WIRING DEVICES SINGLE-POLE WALL SWITCH MOUNT SWITCHES AT 48" AFF. TO CL, UON. WALL SWITCH - SUBSCRIPT 2 = 2-POLE LV = LOW-VOLTAGE 3 = 3-WAY OS = OCCUPANCY SENSOR TYPE 4 = 4-WAY OP = OCCUPANCY/PHOTOELECTRIC TYPE K = KEYED WP = WEATHERPROOF LOWER CASE LETTER INDICATES SWITCHING GROUP MOUNT SWITCHES AT +48" AFF. TO CL, UON. ANY COMBINATION OF SWITCH TYPES CAN BE USED (IE. 3K = 3-WAY KEYED SWITCH) NEMA 5-20R, +18" AFF UON NEMA 5-20R W/ GROUND FAULT CIRCUIT INTERRUPTER, +18" AFF UON SPECIAL PURPOSE RECEPTACLE TYPE AS SHOWN ON PLANS PUSH BUTTON DUPLEX/DOUBLE DUPLEX RECEPTACLES SAME AS ABOVE SAME AS ABOVE SAME AS ABOVE SAME AS ABOVE R FIRE ALARM RELAY AM-AMMETER, M OR kWH-KILOWATT HOUR METER;RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/28/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 E0.1 SYMBOLS & LEGENDS AGENDA ITEM #5. d) ATS EDP ATS EDP-2 ATS PANEL 'S' JUNCTION BOX JUNCTION BOX JUNCTION BOX PANEL EDP PANEL EDP-2 BATTERY CHARGER GENERATOR SERVING EDP GENERATOR SERVING EDP-2 AND PANEL S EXHAUST PIPE ROUTED THROUGH EXTERIOR WALL TO OUTSIDE. ATS EDP ATS EDP-2 ATS PANEL 'S' PANEL EDP-2 PANEL EDP JUNCTION BOX JUNCTION BOX BATTERY CHARGER DUPLEX RECEPTACLE EXHAUST PIPE ROUTED THROUGH EXTERIOR WALL TO OUTSIDE.RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATION2017035 NORTHPROJECTGENERATOR ROOM DEMOLITION PLAN DEMOLITION NOTES: DISCONNECT AND DEMOLISH ALL CONDUIT/WIRE FED FROM EXISTING ATS ROUTED OVER TO EXISTING GENERATOR. MAINTAIN ATS FOR RE-CIRCUITING TO NEW GENERATOR VIA NEW GENERATOR ELECTRICAL PANEL. THREE (3) AUTOMATIC TRANSFER SWITCHES (ATS) TOTAL. DEMOLISH GENERATORS, TWO (2) TOTAL AND TURN OVER TO OWNER FOR SALVAGE. DEMOLISH ALL ASSOCIATED APPURTENANCES (MUFFLER, EXHAUST PIPING, HANGERS, FUEL LINES, ELECTRICAL, ETC.) DEMOLISH BATTERY CHARGER AND CONDUIT/WIRE FEEDING OVER TO GENERATOR. MAINTAIN 120V BRANCH CIRCUIT FEEDING BATTERY CHARGER FOR RE-USE. DISCONNECT AND MAINTAIN STUBBED-UP GROUNDING CONDUCTOR FOR RE-USE WITH NEW GENERATOR. MAINTAIN ALL SPRINKLER PIPING AS IS THROUGHOUT GENERATOR ROOM. DEMOLISH EXISTING 8' FIXTURE CONDUIT/WIRE BACK TO SOURCE AT RECESSED J-BOX IN CEILING. MAINTAIN CIRCUIT FOR RE-USE AT J-BOX. COORDINATE WITH ARCHITECTURAL FOR DEMOLITION OF EXISTING SUPPORT PIPE ROUTED FLOOR TO CEILING AT THIS LOCATION. MAINTAIN EXISTING PIPING AS IS. SEAL UNUSED PENETRATION WITH CONCRETE FULL DEPTH TO MATCH EXISTING EXTERIOR WALL CONSTRUCTION. DEMOLISH EXISTING DUPLEX RECEPTACLE AND REPLACE WITH GFI TYPE. CHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 10/29/2019 PLAN REVIEW 1/2"=1'-0" GENERATOR ROOM EAST WALL ELEVATION VIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 1 E1.0 1 E1.0 1/2"=1'-0" 2 E1.0 1 2 4 3 9 8 7 6 5 10 10 9 1 1 3 22 6 1 4 5 5 8 7 8 8 E1.0 DEMOLITION PLAN AGENDA ITEM #5. d) RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 DEMOLITION NOTES: DEMOLISH ALL CONDUIT AND WIRE ROUTED BETWEEN GENERATOR AND ATS. DEMOLISH GENERATOR AND ALL APPURTENANCES AS DETAILED ON SHEET E1.0. SCALE:NONE EMERGENCY POWER SYSTEM ONE-LINEUTILITY SOURCE 200A,3P,35K800A,3P,50K70A,3P,35K600A,3P,35K800A,3P,50KLEVEL 1 PARKING PANEL ER 100A 7TH FLOOR & ROOF (NEW 208Y/120V PANEL IN ELEVATOR MACHINE ROOM) (EXISTING ON 7TH FLOOR) PANEL X1 80A 15 KVA XT1 2"C, 3#4/0 AL & 1#6 AL 1"C, 3#10 CU & 1#10 GND LEVEL 2 PARKING PANEL EDP MLO PANEL XTP1 100A 208Y/120VG 114"C, 4#2 CU 80KW GENERATOR 1ST FLOOR 10/29/2019 PLAN REVIEW CONDUIT #SETS CONDUCTORS CONDUIT SIZE 11 3#3/0 CU & 1#2 CU 2"C 1 2 3 45PANEL H2,H4,H6PANEL GPANEL H7BUS DUCT2500A,3P,65K 480V 120/240V 480V 800A,3P,50K6 PANEL MDP 800A PANEL S 200A 75 KVA 208Y/120V PANEL EDP2 MLO PANEL XJ-1 100A 208Y/120V G 80KW GENERATOR 480V 480V 30 KVA PANEL X2 50A 120/240V 480V TAP BOX 2 2 2 - 750 MCM AL EACH PH ?? 3 1 4#4 CU 114"C 2 2 - 500 MCM AL EACH PH ??4 5 6 7 8 9 10 PANELS SERVED EDP H2,H4,H6 G H7 2 BUS DUCT 2MDP 1EDP2 -PANEL S 2 - 750 MCM AL EACH PH 2 - 500 MCM CU EACH PH 3/4"C, 2#8 1 1"C, 3#8 114"C, 4#2 & 1#6 GND TO PANEL "CT" @ 7TH FLOOR/ROOF LEVEL 10 TO MDP-J TO MP-1 7 7 7 1"C, 4#6 & 1#8 GND 114"C, 4#2 & 1#6 GND 114"C, 3#6 & 1#10 GND 34"C, 4#8 & 1#10 GND ?? 4"C 4#4/0 & 1#4 GND 3"C 7 SWITCHBOARD 3 - 500 MCM CU & 1#4/0 CU EACH PH 3"C 1 FIRE PUMP CONDUIT/WIRE SCHEDULE PANEL EMR 60A 15 KVA SQUARE D MINI-POWER ZONE PANEL XJE 60A 208Y/120V480V 30 KVA 1"C, 3#8 114"C, 4#6 TAP BOX PANEL XTP2 50A 15 KVA CUTLER HAMMER MINI-POWER CENTER CT CAN 400A/400AF 3PSN,600V DISCONNECT METER FIRE PUMP CONTROLLER CONNECTION 50HP TO PSPL TRANSFORMER 3#4 CU & 1#4 GND 114"C 9 9 8 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 ???? 3#1/0 3#1/0 1 E1.1 1 1 1 PANEL "ER" FEED THRU LUGGED XT2A 30 KVA XFER SWITCH 225A, 480V 3Ø,4W XFER SWITCH 225A, 480V 3Ø, 4W XFER SWITCH 104A, 480V 3Ø, 4W XT1A15 KVA SERVICE SWITCHBOARD (E) 2500A, 480/277V, 3Ø, 4W 200A 175AF 27,200 SCA E1.1 DEMOLITION ONE-LINE DIAGRAM AGENDA ITEM #5. d) 1 2 J H ATS 'EDP' ATS 'EDP-2' ATS PANEL 'S'JUNCTION BOX JUNCTION BOX JUNCTION BOX PANEL EDP PANEL EDP-2 NEW BATTERY CHARGER 2 - 2 12"C, 4#3/0 & 1#4 GND EA 2 3 1 6 5 3/4"C, 3#12 TYP 212"C, 4#4/0 & 1#4 GND 2"C, 3#1/0 CU & 1#8 GND 114"C, 3#6 CU & 1#6 GND 7 8 8 8 JACKET HEATER BATTERY CHARGER NEW 250kW GENERATOR 5 8 NEW ATS PANEL 'X5' 2"C, 3#3/0 CU & 1#2 CU 120 GALLON DAY TANK DT - 1 T 114"C, 4#8 & 1#8 GND 1"C, 3#10 & 1#8 GND NEW PANEL XG-1 100A, 208Y/120V, 50A MB NEW 15KVA XFMR XTG-1 480V:208Y/120V NEW 60A, 3P, 480V HEAVY DUTY DISCONNECT SWITCH 9 1"C, 2#8 & 1#8 GND 400A MANUAL TRANSFER SWITCH NEW 400A, 480Y/277V 3Ø, 4-WIRE GENERATOR PANEL MLO 4 ATS EDP PANEL EDP JUNCTION BOX JUNCTION BOX NEW GENERATOR ELECTRICAL PANEL NEW 250kW GENERATOR PANEL EDP-2 ATS EDP-2 ATS PANEL 'S' NEW BATTERY CHARGER NEW ATS PANEL 'EDP-3' 120 GALLON DAY TANK DT - 1 RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATION2017035 CONSTRUCTION NOTES: INTERCEPT EXISTING CIRCUIT AT CEILING RECESSED JUNCTION BOX SERVING DEMOLISHED FIXTURES. PROVIDE EXTENSION RING AND COVER. CIRCUIT NEW FIXTURES AS SHOWN WITH 3/4"C, 3#12. PROVIDE EATON PRLIA TYPE PANEL, 480/277V, 400A, 3PH, 4W, MLO, 24 SPACE WITH A TOTAL OF 4 BREAKERS INSTALLED AS FOLLOWS: 1) 175A, 3P, 480V 2) 100A, 3P, 480V 3) 100A, 3P, 480V 4) 60A, 3P, 480V COORDINATE WITH GENERATOR MANUFACTURER FOR PROPER SHORT CIRCUIT CURRENT RATING OF PANEL AND ALL BREAKERS. GENERATOR SHALL BE CUMMINS DIESEL 250kW DQDAA (313kVA), 480Y277V, 3Ø, 4 WIRE. ALTERNATOR SHALL HAVE A TEMPERATURE RISE OF 105°. COORDINATE WITH CUMMINS DISTRIBUTOR PRIOR TO ORDERING/PURCHASE TO VERIFY ALL REQUIRED ACCOUTREMENTS ARE PROVIDED AND ARE CODE COMPLIANT FOR USE INTENDED. PROVIDE REMOTE ANNUNCIATOR WITH ENCLOSURE. PROVIDE 400A, 600V, 3Ø, 4-WIRE MANUAL TRANSFER SWITCH AND INSTALL PER ONE-LINE. RE-USE EXISTING 120V CIRCUIT THAT PREVIOUSLY SERVED THE BATTERY CHARGER TO CIRCUIT NEW BATTERY CHARGER IN SAME LOCATION. EXTEND/REMAKE ALL CONDUIT/WIRE AS REQUIRED TO MAKE NEW CONNECTIONS. RE-USE EXISTING GROUND CONNECTION AT THIS LOCATION TO GROUND NEW DAY TANK AND GENERATOR BASE PER CURRENT CODES. PROVIDE NEW #2 BARE COPPER WIRE. PROVIDE MOLDED COVER CABLE PROTECTOR BETWEEN EXISTING GROUND CONNECTION AND NEW GENERATOR UNIT (GUARD DOG LOW PROFILE OR SIMILAR). PROVIDE ADDITIONAL #2 GROUND WIRE FROM GROUND AT PANEL EDP IF REQUIRED. RE-USE EXISTING 120V CIRCUIT (P1/31) THAT PREVIOUSLY SERVED THE GENERATOR JACKET HEATER OF PREVIOUS GENERATORS TO SERVE NEW GENERATOR. FIELD VERIFY EXISTING CIRCUIT. PROVIDE NEW CONDUIT/WIRE TO EXTEND CIRCUIT TO NEW GENERATOR AND REMAKE ALL CONNECTIONS. ROUTE 1/2"C, 6#16 BETWEEN ATS AND GENERATOR. 2#16 FOR GENERATOR START SIGNAL, 2#16 FOR BATTERY VOLTAGE REFERENCE SIGNAL AND 2#16 SPARE. PROVIDE NEW 40A, 3P BREAKER IN EXISTING SPACES OF PANEL EDP. PROVIDE BREAKER TO MATCH MAKE, MODEL AND KAIC OF EXISTING BREAKERS. PANEL IS RATED 35KAIC. CHECKED: DRAWN: REVISION: DATE: ISSUE: CEM MDLV --- 12/21/18 BID 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTGENERATOR INSTALLATION PLAN GENERATOR ROOM EAST WALL ELEVATION VIEW1 E2.0 2 E2.0 1/2"=1'-0" 1/2"=1'-0" 1 2 3 4 5 6 7 1 E2.0 8 E2.0 GENERATOR SIZING CALCS & INSTALLATION PLAN GENERATOR STEP LOADS: 1) ATS EDP2 SHALL BE PLACED ON GENERATOR DURING THE 1ST STEP, WITHIN 10 SECONDS. 2) ATS EDP-2 SHALL BE PLACED ON GENERATOR DURING THE 1ST STEP, WITHIN 10 SECONDS. 3) ATS PANEL S SHALL BE PLACED ON GENERATOR DURING THE 2ND STEP, WITHIN 60 SECONDS. 4) ATS X5 SHALL BE PLACED ON GENERATOR DURING THE 2ND STEP, WITHIN 60 SECONDS. 9 AGENDA ITEM #5. d) CONSTRUCTION NOTES: SEE FLAGNOTE #3 SHEET E2.0 FOR GENERATOR DESCRIPTION AND RELATED WORK. PROVIDE 400A, 600V MANUAL TRANSFER SWITCH, ASCO 300 SERIES OR EQUAL. SEE FLAGNOTE #2 SHEET E2.0 FOR GENERATOR ELECTRICAL PANEL DESCRIPTION AND RELATED WORK. PROVIDE 3 POLE 60A, 480V BREAKER IN PANEL MDP TO MATCH MAKE, MODEL AND KAIC OF EXISTING BREAKERS. PROVIDE 3 POLE 40A, 480V BREAKER IN PANEL EDP TO MATCH MAKE, MODEL AND KAIC OF EXISTING BREAKERS. PROVIDE DISCONNECT, TRANSFORMER AND PANEL AS SHOWN. INSTALL EQUIPMENT IN 4TH FLOOR AND 5TH FLOOR JANITORIAL CLOSET AS REQUIRED FOR SPACE. ALTERNATIVE IS TO INSTALL IN 5TH FLOOR ELECTRICAL ROOM IF SPACE IS AVAILABLE. EMERGENCY POWER SYSTEM ONE-LINEUTILITY SOURCE LEVEL 1 PARKING PANEL ER 100A 7TH FLOOR & ROOF (NEW 208Y/120V PANEL IN ELEVATOR MACHINE ROOM) (EXISTING ON 7TH FLOOR) PANEL X1 80A2"C, 3#4/0 AL & 1#6 AL 1"C, 3#10 CU & 1#10 GND LEVEL 2 PARKING PANEL EDP 225A MLO PANEL XTP1 100A 208Y/120V G 250KW GENERATOR 1ST FLOOR CONDUIT #SETS CONDUCTORS CONDUIT SIZE 1 1 3#3/0 CU & 1#2 CU 2"C 1 2 3 45PANEL H2,H4,H6PANEL GPANEL H7BUS DUCT2500A,3P,65K 480V 120/240V 480V 6 PANEL MDP 800A PANEL S 200A 75 KVA 208Y/120V PANEL EDP2 100A MLO PANEL XJ-1 100A 208Y/120V 480V 480V 30 KVA PANEL X2 50A 120/240V 480V TAP BOX 2 2 2 - 750 MCM AL EACH PH ?? 3 1 4#4 CU 114"C 2 2 - 500 MCM AL EACH PH ??4 5 6 7 8 9 10 PANELS SERVED PANEL EDP PANELS H2,H4,H6 PANEL G PANEL H7 2 BUS DUCT 2 PANEL MDP 1 PANEL EDP2 PANEL S 2 - 750 MCM AL EACH PH 2 - 500 MCM CU EACH PH 3/4"C, 2#8 1 1"C, 3#8 114"C, 4#2 & 1#6 GND TO PANEL "CT" @ 7TH FLOOR/ROOF LEVEL 10 7 7 1"C, 4#6 & 1#8 GND 114"C, 4#2 & 1#6 GND 114"C, 3#6 & 1#10 GND 34"C, 4#8 & 1#10 GND ?? 4"C 4#4/0 & 1#4 GND 3"C 7 SWITCHBOARD 3 - 500 MCM CU & 1#4/0 CU EACH PH 3"C 1 FIRE PUMP CONDUIT/WIRE SCHEDULE PANEL EMR 60A 15 KVA SQUARE D MINI-POWER ZONE PANEL XJE 60A 208Y/120V480V 30 KVA 1"C, 3#8 114"C, 4#6 TAP BOX PANEL XTP2 50A 15 KVA CUTLER HAMMER MINI-POWER CENTER CT CAN 400A/400AF 3PSN,600V DISCONNECT METER FIRE PUMP CONTROLLER CONNECTION 50HP TO PSPL TRANSFORMER 3#4 CU & 1#4 GND 114"C 9 9 3#1/0 & 1#8 GND 2" 3#1/0 3#1/0 1 E2.1 1 1 PANEL GEN 400A MLO 1 8 7 3 XT1 15 KVA XFER SWITCH 225A, 480V 3Ø,4W XT2A 30 KVA SERVICE SWITCHBOARD (E) 2500A, 480/277V, 3Ø, 4W XFER SWITCH 225A, 480V 3Ø,4W XFER SWITCH 104A, 480V 3Ø, 4W DISCONNECT 200A, 175AF SCALE:NONE TO MDP-J TO MP-1 1 27,200 SCA 2 5TH FLOOR XFER SWITCH 100A, 480V 3Ø,4W12 11 PANEL X5 225A 150A MB 208Y/120V 480V XT5 45 KVA 12 2"C, 4#1/0 CU & 1#6 GND 114"C, 3#4 CU & 1#6 GND 11 2 GEN TO MTS & PANEL GEN 4#3/0 & 1#4 GND EA 2 12"C 12 1 TO PANEL X5 112"C 13 14 3#4 CU & 1#4 GND70A, 3P, 35K800A, 3P, 50K800A, 3P, 50K600A, 3P, 35K800A, 3P, 50K200A, 3P, 35K4 3 PANEL XG-1 100A 50A MB 208Y/120V 480V XTG-1 15 KVA 114"C, 4#8 CU & 1#8 GND 1"C, 3#10 & 1#8 GND NEW 60A, 3P, 480V HEAVY DUTY DISCONNECT SWITCH 13 1 TO PANEL XG-1 3#10 CU & 1#8 GND 1"C 5 4 26,901 SCA 13,660 SCA 2,904 SCA NEW 60A, 60AF, 3P, 480V HEAVY DUTY FUSED DISCONNECT SWITCH 12 11 400A, 600V MANUAL TRANSFER SWITCH 2 5 6 6 6 6 RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/29/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 E2.1 INSTALLATION ONE-LINE DIAGRAM AGENDA ITEM #5. d) INSTALLATION NOTES: CONDUIT/CABLE ROUTED DOWN TO CONTROL PANEL OF NEW GENERATOR. SURFACE MOUNTED CONDUIT ROUTED BETWEEN GENERATOR AND EXISTING FIRE CONTROL ROOM. CONDUIT/CABLE ROUTED UP TO FIRE CONTROL ROOM. FIELD VERIFY BEST LOCATION TO CORE HOLE THROUGH FLOOR WITH EXISTING CONDITIONS IN FIRE CONTROL ROOM ON FIRST FLOOR. FIELD VERIFY BEST LOCATION TO INSTALL GENERATOR ANNUNCIATOR PANEL IN THE FIRE CONTROL ROOM WITH THE OWNER PRIOR TO INSTALLATION. SEE SHEET E2.3 FOR PLAN SHOWING LOCATION OF FIRE CONTROL PANEL ON FIRST FLOOR. 1 2 5' 20' 10' 40' SCALE 1" = 20' 0' 3 1 2 3 3/4"C, 1 BELDEN 9729 4.RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/29/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTELECTRICAL GENERATOR ANNUNCIATOR PLAN1 E2.2 1"=20'-0" E2.2 GENERATOR ANNUNCIATOR ROUTING PLAN AGENDA ITEM #5. d) INSTALLATION NOTES: EXISTING FIRE CONTROL ROOM. COORDINATE WITH OWNER FOR LOCATION OF NEW GENERATOR ANNUNCIATOR PANEL. SEE SHEET E2.2 FOR ASSOCIATED WORK. 1 1 RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/29/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTFIRST FLOOR PLAN - FOR REFERENCE ONLY1 E2.3 SCALE:NTS E2.3 FIRST FLOOR PLAN [REFERENCE ONLY] AGENDA ITEM #5. d) EXISTING ELECTRICAL / PHONE 529 JANITOR 528 T T 75 KVA 45 KVA PNL P5 PNL P5-1 PNL L-5 BUS RISER ELEVATOR LOBBY 527 CONFERENCE 511 COPY 514 UPS X5 / 2 X5 / 1 (N) PNL X5 (E) (N) (N) (N) X5 / 3,5 T RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/30/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTFIFTH FLOOR ELECTRICAL ROOM1 E2.4 1/4"=1'-0" CONSTRUCTION NOTES: INSTALL NEW PANEL X5 WHERE SHOWN. ALTERNATE LOCATION IS IN ADJACENT ELECTRICAL ROOM IF THERE IS SPACE. TRANSFORMER AND DISCONNECT MAY BE LOCATED ON FLOOR BELOW. FIELD VERIFY BEST ROUTE TO INSTALL CONDUIT/WIRE RISER SERVING NEW PANEL AND LOCATION OF DISCONNECT, TRANSFORMER AND PANEL. COORDINATE WITH OWNER PRIOR TO INSTALLATION. SEE ALSO ONE-LINE DIAGRAM. ROUTE 3/4"C, 3#12 TO NEW PANEL X5 TO PROVIDE POWER FOR MOOVIN-COOLS FROM THE NEW GENERATOR. PROVIDE NEW (RED) DUPLEX OUTLET AND LABELING. ROUTE 1 1/4"C, 3#3 AND GND TO PANEL X5 FOR EMERGENCY POWER TO SERVE THE UPS VIA A NEW 100A, 3P, 240V, HEAVY DUTY DISCONNECT SWITCH. 1 1 2 2 3 2 3 E2.4 FIFTH FLOOR POWER PLAN 3 AGENDA ITEM #5. d) RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 E2.5 PANEL SCHEDULES 10/30/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 PANEL SCHEDULES1 E2.5 (SCALE:NONE) CONSTRUCTION NOTES: --------1 AGENDA ITEM #5. d) J J J J J RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 ELEVATOR MODERNIZATIONCHECKED: DRAWN: REVISION: DATE: ISSUE: CEM CEM --- 2017035 10/30/2019 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 E2.6 MISC. DETAILS SCALE: BOLLARD DETAIL 1" = 1'-0"2 CONCRETE FILL 4" DIA SCHED. 40 STEEL PIPE HIGH VISIBILITY YELLOW PAINT FINISH GRADE CONCRETE BASE 2'-0" 4'-0" 12" SCALE: BELOW GRADE CONDUIT DETAIL 1-1/2" = 1'-0"3 24"(MIN) 12" LOCATION TAPE SCHED 40 PVC SOIL BACKFILL (PAVED) FINISHED GRADE SCALE: POWER & SIGNAL CONDUITS NTS 1 INTERMEDIATE SUMP WITH LEAK DETECTION TO POWER PANEL XG-1 GRADE DAY TANK 250kW GENERATOR CONTROLS CONDUIT 1"C CONTROLS CONDUIT 1"C POWER CONDUIT NOTES: 1 PROVIDE WIRING PER VENDOR SHOP DRAWINGS. 2 FIELD VERIFY EXACT ROUTING AND CONNECTION. 3 ALL WORK IS CONSIDERED TO BE CLASS II ENVIRONMENT. 4 ALL OUTDOOR JUNCTION BOXES SHALL BE CAST AND WEATHER PROOF. 5 ALL OUTDOOR CONDUITS SHALL BE RIGID STEEL. DETAILS ON THIS SHEET ARE CONCEPTUAL IN NATURE AND ARE FOR GUIDANCE ONLY, INTENDED TO CONVEY THE PROJECT SCOPE OF WORK TANK FUEL OIL POLISHER CONTROLLER TANK FUEL OIL MONITORING & PUMP CONTROLLER POWER CONDUIT INTERMEDIATE SUMP WITH LEAK DETECTION GTLC-1 LEAK DETECTION AND LEVEL CONTROLLER DAY TANK LEVEL AND RETURN PUMP CONTROLLER 1500 GALLON ENVIROSAFE DIESEL FUEL TANK FLLC-1 GENERATOR CONTROLLER GEN REMOTE ANNUNCIATOR TO BUILDING DDC CONTROLS AGENDA ITEM #5. d) ABBREVIATIONS A AIR, AMP ACU AIR CONDITIONING UNIT AFF ABOVE FINISHED FLOOR AHU AIR HANDLING UNIT AL ALUMINUM, ACOUSTICAL LINING ARRGT ARRANGEMENT ATM ATMOSPHERE BC BLOWER COIL BDD BACKDRAFT DAMPER BFF BELOW FINISHED FLOOR BFP BACKFLOW PREVENTER BHP BRAKE HORSEPOWER BLDG BUILDING BOB BOTTOM OF BEAM BOD BOTTOM OF DUCT BOS BOTTOM OF STEEL BTUH BRITISH THERMAL UNITS PER HOUR CAP CAPACITY CC COOLING COIL CD CEILING DIFFUSER CFM CUBIC FEET PER MINUTE CHR CHILLED WATER RETURN CHS CHILLED WATER SUPPLY CI CAST IRON CLG CEILING, COOLING CNTFGL CENTRIFUGAL CO CLEANOUT CONC CONCRETE COND CONDENSATE CONT CONTINUE, CONTROL COMP COMPRESSOR COP COEFFICIENT OF PERFORMANCE CP CIRCULATING PUMP CRU CONDENSATE RETURN UNIT CU CONDENSING UNIT CU FT CUBIC FEET CV CONSTANT VOLUME CVTR CONVERTER CW COLD WATER CWR CONDENSER WATER RETURN CWS CONDENSER WATER SUPPLY dB DECIBELS DB DRY BULB DCVA DOUBLE CHECK VALVE ASSEMBLY DEG DEGREE DF DRINKING FOUNTAIN DI DE-IONIZED DIA DIAMETER DMPR DAMPER DN DOWN DS DOWNSPOUT E EXISTING EA EXHAUST AIR EAT ENTERING AIR TEMPERATURE EER ENERGY EFFICIENCY RATING EF EXHAUST FAN EFF EFFICIENCY EG EXHAUST GRILLE EL ELEVATION EQUIP EQUIPMENT ESP EXTERNAL STATIC PRESSURE EWT ENTERING WATER TEMPERATURE EXH EXHAUST EWC ELECTRIC WATER COOLER EXIST EXISTING EXP EXPANSION EXT EXTERIOR, EXTERNAL F FAHRENHEIT, FIRE LINE FD FIRE DAMPER, FLOOR DRAIN FDC FIRE DEPARTMENT CONNECTION FLA FULL LOAD AMPS FLR FLOOR FLTR FILTER FM FLOW METER FOB FLAT ON BOTTOM FO FLAT OVAL FOT FLAT ON TOP FPM FEET PER MINUTE FPS FEET PER SECOND FSD FIRE SMOKE DAMPER FT FEET, FAN TERMINAL FV FACE VELOCITY GA GAGE GAL GALLONS GALV GALVANIZED GPM GALLONS PER MINUTE H HUMIDIFIER, HEIGHT HB HOSE BIBB HC HEATING COIL HD HEAD HEX HEAT EXCHANGE HOA HAND-OFF-AUTOMATIC HP HORSEPOWER, HEAT PUMP HPS HIGH PRESSURE STEAM HTG HEATING HW HOT WATER HWC HOT WATER CIRCULATING HWP HOT WATER PUMP HWR HEATING WATER RETURN HWS HEATING WATER SUPPLY HZ HERTZ ID INSIDE DIAMETER, INDIRECT DRAIN IE INVERT ELEVATION IH INTAKE HOOD IN INCH INIT INITIAL INT INTERIOR IPLV INTEGRATED PART LOAD VALUE KW KILOWATT KWH KILOWATT HOURS LLENGTH LAT LEAVING AIR TEMPERATURE LB POUND, LINEAR BAR LBS POUNDS LD LINEAR DIFFUSER LWT LEAVING WATER TEMPERATURE MAX MAXIMUM MBH THOUSAND BTU PER HOUR MCA MINIMUM CIRCUIT AMPACITY MD MANUAL DAMPER MECH MECHANICAL MFR MANUFACTURER MIN MINIMUM MOCP MAXIMUM OVER CURRENT PROTECTION MOD MOTOR OPERATED DAMPER MTR MOTOR NC NORMALLY CLOSED NEG NEGATIVE NIC NOT IN CONTRACT NO NUMBER, NORMALLY OPEN NTS NOT TO SCALE OA OUTDOOR AIR OC ON CENTER OD OUTSIDE DIAMETER OPNG OPENING ORD OVERFLOW ROOF DRAIN ORL OVERFLOW RAIN LEADER P PUMP, PLUMBING PD PRESSURE DROP PH PHASE POC POINT OF CONNECTION POS POSITIVE PR PUMPED RETURN P/T PRESSURE/TEMPERATURE PVC POLYVINYL CHLORIDE QTY QUANTITY RA RETURN AIR RD ROOF DRAIN REF REFERENCE REQD REQUIRED RF RETURN FAN RG RETURN GRILLE RH RELIEF HOOD, RELATIVE HUMIDITY RL RAIN LEADER RPBFP REDUCED PRESSURE BACKFLOW PREVENTER RPM REVOLUTIONS PER MINUTE SSOIL SA SUPPLY AIR SD STORM DRAIN, SMOKE DAMPER SENS SENSIBLE SEER SEASONAL ENERGY EFFICIENCY RATING SF SUPPLY FAN, SQUARE FEET SG SUPPLY GRILLE SL SOUNDLINING SP STATIC PRESSURE SPR SPRINKLER SS STAINLESS STEEL, SANITARY SEWER STP STANDPIPE T THERMOSTAT TEMP TEMPERATURE TG TRANSFER GRILLE TOD TOP OF DUCT TOT TOTAL TP TRAP PRIMER, TOTAL PRESSURE TSP TOTAL STATIC PRESSURE TU TERMINAL UNIT TYP TYPICAL UH UNIT HEATER UON UNLESS OTHERWISE NOTED V VENT, VOLT VA VALVE VAV VARIABLE AIR VOLUME VEL VELOCITY VFD VARIABLE FREQUENCY DRIVE VTR VENT THROUGH ROOF W WASTE, WATER, WATT, WIDTH WB WET BULB WG WATER GAGE WH WATER HEATER, WALL HYDRANT WTR WATER GENERAL NOTES 1. THE SCOPE OF THE MECHANICAL WORK CONSISTS OF WORK SHOWN ON THE PLANS AND AS DESCRIBED IN THE SPECIFICATIONS. IN CASE OF CONFLICT, THE SPECIFICATIONS SHALL GOVERN. PROVIDE A COMPLETE & FUNCTIONAL SYSTEM. 2. PERFORM ALL WORK IN ACCORDANCE WITH LOCAL CODES AND ORDINANCES. OBTAIN AND PAY FOR ALL REQUIRED PERMITS AND PAY FOR ALL FEES REQUIRED BY AUTHORITIES HAVING JURISDICTION. PAY ALL ROYALTIES OR FEES REQUIRED IN CONNECTION WITH THE USE OF PATENTED DEVICES AND SYSTEMS. 3. REFER TO ARCHITECTURAL AND STRUCTURAL DRAWINGS FOR GENERAL CONSTRUCTION INCLUDING LOUVERS, CONCRETE EQUIPMENT PADS, FLASHING DETAILS, ETC. REFER TO ARCHITECTURAL DRAWINGS FOR ROOM ELEVATIONS, LOCATE MECHANICAL DEVICES SUCH AS TEMPERATURE SENSORS, HUMIDISTATS, PANELS, ETC. SO THAT THEY DO NOT CONFLICT WITH GENERAL CONSTRUCTION (WAINSCOT, DOOR HARDWARE, ETC.) NOR WITH ELECTRICAL SYSTEM (LIGHT SWITCHES, SPEAKERS, OUTLETS, ETC.). 4. COORDINATE WITH OTHER TRADES: A. REFER TO ELECTRICAL DRAWINGS AND CONFIRM ELECTRICAL CHARACTERISTICS SHOWN FOR MECHANICAL EQUIPMENT (VOLTAGE, PHASE, HZ, ETC). MATCHES THAT OF THE MECHANICAL EQUIPMENT PROVIDED. B. PROVIDE ADEQUATE CLEARANCE OF MECHANICAL WORK FROM ELECTRICAL EQUIPMENT. MAINTAIN MINIMUM ACCESS OF 6-INCHES ABOVE CABLE TRAYS AND 18-INCHES TO THE SIDE OF CABLE TRAYS. CLEARANCE ABOVE CABLE TRAY SHOULD BE 1/2 THE WIDTH AND NOT LESS THAN 6-INCHES WHEN RUNNING PARALLEL WITH CABLE TRAY. AND NOT LESS THAN 6-INCHES WHEN RUNNING PERPENDICULAR TO THE CABLE TRAY. 5. ARRANGE EQUIPMENT SO THAT ACCESS CLEARANCES INDICATED BY DRAWINGS, REQUIRED BY CODES, OR RECOMMENDED BY MANUFACTURER ARE PROVIDED. 6. INSTALL MATERIALS AND SYSTEMS IN ACCORDANCE WITH MANUFACTURER'S INSTRUCTIONS AND ACCEPTED SUBMITTALS. INSTALL MATERIAL IN PROPER RELATION TO ADJACENT CONSTRUCTION AND WITH UNIFORM APPEARANCE FOR EXPOSED WORK. 7. THOROUGHLY EXAMINE ALL AREAS WHERE EQUIPMENT, DUCTWORK, AND PIPING WILL BE INSTALLED AND REPORT ANY CONDITION THAT PREVENTS THE PROPER INSTALLATION OF THE MECHANICAL WORK. 8. THE COMMISSIONING SPECIFICATION, INCLUDING ALL FUNCTIONAL TEST PROCEDURES, SHALL BE PROVIDED AND ENFORCED BY THE CONTRACTOR. 9. PROVIDE SEISMIC RESTRAINT IN ACCORDANCE WITH IBC AND ASCE STANDARD 7. SUBMIT CALCULATIONS BY LICENSED STRUCTURAL ENGINEER. PRODUCTS MAY CONFORM TO SMACNA SEISMIC RESTRAINT GUIDELINES. 10. PROVIDE A SINGLE SUBMITTAL OF ALL MECHANICAL EQUIPMENT AS SPECIFIED. AS A MINIMUM, SUBMIT PRODUCT DATA FOR ALL EQUIPMENT AND FIXTURES LISTED IN ACCOMPANYING SCHEDULES FOR APPROVAL. 11. USE EXPERIENCED INSTALLERS. DELIVER, HANDLE, AND STORE MATERIALS IN ACCORDANCE WITH MANUFACTURER'S INSTRUCTIONS. 12. ARRANGEMENT OF SYSTEMS INDICATED ON THE DRAWINGS IS DIAGRAMMATIC, AND INDICATES THE MINIMUM REQUIREMENTS FOR PLUMBING AND MECHANICAL WORK. ADJUST TERMINAL UNIT LOCATIONS, BASED ON FIELD MEASUREMENTS, TO AVOID INSTALLATION ABOVE DESKS. SITE CONDITIONS SHALL DETERMINE THE ACTUAL ARRANGEMENT OF THE WORK. TAKE FIELD MEASUREMENTS BEFORE PREPARING SHOP DRAWINGS, OBTAIN APPROVAL OF SHOP DRAWINGS BEFORE BEGINNING FABRICATION. BE RESPONSIBLE FOR ACCURACY OF DIMENSIONS AND LAYOUT. OVERHEAD PIPING AND DUCTWORK SHALL BE ARRANGED TO OBTAIN MAXIMUM HEAD ROOM. 13. CLEAN AND PROTECT WORK FROM DAMAGE. RESTORE DAMAGED FINISHES. COVER ENDS OF PIPING AND DUCTWORK NOT ACTIVELY BEING WORKED ON. 14. MODIFY AND EXTEND EXISTING SERVICE TO ACCOMMODATE NEW WORK. RELOCATE EXISTING COMPONENTS AS REQUIRED FOR NEW SYSTEM. COORDINATE WITH BUILDING MANAGEMENT. 15. PROVIDE PRODUCTS OF ACCEPTABLE MANUFACTURERS, WHICH HAVE BEEN IN SATISFACTORY USE IN SIMILAR SERVICE FOR THREE YEARS. DELIVER, HANDLE, AND STORE MATERIALS IN ACCORDANCE WITH MANUFACTURER'S INSTRUCTIONS. 16. DO NOT CUT STRUCTURAL ELEMENTS WITHOUT PRIOR WRITTEN APPROVAL. 17. CONCEAL PIPING AND DUCTWORK TO THE GREATEST EXTENT POSSIBLE. 18. INSTRUCT OWNER IN PROPER OPERATION OF SYSTEMS. 19. DRAWINGS DO NOT SHOW ALL OFFSETS WHICH MAY BE REQUIRED. MAKE OFFSETS WITH FITTINGS USING THE LEAST ANGLE OF OFFSET POSSIBLE. DUCTWORK & PIPING SHALL BE ROUTED TO AVOID ALL STRUCTURAL SUPPORTS, AND COORDINATED WITH WORK OF OTHER TRADES. 20. MATERIALS, METHODS, AND INSTALLATION SHALL COMPLY WITH THE PROVISIONS OF THE LATEST EDITION OF THE FOLLOWING CODES AS ADOPTED BY THE AUTHORITY HAVING JURISDICTION. INTERNATIONAL BUILDING CODE (IBC) INTERNATIONAL MECHANICAL CODE (IMC) UNIFORM PLUMBING CODE (UPC) INTERNATIONAL FIRE CODE (IFC) SHEET METAL NOTES 1. PERFORM ALL SHEET METAL WORK IN ACCORDANCE WITH CURRENT SMACNA STANDARDS. 2. DUCT SEALING SHALL MEET REQUIREMENTS LISTED IN CHAPTER 6 OF IMC AND WASHINGTON STATE ENERGY CODE WITH LOCAL AMENDMENTS. IN ADDITION, PROVIDE SEAL CLASS A FOR ALL DUCTWORK. 3. CONSTRUCT DUCTS WITH G-90 OR BETTER GALVANIZED STEEL (ASTM 527) LFQ. 4. CONSTRUCT RECTANGULAR DUCTWORK TO MEET ALL FUNCTIONAL CRITERIA DEFINED IN CHAPTER 11, OF THE SMACNA HVAC DUCT CONSTRUCTION STANDARDS. PROVIDE DIAGONAL CREASING OR BEADING ON ALL PANELS WIDER THAN 18-INCHES, AND PANELS LESS THAN 18 GAGE. CONSTRUCT ROUND AND FLAT OVAL DUCTWORK IN ACCORDANCE WITH CHAPTER 3 OF SMACNA HDCS. 5. DUCTMATE, METU, OR W.D.C.I. DUCT CONNECTION SYSTEMS ARE ACCEPTABLE. DUCTS CONSTRUCTED USING THESE SYSTEMS WILL REFER TO THE MANUFACTURER'S GUIDELINES FOR SHEET GAGE, INTERMEDIATE REINFORCEMENT SIZE AND SPACING, AND JOINT REINFORCEMENTS. 6. PROVIDE COLLARS WHEREVER AN EXPOSED DUCT PASSES THROUGH A WALL, SLAB, OR CEILING:1-INCH WIDE, 18-GAGE ANGLE WITH MITERED CORNERS & SEAL WITH FIBERGLASS AND MASTIC. 7. ELBOWS IN RECTANGULAR OR SQUARE DUCTWORK SHALL HAVE AN INSIDE RADIUS EQUAL TO DIMENSION OF ELBOW IN THE PLANE OF THE TURN. 8. ELBOWS IN ROUND DUCTWORK SHALL HAVE THE INSIDE RADIUS EQUAL TO DIMENSION OF ELBOW IN THE PLANE OF THE TURN. USE SEGMENTED, STANDING SEAM, PLEATED, OR STAMPED ELBOWS. ADJUSTABLE ELBOWS ARE ALLOWED IF RADIUS CONFORMS TO ABOVE. 9. VOLUME DAMPERS ARE NOT SHOWN GENERALLY. INCLUDE A DAMPER IN THE DUCT TO EACH SUPPLY, EXHAUST, OR RETURN OPENING; ALSO IN EACH BRANCH DUCT WHERE THREE OR MORE OPENINGS ARE ASSOCIATED WITH THE BRANCH. LOCATE DAMPERS AT A POINT WHERE THE DUCT IS ACCESSIBLE; AS FAR FROM THE OUTLET AS POSSIBLE. DO NOT PROVIDE VOLUME DAMPER ON SUPPLY DUCTWORK UPSTREAM OF TERMINAL UNITS. DAMPERS SHALL BE RUSKIN MD25 OR MDRS25. 10. THOROUGHLY CLEAN ALL DEBRIS FROM THE INSIDE OF ALL DUCTWORK AND PLENUMS. 11. MECHANICAL DRAWINGS SHOW APPROXIMATE LOCATIONS. 12. CONNECT FLEXIBLE DUCTS TO METAL DUCTS WITH A SLIP JOINT MADE USING FIRE RESISTANT MASTIC AND CLAMP, IDEAL "SNAP-LOCK" OR VENTLOCK "SURETIGHT NO. 670" AT EACH END. SUPPORT IN ACCORDANCE WITH SMACNA HVAC DUCT CONSTRUCTION STANDARDS. DO NOT INSTALL WITH ABRUPT BENDS OR OFFSETS. MAXIMUM LENGTH 5-FEET. LOW PRESSURE INSULATED FLEXIBLE DUCT SHALL BE THERMAFLEX MK-E. HIGH PRESSURE INSULATED FLEXIBLE DUCT SHALL BE THERAMFLEX MK-C. FUEL OIL PIPING NOTES 1. COMPLY WITH ASME B31.9 2. COMPLY WITH SPEC SECTION 23-10-01 3. COMPLY WITH NFPA REQUIREMENTS PC PUMPED CONDENSATEPC CD CONDENSATE DRAINCD FLEXIBLE DUCT RECTANGULAR TO ROUND TRANSITION FOR NEW WORK PARALLEL BLADE DAMPER DIRECTION OF AIR FLOW POC MARK NUMBER (SEE SCHEDULE) EQUIPMENT TYPE (LETTER) EQUIPMENT MARK RETURN OR EXHAUST DUCT SECTION (FIRST NUMBER IS SIDE SHOWN) RECTANGULAR DUCT12x8 FLOW SWITCH THERMOSTAT (WALL MOUNTED) THERMOMETER UNION FS XXX ABC PLAN SHEET NUMBER SECTION SHEET NUMBER SECTION LETTER FIRE LINEFF A SYMBOLS LEGEND PRESSURE GAUGE COMPRESSED AIR LINEA ELBOW TURNED UP ELBOW TURNED DOWN POINT OF CONNECTION DETAIL NUMBER DETAIL SHEET NUMBER PLAN SHEET NUMBER T SYMBOL DESCRIPTION PIPING SPECIALTIES BUTTERFLY VALVE SWING CHECK VALVE WITH FLOW ANGLE GLOBE VALVE, ELEVATION / PLAN GLOBE VALVE, OPEN / CLOSED BALL VALVE, OPEN / CLOSED GATE VALVE, WITH HOSE CONNECTION GATE VALVE, OPEN / CLOSE GATE VALVE, OUTSIDE SCREW AND YOKE LIFT CHECK VALVE PRESSURE REGULATING VALVE W/EXT PRESS TAP PRESSURE REGULATING VALVE (SELF CONTAINED) PRESSURE RELIEF VALVE / SAFETY VALVE MOTOR OPERATED VALVE SOLENOID OPERATED VALVE NEEDLE VALVE BALANCE VALVE WITH METERING PORTS BALANCE VALVE W/O METERING PORTS 2 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR 3 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR PETCOCK FLOAT VALVE QUICK OPENING VALVE QUICK CLOSING VALVE, FUSIBLE LINK PLUG VALVE/STOP COCK FLOWMETER, VENTURI TYPE FLOWMETER ORIFICE AUTOMATIC AIR VENT (WITH DRAIN) MANUAL AIR VENT (WITH DRAIN) PRESSURE GAUGE WITH VALVE AIR OUTLET - HARD PIPE, SIMPLEX / DUPLEX PETE'S PLUG, WITH BALL VALVE BACKFLOW PREVENTER (NUMBER INDICATES GPM) AUTOMATIC FLOW CONTROL VALVE MECHANICAL PIPING LEGEND VALVE IN RISER (TYPE SPECIFIED) UNCLASSIFIED VALVE VALVE BOX WYE STRAINER (WITH DRAIN VALVE) THERMOMETER, LINE MOUNT THERMOMETER, SEPARABLE WELL MOUNT TEST PLUG VACUUM BREAKER PC PUMPED CONDENSATEPC CD CONDENSATE DRAINCD FLEXIBLE DUCT RECTANGULAR TO ROUND TRANSITION FOR NEW WORK PARALLEL BLADE DAMPER DIRECTION OF AIR FLOW POC MARK NUMBER (SEE SCHEDULE) EQUIPMENT TYPE (LETTER) EQUIPMENT MARK RETURN OR EXHAUST DUCT SECTION (FIRST NUMBER IS SIDE SHOWN) RECTANGULAR DUCT12x8 FLOW SWITCH THERMOSTAT (WALL MOUNTED) THERMOMETER UNION FS XXX ABC PLAN SHEET NUMBER SECTION SHEET NUMBER SECTION LETTER FIRE LINEFF A PRESSURE GAUGE COMPRESSED AIR LINEA ELBOW TURNED UP ELBOW TURNED DOWN POINT OF CONNECTION DETAIL NUMBER DETAIL SHEET NUMBER PLAN SHEET NUMBER T SYMBOL DESCRIPTION PIPING SPECIALTIES BUTTERFLY VALVE SWING CHECK VALVE WITH FLOW ANGLE GLOBE VALVE, ELEVATION / PLAN GLOBE VALVE, OPEN / CLOSED BALL VALVE, OPEN / CLOSED GATE VALVE, WITH HOSE CONNECTION GATE VALVE, OPEN / CLOSE GATE VALVE, OUTSIDE SCREW AND YOKE LIFT CHECK VALVE PRESSURE REGULATING VALVE W/EXT PRESS TAP PRESSURE REGULATING VALVE (SELF CONTAINED) PRESSURE RELIEF VALVE / SAFETY VALVE MOTOR OPERATED VALVE SOLENOID OPERATED VALVE NEEDLE VALVE BALANCE VALVE WITH METERING PORTS BALANCE VALVE W/O METERING PORTS 2 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR 3 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR PETCOCK FLOAT VALVE QUICK OPENING VALVE QUICK CLOSING VALVE, FUSIBLE LINK PLUG VALVE/STOP COCK FLOWMETER, VENTURI TYPE FLOWMETER ORIFICE AUTOMATIC AIR VENT (WITH DRAIN) MANUAL AIR VENT (WITH DRAIN) PRESSURE GAUGE WITH VALVE AIR OUTLET - HARD PIPE, SIMPLEX / DUPLEX PETE'S PLUG, WITH BALL VALVE BACKFLOW PREVENTER (NUMBER INDICATES GPM) AUTOMATIC FLOW CONTROL VALVE MECHANICAL PIPING LEGEND VALVE IN RISER (TYPE SPECIFIED) UNCLASSIFIED VALVE VALVE BOX WYE STRAINER (WITH DRAIN VALVE) THERMOMETER, LINE MOUNT THERMOMETER, SEPARABLE WELL MOUNT TEST PLUG VACUUM BREAKER RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENTCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/05/2020 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 M0.0 NOTES, LEGENDS, ABBREV. & DRAWING LIST AGENDA ITEM #5. d) PC PUMPED CONDENSATEPC CD CONDENSATE DRAINCD FLEXIBLE DUCT RECTANGULAR TO ROUND TRANSITION FOR NEW WORK PARALLEL BLADE DAMPER DIRECTION OF AIR FLOW POC MARK NUMBER (SEE SCHEDULE) EQUIPMENT TYPE (LETTER) EQUIPMENT MARK RETURN OR EXHAUST DUCT SECTION (FIRST NUMBER IS SIDE SHOWN) RECTANGULAR DUCT12x8 FLOW SWITCH THERMOSTAT (WALL MOUNTED) THERMOMETER UNION FS XXX ABC PLAN SHEET NUMBER SECTION SHEET NUMBER SECTION LETTER FIRE LINEFF A SYMBOLS LEGEND PRESSURE GAUGE COMPRESSED AIR LINEA ELBOW TURNED UP ELBOW TURNED DOWN POINT OF CONNECTION DETAIL NUMBER DETAIL SHEET NUMBER PLAN SHEET NUMBER T SYMBOL DESCRIPTION PIPING SPECIALTIES BUTTERFLY VALVE SWING CHECK VALVE WITH FLOW ANGLE GLOBE VALVE, ELEVATION / PLAN GLOBE VALVE, OPEN / CLOSED BALL VALVE, OPEN / CLOSED GATE VALVE, WITH HOSE CONNECTION GATE VALVE, OPEN / CLOSE GATE VALVE, OUTSIDE SCREW AND YOKE LIFT CHECK VALVE PRESSURE REGULATING VALVE W/EXT PRESS TAP PRESSURE REGULATING VALVE (SELF CONTAINED) PRESSURE RELIEF VALVE / SAFETY VALVE MOTOR OPERATED VALVE SOLENOID OPERATED VALVE NEEDLE VALVE BALANCE VALVE WITH METERING PORTS BALANCE VALVE W/O METERING PORTS 2 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR 3 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR PETCOCK FLOAT VALVE QUICK OPENING VALVE QUICK CLOSING VALVE, FUSIBLE LINK PLUG VALVE/STOP COCK FLOWMETER, VENTURI TYPE FLOWMETER ORIFICE AUTOMATIC AIR VENT (WITH DRAIN) MANUAL AIR VENT (WITH DRAIN) PRESSURE GAUGE WITH VALVE AIR OUTLET - HARD PIPE, SIMPLEX / DUPLEX PETE'S PLUG, WITH BALL VALVE BACKFLOW PREVENTER (NUMBER INDICATES GPM)AUTOMATIC FLOW CONTROL VALVE MECHANICAL PIPING LEGEND VALVE IN RISER (TYPE SPECIFIED) UNCLASSIFIED VALVE VALVE BOX WYE STRAINER (WITH DRAIN VALVE) THERMOMETER, LINE MOUNT THERMOMETER, SEPARABLE WELL MOUNT TEST PLUG VACUUM BREAKER PC PUMPED CONDENSATEPC CD CONDENSATE DRAINCD FLEXIBLE DUCT RECTANGULAR TO ROUND TRANSITION FOR NEW WORK PARALLEL BLADE DAMPER DIRECTION OF AIR FLOW POC MARK NUMBER (SEE SCHEDULE) EQUIPMENT TYPE (LETTER) EQUIPMENT MARK RETURN OR EXHAUST DUCT SECTION (FIRST NUMBER IS SIDE SHOWN) RECTANGULAR DUCT12x8 FLOW SWITCH THERMOSTAT (WALL MOUNTED) THERMOMETER UNION FS XXX ABC PLAN SHEET NUMBER SECTION SHEET NUMBER SECTION LETTER FIRE LINEFF A PRESSURE GAUGE COMPRESSED AIR LINEA ELBOW TURNED UP ELBOW TURNED DOWN POINT OF CONNECTION DETAIL NUMBER DETAIL SHEET NUMBER PLAN SHEET NUMBER T SYMBOL DESCRIPTION PIPING SPECIALTIES BUTTERFLY VALVE SWING CHECK VALVE WITH FLOW ANGLE GLOBE VALVE, ELEVATION / PLAN GLOBE VALVE, OPEN / CLOSED BALL VALVE, OPEN / CLOSED GATE VALVE, WITH HOSE CONNECTION GATE VALVE, OPEN / CLOSE GATE VALVE, OUTSIDE SCREW AND YOKE LIFT CHECK VALVE PRESSURE REGULATING VALVE W/EXT PRESS TAP PRESSURE REGULATING VALVE (SELF CONTAINED) PRESSURE RELIEF VALVE / SAFETY VALVE MOTOR OPERATED VALVE SOLENOID OPERATED VALVE NEEDLE VALVE BALANCE VALVE WITH METERING PORTS BALANCE VALVE W/O METERING PORTS 2 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR 3 WAY CONTROL VALVE W/PNEUMATIC ACTUATOR PETCOCK FLOAT VALVE QUICK OPENING VALVE QUICK CLOSING VALVE, FUSIBLE LINK PLUG VALVE/STOP COCK FLOWMETER, VENTURI TYPE FLOWMETER ORIFICE AUTOMATIC AIR VENT (WITH DRAIN) MANUAL AIR VENT (WITH DRAIN) PRESSURE GAUGE WITH VALVE AIR OUTLET - HARD PIPE, SIMPLEX / DUPLEX PETE'S PLUG, WITH BALL VALVE BACKFLOW PREVENTER (NUMBER INDICATES GPM)AUTOMATIC FLOW CONTROL VALVE MECHANICAL PIPING LEGEND VALVE IN RISER (TYPE SPECIFIED) UNCLASSIFIED VALVE VALVE BOX WYE STRAINER (WITH DRAIN VALVE) THERMOMETER, LINE MOUNT THERMOMETER, SEPARABLE WELL MOUNT TEST PLUG VACUUM BREAKER RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENTCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/05/2020 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 M0.1 SYMBOL LEGENDS AGENDA ITEM #5. d) 1 2 3 J H G FUEL OIL POLISHER CABINET WITH DUPLEX PUMP AND CONTROLLER FUEL OIL PUMP CONTROLLER FOR DUPLEX PUMP INTERMEDIATE SUMP WITH LEAK DETECTION 1 2 5 3 5 6 INTERMEDIATE SUMP WITH LEAK DETECTION 4 5 5 4 8 7 FILL POINT WITH AUTOMATIC FILL SHUT OFF VALVE 2 2 1 M1.0 M7.0 2 M2.0 RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENTCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/05/2020 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTNRCH MECHANICAL SITE PLAN1 M1.0 3/16"=1'-0" EXISTING BUILDING GENERATOR ROOM CONSTRUCTION NOTES: PROVIDE UNDERGROUND PIPING SYSTEM WITH DOUBLE CONTAINMENT FUEL PIPING FROM GENERATOR TO FUEL TANK. SLOPE PIPE AT 2% 1500 GALLON DIESEL ENVIROSAFE FUEL STORAGE TANK INTERMEDIATE SUMP - TWO (2) EQUIDISTANT BETWEEN TANK AND BUILDING LEAK DETECTOR TRANSITION SUMP PROVIDE CONCRETE MOUNTING PAD SIZED FOR 72 HOUR CONTINUOUS OPERATION SEE ARCHITECTURAL DWG'S FOR BOLLARD LAYOUT AND CIVIL SPECS FOR BOLLARD CRITERIA 1 2 3 4 5 6 7 8 M1.0 SITE PLAN AGENDA ITEM #5. d) 1 2 J H ATS EDP ATS EDP-2 ATS PANEL 'S'PANEL EDP PANEL EDP-2 NEW BATTERY CHARGER 125 GALLON DAY TANK NEW 250kW GENERATOR NEW ATS PANEL 'EDP-3' NEW 112.5 kVA 480:208Y/120V XFMR DAY TANK LEVEL AND RETURN PUMP CONTROLLER LEAK DETECTION AND LEVEL CONTROLLER FUEL OIL SUPPLY (1") FUEL OIL RETURN (1")4" 6" 1 M2.0 M6.0 3 M2.0 M6.0 3 M2.0 M6.0 6 1 8 7 66 2 SPILL CONTAINMENT SUMP 9 5 DT - 1 GTLC - 1 FLLC-1 6 TRANS TO 90"X72" WALL OPENING 40"X72" RADIATOR DUCT FLANGE 2 M2.0 M6.0 DAY TANK NEW GENERATOR FUEL OIL SUPPLY/RETURN FUEL OIL SUPPLY/RETURN P.O.C. 7 DT - 1 RETURN AND SUPPLY ANTI SIPHON SOLENOID VALUES RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENT2017035 CONSTRUCTION NOTES: PROVIDE UNDERGROUND PIPING WITH DOUBLE CONTAINMENT FUEL PIPING FROM GENERATOR TO FUEL TANK PROVIDE TRANSITION SUMP RE-USE EXISTING EXHAUST PENETRATION. ENLARGE AS NECESSARY PROVIDE ISOLATION VALVE WITH UNION FOR SINGLE WALL FUEL OIL SUPPLY AND RETURN PIPING AT EXTERIOR OF GENERATOR HOUSING PROVIDE FLEXIBLE CONNECTORS FOR FUEL OIL PIPE CONNECTION TO GENERATOR PER MANUFACTURER INSTALLATION LEAK DETECTION SENSOR PROVIDED AND MOUNTED BY GENERATOR SUPPLIER 10'-0" AFG GENERATOR EXHAUST COLLAR, PROVIDE FLEX CONNECTION AT GENERATOR CHECKED: DRAWN: REVISION: DATE: ISSUE: TMT MDLV --- 09/24/2020 BID 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 NORTHPROJECTGENERATOR INSTALLATION PLAN GENERATOR ROOM WEST WALL ELEVATION VIEW1 M2.0 2 M2.0 1/2"=1'-0" 1/2"=1'-0" 1 2 3 4 5 1 M2.0 6 7 8 9 M2.0 GENERATOR INSTALLATION PLAN AGENDA ITEM #5. d) RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENTCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/05/2020 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN #476-19008 FUEL OIL PIPING GENERATOR ENCLOSURE WALL FOOTING PENETRATION DETAIL1 M6.0 NTS LEVEL AND LEAK DETECTION MONITORING SYSTEM3 M6.0 NTS STEMMONITORINGSYSAK DETECTION MLEVELANDLEA NTS 3 M6.0 M6.0 CONTROL DIAGRAMS AND SCHEDULES AGENDA ITEM #5. d) RENTON CITY HALLCITY OF RENTON - PROJECT 2017035 GENERATOR REPLACEMENTCHECKED: DRAWN: REVISION: DATE: ISSUE: TMT CEM --- 2017035 10/05/2020 PLAN REVIEW 600 Stewart St., Ste 1400 Seattle, Washington 98101 Tel 206.267.1700 Fax 206.267.1701 SAZAN # 476-19008 GENERATOR SECTIONA M7.0 NTS JOINT ASSEMBLY DETAIL1 M7.0 NTS CONSTRUCTION NOTES: INSTALL NEW MODEL IPS-CI (1" FIBER INSULATED PIPE) 6"Ø I.D. GENERATOR EXHAUST. SEE DETAIL 1/M537-1 PROVIDE ONE FULL ANGLE SUPPORT (PA) PROVIDE 6"Ø BELLOWS JOINT (IPS-BJ). PROVIDE WALL GUIDE (IPS-WG) ASSEMBLY. THIS GUIDE ALLOWS FOR EXPANSION UP AND DOWN. SEE DETAIL 2/M537-1. PROVIDE PLATE SUPPORT (IPS-PA) AT BOTTOM OF VERTICAL PIPE. PROVIDE FLIP TOP (IPS-FL) TERMINATION. SEE DETAIL 3/M537-1. SLOPE PIPE TO DRAIN TEE. 1 2 3 4 5 6 7 FUEL POLISHER SEQUENCE OF OPERATIONS THE SYSTEM USES A 2 STAGE PROCESS, FILTERING AND WATER REMOVAL PROCESS ON BOTH TANKS. IT HAS A 7 DAY PROGRAMMABLE TIME CLOCK. THE FUEL POLISHER PUMPS FUEL FROM THE TANK THROUGH THE FILTER AND THEN BACK TO THE TANK. THE FILTER CLEANS THE FUEL AND THEN SEPARATES THE WATER FROM THE FUEL. THE SYSTEM USES ACTUATED BALL VALVES TO ISOLATE ONE TANK FOR THE SYSTEM TO CLEAN. THE SYSTEM INCLUDES A VACUUM SENSOR, LEAK DETECTOR SENSOR, MOTOR OVERLOAD AND A FILTER WATER SENSOR WHICH WILL AUTOMATICALLY TURN SYSTEM OFF, AND SOUND AN AUDIBLE ALARM. A BRIEF DESCRIPTION WILL APPEAR ON THE SCREEN. THE ALARM DESCRIPTION WILL TELL MAINTENANCE WHAT NEEDS SERVICE A DRY CONTACT FOR GENERAL ALARM NOTIFICATION IS PROVIDED AND SHOULD BE WIRED TO THE MONITORING SYSTEM. THE 7 DAY PROGRAMMABLE HAS THREE SETTINGS FOR EACH TANK, (B4 - 1), (B4 - 2), AND (B4 - 3). THE FOLLOWING IS RECOMMENDED SETTINGS: TANK 1 (UNDERGROUND TANK) SET (B4 - 1) TO RUN EVERY DAY FROM 5:30AM TO 7:40AM (ADJUSTABLE) SET (B4 - 2) TO RUN EVERY TUESDAY FROM 3:10PM TO 6:15PM (ADJUSTABLE) SET (B4 - 3) TO RUN EVERY SATURDAY AND SUNDAY FROM 8:30PM TO 11:45AM (ADJUSTABLE) TANK 2 (BELLY TANK) SET (B4 - 1) TO RUN EVERY DAY FROM 8:30AM TO 10:40AM (ADJUSTABLE) SET (B4 - 2) TO RUN EVERY TUESDAY FROM 7:10PM TO 10:15PM (ADJUSTABLE) SET (B4 - 3) TO RUN EVERY SATURDAY AND SUNDAY FROM 12:00PM TO 7:00AM (ADJUSTABLE) FUEL PUMP CONTROLLER SEQUENCE OF OPERATIONS TANK LEVEL CONTROLLER FILL SEQUENCE WHEN LEVEL FALLS BELOW NORMAL OPERATING BAND, THE LEVEL CONTROLLER WILL OPEN THE NORMALLY OPEN FILL CONTROL SOLENOID VALVE, START PUMP 1 AND MONITOR THE FLOW SWITCH FOR PROOF OF FLOW. IF FLOW IS NOT DETECTED FOR 15 SECONDS, THE PUMP WILL BE FAILED AND PUMP 2 WILL BE STARTED. IF FLOW IS NOT DETECTED FOR 15 SECONDS AFTER PUMP 2 IS STARTED, THE PUMP WILL BE FAILED AND THE SYSTEM WILL BE "DOWN" UNTIL RESET. ONCE FLOW IS PROVEN, THE OPERATING PUMP WILL CONTINUE TO RUN UNTIL FUEL LEVEL RISES ABOVE 90% AT WHICH TIME, THE PUMP WILL BE STOPPED. THE SYSTEM WILL THEN WAIT UNTIL THE LEVEL FALLS BELOW THE NORMAL OPERATING BAND AND REPEAT THE ABOVE SEQUENCE, ALTERNATING PUMPS ON EACH FILL CYCLE TO EQUALIZE RUN TIMES. FLOAT SEQUENCE ERROR; IF THE LEVEL FLOAT SWITCH REPORTS CONFLICTING FUEL LEVELS (E.G. SEES LEVEL BELOW THE LOW LEVEL SET POINT AND ABOVE THE 95% AT THE SAME TIME) THE LEVEL CONTROLLER WILL BE FAILED AND AUTOMATIC FILL AND RETURN OPERATION WILL BE DISABLED. ACTIVATES ALARM TO BMS UNTIL ALARM ACKNOWLEDGED. OTHER ALARM CONDITIONS; BELLY TANK LEAK; AUTOMATIC FILL OPERATION DISABLED. ACTIVATE GENERAL ALARM TO BMS UNTIL ALARM ACKNOWLEDGED BELLY TANK LOW LEVEL; SYSTEM WILL RUN BOTH SUPPLY PUMPS UNTIL LEVEL RISES ABOVE TANK FULL LEVEL. ACTIVATE GENERAL ALARM TO BMS UNTIL ALARM ACKNOWLEDGED BELLY TANK LEVEL HIGH; OPERATE RETURN PUMP PER RETURN PUMP OPERATION DESCRIBED ABOVE. ACTIVATE GENERAL ALARM TO BMS UNTIL ALARM ACKNOWLEDGED SUPPLY PUMP 1 OR SUPPLY PUMP 2 FAILURE; TRIGGER GENERAL ALARM TO BMS UNTIL ACKNOWLEDGED FUEL POLISHER SEQUENCE OF OPERATION FUEL PUMP SEQUENCE OF OPERATION M7.0 SECTIONS AND DETAILS AGENDA ITEM #5. d) Page 96 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) &ůŽŽƌ ZŽŽŵ WĂŶĞů ƌĞĂŬĞƌη ƌĞĂŬĞƌ^ŝǌĞ sŽůƚƐ ƋƵŝƉŵĞŶƚ <s ^ƚĂƚƵƐ WϮ ůĞĐƚƌŝĐĂůĐůŽƐĞƚ DWͲ:ηϭ ϯϭ͕ϯϯ͕ϯϱ ϰϬ ϰϴϬ ϮͲŽŶĚĞŶƐĞƌƐĨŽƌĐŽŵƉƵƚĞƌƌŽŽŵ Ϭ dŽĞĞŵŽůŝƐŚĞĚ ϭ ŽŵƉƵƚĞƌZŽŽŵ ,Ϯ ϯϮ͕ϯϰ͕ϯϲ ϯϬ ϰϴϬ ϮͲͬƵŶŝƚƐ Ϭ Η Ϯ Ϯϲϯ WϮͲϭ ϭϲ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ ǆŝƐƚŝŶŐ ϯ ϯϮϴ WϯͲϭ ϳ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ Η ϰ ϰϰϳ hW^ Ϯ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ Η ϱ ϱϮϰ WϱͲϭ ϭϭ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϮ ϭϬ͕ϭϮ ϭϬϬ ϮϬϴ ϭϲ<shW^ ϭϲ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϭ ϳ ϮϬ ϭϮϬ ϭ͘ϲϮϱ<sDŽǀŝŶĐŽŽů ϭ͘ϲϮϱ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϭ ϭϯ ϮϬ ϭϮϬ ϭ͘ϲϮϱ<sDŽǀŝŶĐŽŽů ϭ͘ϲϮϱ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϭ Ϯϱ Ϯϱ ϭϮϬ ,ĞĂƚWƵŵƉϱϬϯ Ϯ͘ϰ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϭ Ϯϳ͕Ϯϵ ϭϱ ϮϬϴ ,ĞĂƚWƵŵƉϱϬϰ Ϯ͘ϭ Η ϱ dƌĂĨĨŝĐZŽŽŵ WϱͲϭ ϯϬ ϭϱ ϭϮϬ ,ĞĂƚWƵŵƉϱϬϱ ϭ͘ϱ Η ϲ ϲϮϯ WϲͲϮ Ϯϯ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ Η ϳ ϳϰϮ WϳͲϭ ϭϬ ϮϬ ϭϮϬ ϭ͘ϱ<shW^ ϭ͘ϱ Η &ůŽŽƌ ZŽŽŵ WĂŶĞů ƌĞĂŬĞƌη ƌĞĂŬĞƌ^ŝǌĞ sŽůƚƐ ƋƵŝƉŵĞŶƚ <s ^ƚĂƚƵƐ ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϮϬϴ /hͬKhηϭ ϯ͘ϳϰ EĞǁ ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϮϬϴ /hͬKhηϮ ϯ͘ϳϰ Η ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϮϬϴ /hͬKhηϯ ϯ͘ϳϰ Η ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϭϮϬ WͲϭ Ϭ͘ϭϴ Η ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϭϮϬ WͲϮ Ϭ͘ϭϴ Η ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϭϮϬ WͲϯ Ϭ͘ϭϴ Η ϭ ŽŵƉƵƚĞƌZŽŽŵ ͍ ͍ ͍ ϮϬϴ ^&Ͳϭ Ϯ͘ϳϱ Η dKd>hW^<sс Ϯϱ͘ϬϬ dKd>,s<sс Ϯϯ͘ϳϲ dKd><sс ϰϴ͘ϳϲ y/^d/E'/d/KE>>K^dKW>KE'EZdKZͲWZ^d<,K>Z^ EtKDWhdZZKKD>K^dKW>KE'EZdKZͲWZ^d<,K>Z^ WƌĞƉĂƌĞĚďǇD;^ĂǌĂŶ'ƌŽƵƉͿϵͬϭϳͬϮϬϮϬ WĂŐĞϭ Only clouded items below are in scope. Crossed out loads are no longer in scope per City direction. AGENDA ITEM #5. d) !"#$%&' ( )*#) )' +) )),- .+)/ )) ( ( ( 0 0 /#1 0 0 !!"#$ 2'( 0- +#3#/"456)/ // (778!9#3&:;)6*08 #+3 77 )&5;) 7<=3#/ *0 776#9$ '"77-9+98=#$+)+# #++3/ ):+$ ;=##+8=#>+#=)+ ?-9+9/:*0?6@+&5A+&&) ?94#/ $A)?>#*+)-/$)# -9+9 8=#>+;=4)6&+9 A+>>#4#// ? 6+)#+3,*0 77$ &5"3*0 )/#/) 3+#/B##+&4+A* %)#)+)+5"3 45A&C+) =+#)+&A46:$#)+&.#)>#B+3#>#9&++ 69&77)#++))+38: 4#># :)9 4 -D% "6A$9$),+)))# &53 ;0(B!0 % )/#/ 6-4 866 :)9-)9)/)##>#%)+3) 639) +9)#%/+&)#8: ' +)+A+3+)= *+)&77E'' ;A +/;= = *+)& / $#):%)/<:8)# -; ;=-)+ :$% +077 ;=*#- 0? -; ;=)$$) +30? A#$4<077 (( *+=077E490771%9 F+)+A+3+)= *+)&F G #+)+&B+3 +/;= G B+34#9$8>> G *-&)+=)9$8 G #+)+&*-&)+=)4*9$8 :0A:45A+9+H+#/)4+9>8#/#+3 776*:>#:+#)5&&+<++): . </I+)/ )$*+))>#9 44B%CE 0(77 BI077B-A 4& $+) 3> AGENDA ITEM #5. d) 8*#6 %&'''( 2(' 0- - 4 ( D -9<:++3 :)9+&/++3 :)9+&/ ' 4 ( D 6+)& :)9 '"6-)9)/0 ;0(B!0E9 &'00770 77$#)0 >& #3#99<)##*+)AA+$: ' -;?-)+ +$;=*0$++> 7,'' ' (77;=<# >) ? &/&5+$ '6 A#$4<77+&5$4<A#$/);=77(77#9))9>45 <*,/77 -40DD77 4%C-4 -// 773 A))#+>>)5H)#:3/># #)+>#)#)+&'%)/)+&/)$#9+))+3 +))+)$#/+=#:))/)#*+')#9H+$9)0$#)#3/>#/:' 95&&5$:<)668%&' 9+//+#3#/)5+&/:#)5*##):<&5/<:) )45%)+))' -H+$9)/+$+3@)/+%)/)&)#:' 3 > AGENDA ITEM #5. d) 1 1 2 2 3 3 4 4 A A B B C C D D SHEET 1 OF 5 DRAWN BY MEMCO REP QUOTE # Customer Approval Signature Akshar Patel 4/25/2019 DWG NO 1000 GALLON FIREGUARD GENERATOR SIZE C SCALE REV 1000 GALLON FIREGUARD GENERATOR *LEAD TIMES BEGIN UPON RECEIPT OF SIGNED APPROVED DRAWING, WHICH MUST BE RETURNED BEFORE PRODUCTION CAN BEGIN* This document and all information and design thereon are the property of Envirosafe Fuel Systems. This document is confidential and must not be made public or copied without written authorization from Envirosafe and is subject to return upon demand. No use of this document or any design thereon is permitted except asisspecifically authorized in writing by Envirosafe. Acceptance of possession of this document constitutes full agreement with the above conditions. All Rights Reserved. Memco, Inc STI SwRI UL# NOTES: 1. GAS/DIESEL USE 2. ENVIROLASTIC 940 DTM POLYASPARTIC URETHANE COATING FOR HIGH PERFORMANCE FINISH (MEMCO GREY) 3. UL 2085 LABELED AND LISTED 4. 2 HOUR RATING TESTED TO SWRI 97-04 NFPA 30 A FIRE RESISTANT TANK 5. ENGINEERED HURRICANE TIE-DOWN 6. LEAD TIME IS DEPENDENT ON IMMEDIATE APPROVAL CUSTOMER REQUESTED COMPLETION DATE : AGENDA ITEM #5. d) DETAIL A SCALE 1/6 A PARTS LIST ITEM QTY DESCRIPTION 1 1 1,000 GALLON TANK MOUNTED ON SADDLES 2 1 18" MANWAY FOR EASY INNER TANK ACCESSIBILITY 326INNPTTHREADEDFLANGE 424INNPTTHREADEDFLANGE 5 3 3" NPT THREADED FLANGE (CONCRETE PORT) 662INNPTTHREADEDFLANGE 7 2 LIFTING LUG 826" 8 OZ EMERGENCY VENT MALE THREADS W/ O-RING 9 1 818-CLOCK-GAUGE 10 1 INTERSTITIAL LEAK GAUGE 11 1 2 INCH VENT STACK WITH MUSHROOM CAP 12 1 7.5 GALLON OVERSPILL CONTAINER WIT HINGED CAP 13 1 CAP MONITORING FEMALE THREADED 4'' 14 1 1" PICKUP DROP TUBE W/ FOOT VALVE 6" FROM BOTTOM OF TANK 15 1 STEP LADDER W/PLATFORM 16 1 TANK DECAL KIT (NOT SHOWN) 17 1 TOUCH UP PAINT (NOT SHOWN & SHIPPED SEPARATELY) 1 1 2 2 3 3 4 4 A A B B C C D D SHEET 2 OF 5 DRAWN BY MEMCO REP QUOTE # Customer Approval Signature Akshar Patel 4/25/2019 DWG NO 1000 GALLON FIREGUARD GENERATOR SIZE C SCALE REV SHELL THICKNESS: 1/4" HEAD THICKNESS: 1/4" STI SwRI UL 1000 GALLON FIREGUARD GENERATOR#*LEAD TIMES BEGIN UPON RECEIPT OF SIGNED APPROVED DRAWING, WHICH MUST BE RETURNED BEFORE PRODUCTION CAN BEGIN* This document and all information and design thereon are the property of Envirosafe Fuel Systems. This document is confidential and must not be made public or copied without written authorization from Envirosafe and is subject to return upon demand. No use of this document or any design thereon is permitted except asisspecifically authorized in writing by Envirosafe. Acceptance of possession of this document constitutes full agreement with the above conditions. All Rights Reserved. Memco, Inc PRIMARY TANK SECONDARY TANK CONCRETE INSULATION FOR FIRE RATING 1 7 10 2 8 11 8 7 9 1213 15 544363656665 14 6 13.84 13.84 147.00B3'' 48.00 P55.38 144.00 MIN. ABOVE GRADE AGENDA ITEM #5. d) THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŶĞƌŐǇ^ĂǀŝŶŐƐ'ƵĂƌĂŶƚĞĞ ϯ͘ϭ'ƵĂƌĂŶƚĞĞKǀĞƌǀŝĞǁ ϭ͘WŚŝůŽƐŽƉŚǇ͗ DĐ<ŝŶƐƚƌǇŝƐƉƌĞƉĂƌĞĚƚŽŐƵĂƌĂŶƚĞĞĂŶǇƉŽƌƚŝŽŶŽĨĂƉƌŽũĞĐƚŽǀĞƌǁŚŝĐŚŝƚŚĂƐĚŝƌĞĐƚĐŽŶƚƌŽů͘tŚĞƌĞ DĐ<ŝŶƐƚƌǇĚŽĞƐŶŽƚŚĂǀĞĚŝƌĞĐƚĐŽŶƚƌŽů;ƐƵĐŚĂƐŽƉĞƌĂƚŝŶŐŚŽƵƌƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚůŝŐŚƚŝŶŐͿ͕ǁĞĂƌĞƉƌĞƉĂƌĞĚ ƚŽǁŽƌŬǁŝƚŚƚŚĞKǁŶĞƌĂŶĚ^ƚŽĚĞǀŝƐĞĂŵĞƚŚŽĚŽĨDĞĂƐƵƌĞŵĞŶƚĂŶĚsĞƌŝĨŝĐĂƚŝŽŶ;DΘsͿ͕ǁŚŝĐŚǁŝůů ƉƌŽǀŝĚĞƚŚĞŚŝŐŚĞƐƚĚĞŐƌĞĞŽĨĂƐƐƵƌĂŶĐĞƚŚĂƚƚŚĞĞŶĞƌŐǇƐĂǀŝŶŐƐĂƌĞĂĐŚŝĞǀĞĚ͘ Ϯ͘dŚŝƐWƌŽũĞĐƚ͗ &ŽƌƚŚŝƐƉƌŽũĞĐƚ͕DĐ<ŝŶƐƚƌǇŐƵĂƌĂŶƚĞĞƐƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞŝŶƐƚĂůůĞĚŝŶŝƚŝĂƚŝǀĞƐƚŽƌĞĚƵĐĞĞŶĞƌŐǇ ĐŽŶƐƵŵƉƚŝŽŶ͘dŚĞƚĂƌŐĞƚĞŶĞƌŐǇƌĞĚƵĐƚŝŽŶƐĨŽƌƚŚĞŝŶŝƚŝĂƚŝǀĞƐƚŚĂƚǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚĂƌĞƐŚŽǁŶŝŶƚŚĞ ĂƚƚĂĐŚĞĚdĂďůĞϯ͘ϭŶĞƌŐǇ^ĂǀŝŶŐƐ^ƵŵŵĂƌǇ͘ĂƐĞĚƵƉŽŶƚŚĞƐƚŝƉƵůĂƚĞĚĐŽŶĚŝƚŝŽŶƐĂƐĞŶƵŵĞƌĂƚĞĚďǇƚŚĞ KǁŶĞƌĂŶĚ^ƉĞƌƐŽŶŶĞůĂŶĚƚŚĞƵƚŝůŝƚǇƌĂƚĞƐĂƐĚĞƐĐƌŝďĞĚďĞůŽǁ͕ƚŚĞƵƚŝůŝƚǇĐŽƐƚƐĂǀŝŶŐƐĞƐƚŝŵĂƚĞƐĂƌĞĂůƐŽ ƐŚŽǁŶŝŶdĂďůĞϯ͘ϭ͘ ϯ͘KŶŐŽŝŶŐ^ĞƌǀŝĐĞƐ͗ ZĞĨĞƌƚŽdĂďůĞϰ͘ϭĨŽƌƚŚĞĐŽƐƚĂŶĚĚƵƌĂƚŝŽŶŽĨŽŶŐŽŝŶŐDΘs͘dŚĞĐŽƐƚŽĨŽŶŐŽŝŶŐDΘsďĞǇŽŶĚƚŚĞĚƵƌĂƚŝŽŶ ůŝƐƚĞĚŝŶdĂďůĞϰ͘ϭŝƐĂƚƚŚĞĚŝƐĐƌĞƚŝŽŶŽĨƚŚĞKǁŶĞƌ͘DĐ<ŝŶƐƚƌǇŝƐƉƌĞƉĂƌĞĚƚŽĐŽŶƚŝŶƵĞƚŚĞŐƵĂƌĂŶƚĞĞĂƐůŽŶŐ ĂƐƚŚĞKǁŶĞƌĐŽŶƚŝŶƵĞƐƚŚĞŽŶŐŽŝŶŐƐĞƌǀŝĐĞƐĂƐĚĞƐĐƌŝďĞĚŚĞƌĞŝŶ͘tŚĞŶƚŚĞKǁŶĞƌĐŚŽŽƐĞƐƚŽĐĂŶĐĞůƚŚĞ ŽŶŐŽŝŶŐƐĞƌǀŝĐĞƐ͕ƚŚĞŐƵĂƌĂŶƚĞĞǁŝůůĂůƐŽďĞƚĞƌŵŝŶĂƚĞĚĂƚƚŚĞƐĂŵĞƉŽŝŶƚŝŶƚŝŵĞ͘WůĞĂƐĞƌĞĨĞƌƚŽdĂďůĞϯ͘Ϯ DΘsWůĂŶKƵƚůŝŶĞĨŽƌĂƐƵŵŵĂƌǇŽĨƚŚĞƉƌŽƉŽƐĞĚŵĞĂƐƵƌĞŵĞŶƚĂŶĚǀĞƌŝĨŝĐĂƚŝŽŶƐĐŽƉĞ͘ ϯ͘Ϯ&/D^ƉĞĐŝĨŝĐWĞƌĨŽƌŵĂŶĐĞƐƐƵƌĂŶĐĞDĞƚŚŽĚŽůŽŐǇ ϭ͘'ƵĂƌĂŶƚĞĞƐ͗ dĂďůĞϯ͘ϭŶĞƌŐǇ^ĂǀŝŶŐƐ^ƵŵŵĂƌǇƉƌŽǀŝĚĞƐƚŚĞƐƉĞĐŝĨŝĐĞŶĞƌŐǇĐŽŶƐƵŵƉƚŝŽŶƐĂǀŝŶŐƐĨŽƌĞĂĐŚ&ĂĐŝůŝƚǇ /ŵƉƌŽǀĞŵĞŶƚDĞĂƐƵƌĞ;&/DͿĂŶĚƚŚĞŐƵĂƌĂŶƚĞĞƚŚĂƚDĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĂƚŵĞĂƐƵƌĞ͘ ^ĂǀŝŶŐƐĐĂůĐƵůĂƚŝŽŶƐĂƌĞďĂƐĞĚƵƉŽŶďŽƚŚďĂƐĞůŝŶĞŽƉĞƌĂƚŝŶŐĐŚĂƌĂĐƚĞƌŝƐƚŝĐƐĂŶĚƉƌŽƉŽƐĞĚŽƉĞƌĂƚŝŽŶĐƌŝƚĞƌŝĂ͗ Ă͘ĂƐĞůŝŶĞ͗ĂƐĞůŝŶĞƌĞĨĞƌƐƚŽƚŚĞĞǆŝƐƚŝŶŐŽƉĞƌĂƚŝŶŐĐŚĂƌĂĐƚĞƌŝƐƚŝĐƐƚŚĂƚǁĞƌĞƵƐĞĚƚŽĐĂůĐƵůĂƚĞ ĞŶĞƌŐǇƐĂǀŝŶŐƐ͘dŚĞďĂƐĞůŝŶĞǀĂůƵĞƐ͕ŝŶĐůƵĚŝŶŐƐǇƐƚĞŵƉĞƌĨŽƌŵĂŶĐĞĂŶĚŽƉĞƌĂƚŝŽŶĂůĐŽŶĚŝƚŝŽŶƐ͕ ǁŚŝĐŚǁĞƌĞƵƐĞĚĨŽƌƚŚŝƐƉƌŽũĞĐƚĂƌĞƉƌŽǀŝĚĞĚŝŶdĂďůĞϯ͘Ϯ͘/ŶŐĞŶĞƌĂů͕ĂůůƉĂƌƚŝĞƐĂĐŬŶŽǁůĞĚŐĞ ƚŚĞďĂƐĞůŝŶĞĂƐƐŽĐŝĂƚĞĚǁŝƚŚĂŶǇƐƉĞĐŝĨŝĐŵĞĂƐƵƌĞŚĂƐďĞĞŶĚĞƌŝǀĞĚĨƌŽŵƚŚĞĨŽůůŽǁŝŶŐƐŽƵƌĐĞƐ͗ ŝ͘ĐƚƵĂůŽƉĞƌĂƚŝŶŐŝŶĨŽƌŵĂƚŝŽŶŐĂƚŚĞƌĞĚƚŚƌŽƵŐŚĨŝĞůĚŽďƐĞƌǀĂƚŝŽŶ͕ŵĞĂƐƵƌĞŵĞŶƚ͕ŵŝĐƌŽͲ ĚĂƚĂůŽŐŐĞƌƐ͕ĂŶĚKǁŶĞƌ͛ƐŽƉĞƌĂƚŝŶŐůŽŐďŽŽŬƐ͘ ŝŝ͘KǁŶĞƌƉƌŽǀŝĚĞĚŝŶĨŽƌŵĂƚŝŽŶĐŽŶĐĞƌŶŝŶŐƐƚŝƉƵůĂƚĞĚĨĂĐƚŽƌƐƐƵĐŚĂƐďƵƌŶŚŽƵƌƐ͕ ŽĐĐƵƉĂŶĐǇ͕ŽƌŽƉĞƌĂƚŝŽŶĂůĞǆƉĞŶĚŝƚƵƌĞƐ͘ ŝŝŝ͘/ŶƐŽŵĞŝŶƐƚĂŶĐĞƐ͕ĂŵŽĚŝĨŝĞĚďĂƐĞůŝŶĞŵĂǇŚĂǀĞďĞĞŶĚĞǀĞůŽƉĞĚƚŽĂĚĚƌĞƐƐĂƌĞĂƐ ǁŚĞƌĞďǇƉƌĞͲƌĞƚƌŽĨŝƚĐŽŶĚŝƚŝŽŶƐĚŽŶŽƚƌĞĨůĞĐƚĂƐǇƐƚĞŵƚŚĂƚŝƐŽƉĞƌĂƚŝŶŐƉĞƌĐƵƌƌĞŶƚ ĐŽĚĞŽƌǁŚĂƚƚŚĞKǁŶĞƌŵĂǇĚĞĞŵĂƐŶŽƌŵĂůŽƉĞƌĂƚŝŽŶ͘ ď͘WƌŽƉŽƐĞĚ͗dŚĞƉƌŽƉŽƐĞĚŽƉĞƌĂƚŝŶŐǀĂůƵĞƐ͕ŝŶĐůƵĚŝŶŐƐǇƐƚĞŵƉĞƌĨŽƌŵĂŶĐĞĂŶĚŽƉĞƌĂƚŝŽŶĂů ĐŽŶĚŝƚŝŽŶƐ͕ǁŚŝĐŚǁĞƌĞƵƐĞĚĨŽƌƐĂǀŝŶŐƐĐĂůĐƵůĂƚŝŽŶƐĂƌĞƉƌŽǀŝĚĞĚŝŶdĂďůĞϯ͘Ϯ͘^ǇƐƚĞŵƐŵƵƐƚďĞ ŽƉĞƌĂƚĞĚƉĞƌƚŚĞƉƌŽƉŽƐĞĚĐƌŝƚĞƌŝĂƚŽĞŶƐƵƌĞĞŶĞƌŐǇƐĂǀŝŶŐƐĂƌĞƌĞĂůŝǌĞĚ͘DĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞ ƚŚĞŝŶŝƚŝĂůƐƚĂƌƚͲƵƉ͕ĐŽŵŵŝƐƐŝŽŶŝŶŐ͕ĂŶĚƉƌŽŐƌĂŵŵŝŶŐŽĨƚŚĞƐǇƐƚĞŵƚŽĞŶƐƵƌĞƚŚĞƐǇƐƚĞŵƐ ŽƉĞƌĂƚĞƉĞƌƚŚĞƉƌŽƉŽƐĞĚŽƉĞƌĂƚŝŶŐĐƌŝƚĞƌŝĂ͘dŚĞKǁŶĞƌĂĐŬŶŽǁůĞĚŐĞƐƚŚĞŝƌƌĞƐƉŽŶƐŝďŝůŝƚǇƚŽ ĞŶƐƵƌĞƚŚĞƐĞĐƌŝƚĞƌŝĂĂƌĞŵĂŝŶƚĂŝŶĞĚĂŶĚĂƐƐŽĐŝĂƚĞĚĞŶĞƌŐǇƐĂǀŝŶŐƐĂƌĞƌĞĂůŝǌĞĚ͘ŶĞƌŐǇ^ĂǀŝŶŐƐ Page 39 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŶĞƌŐǇ^ĂǀŝŶŐƐ'ƵĂƌĂŶƚĞĞ 'ƵĂƌĂŶƚĞĞƐĂƌĞƉƌĞĚŝĐĂƚĞĚďĂƐĞĚŽŶƚŚĞKǁŶĞƌŵĂŝŶƚĂŝŶŝŶŐƚŚĞŝƌƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐĂƐƉƌŽǀŝĚĞĚ ďĞůŽǁŝŶ͞KŶŐŽŝŶŐKǁŶĞƌZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ͟ŝŶ^ĞĐƚŝŽŶϯ͘ϱ͘ ϯ͘ϯhƚŝůŝƚǇZĂƚĞƐ ϭ͘hƚŝůŝƚǇZĂƚĞ͗ &ŽƌƚŚĞƉƵƌƉŽƐĞŽĨĐĂůĐƵůĂƚŝŶŐĞŶĞƌŐǇĐŽƐƚƐĂǀŝŶŐƐ͕ƚŚĞƵƚŝůŝƚǇƌĂƚĞƐƵƐĞĚǁŝůůďĞƚŚĞƵƚŝůŝƚǇƌĂƚĞƐĂƐƉĂŝĚďǇ ƚŚĞKǁŶĞƌƚŽƚŚĞƵƚŝůŝƚǇĐŽŵƉĂŶǇĂƚƚŚĞƚŝŵĞƚŚĞŶĞƌŐǇ^ĞƌǀŝĐĞƐWƌŽƉŽƐĂůǁĂƐĚĞǀĞůŽƉĞĚ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚ ĂďƵŝůĚŝŶŐŚĂƐŵƵůƚŝƉůĞŵĞƚĞƌƐŽŶĚŝĨĨĞƌĞŶƚƌĂƚĞƐĐŚĞĚƵůĞƐ͕ƚŚĞƉĞƌͲƵŶŝƚĐŽƐƚŽĨƚŚĞƵƚŝůŝƚǇǁŝůůďĞƚŚĞĂǀĞƌĂŐĞ ŽĨĂůůƚŚĞƌĂƚĞƐĐŚĞĚƵůĞƐŝŶĞĨĨĞĐƚĂƚƚŚĂƚĨĂĐŝůŝƚǇ͘ Ă͘ĂƐĞhƚŝůŝƚǇZĂƚĞ͗ ZĞĨĞƌƚŽƚĂďůĞϯ͘ϯĨŽƌƚŚĞĂƐĞhƚŝůŝƚǇZĂƚĞƐ;ŝŶĐůƵĚŝŶŐƐĂůĞƐƚĂǆͿ͘ ϯ͘ϰ^ƚĂŶĚĂƌĚƐKĨŽŵĨŽƌƚ^ĞƌǀŝĐĞ tŚĞƌĞĂƉƉůŝĐĂďůĞ͕ƚŚĞĨŽůůŽǁŝŶŐƐĞĐƚŝŽŶƉƌŽǀŝĚĞƐƚŚĞƐƚĂŶĚĂƌĚƐŽĨĐŽŵĨŽƌƚ͕ǁŚŝĐŚƚŚĞKǁŶĞƌŵƵƐƚŵĂŝŶƚĂŝŶƚŽ ĞŶƐƵƌĞƚŚĞĐŽŵĨŽƌƚŽĨƚŚĞŽĐĐƵƉĂŶƚƐĂŶĚƐƚĂĨĨ͕ĂŶĚƵƉŽŶǁŚŝĐŚĂůůĞŶĞƌŐǇĐĂůĐƵůĂƚŝŽŶƐǁĞƌĞďĂƐĞĚ͘ ,sKD&KZd ,ĞĂƚŝŶŐ͕ǀĞŶƚŝůĂƚŝŶŐ͕ĂŶĚĂŝƌĐŽŶĚŝƚŝŽŶŝŶŐ;,sͿƐǇƐƚĞŵƐƉƌŽǀŝĚĞĚďǇDĐ<ŝŶƐƚƌǇǁŝůůƉƌŽǀŝĚĞĐŽŵĨŽƌƚĂŶĚŝŶĚŽŽƌ ĂŝƌƋƵĂůŝƚǇŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ^ƚĂŶĚĂƌĚƐŽĨŽŵĨŽƌƚďĞůŽǁ͘dŚŝƐƐƚĂŶĚĂƌĚǁŝůůƉĞƌƚĂŝŶŽŶůǇƚŽďƵŝůĚŝŶŐƐĂŶĚ ĂƌĞĂƐŽĨďƵŝůĚŝŶŐƐŝŶǁŚŝĐŚDĐ<ŝŶƐƚƌǇŝƐŝŶƐƚĂůůŝŶŐ,sĞƋƵŝƉŵĞŶƚƚŚĂƚŚĂƐĚŝƌĞĐƚĐŽŶƚƌŽůŽǀĞƌƐƉĂĐĞĐŽŵĨŽƌƚ ĐŽŶĚŝƚŝŽŶƐ͘,sĐŽŵĨŽƌƚĐŽŶĚŝƚŝŽŶƐĐĂŶŶŽƚďĞŐƵĂƌĂŶƚĞĞĚǁŚĞŶŽƉĞƌĂďůĞǁŝŶĚŽǁƐŽƌĚŽŽƌƐĂƌĞŽƉĞŶ͘ /EKKZKE/d/KE^ KĐĐƵƉŝĞĚ͗ tŝŶƚĞƌ,ĞĂƚŝŶŐDŝŶŝŵƵŵ^ĞƚͲƉŽŝŶƚʹϳϬĚĞŐƌĞĞƐ&;^ƵƉĞƌƐĞĚĞĚďǇK,ZĞŐƐͿ tŝŶƚĞƌ,ĞĂƚŝŶŐDĂǆŝŵƵŵ^ĞƚͲƉŽŝŶƚʹϳϰĚĞŐƌĞĞƐ&;^ƵƉĞƌƐĞĚĞĚďǇK,ZĞŐƐͿ ^ƵŵŵĞƌŽŽůŝŶŐDŝŶŝŵƵŵ^ĞƚͲƉŽŝŶƚʹϳϮĚĞŐƌĞĞƐ&;ǁŚĞƌĞŵĞĐŚĂŶŝĐĂůĐŽŽůŝŶŐƐǇƐƚĞŵƐĂƌĞĞŵƉůŽǇĞĚͿ ^ƵŵŵĞƌŽŽůŝŶŐDĂǆŝŵƵŵ^ĞƚͲƉŽŝŶƚʹϳϴĚĞŐƌĞĞƐ&;ǁŚĞƌĞŵĞĐŚĂŶŝĐĂůĐŽŽůŝŶŐƐǇƐƚĞŵƐĂƌĞĞŵƉůŽǇĞĚͿ hŶŽĐĐƵƉŝĞĚ͗ DŝŶŝŵƵŵʹϱϱĚĞŐƌĞĞƐ& DĂǆŝŵƵŵʹϴϱĚĞŐƌĞĞƐ&;ǁŚĞƌĞŵĞĐŚĂŶŝĐĂůĐŽŽůŝŶŐƐǇƐƚĞŵƐĂƌĞĞŵƉůŽǇĞĚͿ ZĞůĂƚŝǀĞ,ƵŵŝĚŝƚǇ;/ĨŚƵŵŝĚŝƚǇĐŽŶƚƌŽůƉƌŽǀŝĚĞĚͿ͗ DŝŶŝŵƵŵͲϰϬй DĂǆŝŵƵŵͲϲϬй DŝŶŝŵƵŵŽƵƚƐŝĚĞĂŝƌƉĞƌŽĐĐƵƉĂŶƚ͗ DŝŶŝŵƵŵŽƵƚƐŝĚĞĂŝƌƉĞƌŽĐĐƵƉĂŶƚƐŚĂůůďĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŵĞƌŝĐĂŶ^ŽĐŝĞƚǇŽĨ,ĞĂƚŝŶŐ͕ZĞĨƌŝŐĞƌĂƚŝŶŐ͕ĂŶĚ ŝƌŽŶĚŝƚŝŽŶŝŶŐŶŐŝŶĞĞƌƐ;^,ZͿƐƚĂŶĚĂƌĚƐĂŶĚŚĂƉƚĞƌϰŽĨƚŚĞ/ŶƚĞƌŶĂƚŝŽŶĂůDĞĐŚĂŶŝĐĂůŽĚĞ͘ >ĞƐƐƐƚƌŝŶŐĞŶƚĐŽŶĚŝƚŝŽŶƐǁŝůůŶŽƚďĞƉƌŽƉŽƐĞĚƵŶůĞƐƐƐƉĞĐŝĨŝĐĂůůǇĂƉƉƌŽǀĞĚďǇƚŚĞKǁŶĞƌĂŶĚ^;ŝĨĂƉƉůŝĐĂďůĞͿ͘ Page 40 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŶĞƌŐǇ^ĂǀŝŶŐƐ'ƵĂƌĂŶƚĞĞ >/',d/E' /ůůƵŵŝŶĂƚŝŽŶ>ĞǀĞůƐsĞƌŝĨŝĐĂƚŝŽŶ͗ DĐ<ŝŶƐƚƌǇƐŚĂůůƉĞƌĨŽƌŵĂůŝŐŚƚůĞǀĞůƐƵƌǀĞǇŽĨƚŚĞĞǆŝƐƚŝŶŐĐŽŶĚŝƚŝŽŶƐĚƵƌŝŶŐƚŚĞĂƵĚŝƚƉŚĂƐĞŽĨƚŚĞƉƌŽũĞĐƚ ĚĞǀĞůŽƉŵĞŶƚ͘dŚĞĞǆŝƐƚŝŶŐůŝŐŚƚŝŶŐĐŽŶĚŝƚŝŽŶƐƐŚĂůůďĞĚŝƐĐƵƐƐĞĚǁŝƚŚƚŚĞKǁŶĞƌƚŽŐĂƵŐĞƚŚĞƉƌĞĨĞƌĞŶĐĞĨŽƌ ŐĞŶĞƌĂůŝůůƵŵŝŶĂƚŝŽŶƚŚƌŽƵŐŚŽƵƚƚŚĞĨĂĐŝůŝƚǇ͘ /ůůƵŵŝŶĂƚŝŽŶ>ĞǀĞůƐĞƐŝŐŶ͗ /ƚŝƐDĐ<ŝŶƐƚƌǇ͛ƐŝŶƚĞŶƚƚŽƉƌŽǀŝĚĞĞŶĞƌŐǇĞĨĨŝĐŝĞŶƚůŝŐŚƚŝŶŐĐŽŶĚŝƚŝŽŶƐƚŚĂƚĞĨĨĞĐƚŝǀĞůǇŵĞĞƚƚŚĞŶĞĞĚƐŽĨƚŚĞ ŽĐĐƵƉĂŶƚƐĂŶĚĂĐĐŽŵŵŽĚĂƚĞƚŚĞĂƉƉůŝĐĂƚŝŽŶƌĞƋƵŝƌĞŵĞŶƚƐ͘tŚĞƌĞĚĞĞŵĞĚĂƉƉƌŽƉƌŝĂƚĞ͕DĐ<ŝŶƐƚƌǇǁŝůůĨŽůůŽǁ /^EƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐĨŽƌŝůůƵŵŝŶĂƚŝŽŶĐƌŝƚĞƌŝĂŝŶƚŚĞĂďƐĞŶĐĞŽĨƚŚĞKǁŶĞƌ͛ƐƉƌĞĨĞƌƌĞĚůŝŐŚƚŝŶŐƐƚĂŶĚĂƌĚƐ͘ ϯ͘ϱKŶŐŽŝŶŐKǁŶĞƌZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ dŚĞKǁŶĞƌƐŚĂůůƉƌŽǀŝĚĞƚŚĞĨŽůůŽǁŝŶŐƐĞƌǀŝĐĞƐĂƐƉĂƌƚŽĨƚŚŝƐĞŶĞƌŐǇƐĞƌǀŝĐĞƐƉƌŽũĞĐƚ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚƚŚĞƐĞ ƐĞƌǀŝĐĞƐĂƌĞŶŽƚƉƌŽǀŝĚĞĚ͕ĞŶĞƌŐǇƐĂǀŝŶŐƐĂŶĚĂƐƐŽĐŝĂƚĞĚŐƵĂƌĂŶƚĞĞƐǁŝůůďĞŵŽĚŝĨŝĞĚƚŽƌĞĨůĞĐƚƚŚĞĂƐƐŽĐŝĂƚĞĚ ŝŵƉĂĐƚ͘ ϭ͘DĂŝŶƚĂŝŶĂůůĞƋƵŝƉŵĞŶƚƉĞƌŵĂŶƵĨĂĐƚƵƌĞƌ͛ƐƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐĂŶĚƉƌŽƉŽƐĞĚŵĂŝŶƚĞŶĂŶĐĞƐĐŚĞĚƵůĞ͘ Ϯ͘DĂŝŶƚĂŝŶĂůůƐĞƋƵĞŶĐĞŽĨŽƉĞƌĂƚŝŽŶƐĂŶĚƉĞƌĨŽƌŵĂŶĐĞĐƌŝƚĞƌŝĂƌĞůĂƚĞĚƚŽŝŶƐƚĂůůĞĚƐǇƐƚĞŵƐĂƐƉƌŽƉŽƐĞĚĂŶĚ ĚĞƐŝŐŶĞĚ͘ ϯ͘WƌŽǀŝĚĞŽƚŚĞƌ&/DƐƉĞĐŝĨŝĐŽŶŐŽŝŶŐƌĞƐƉŽŶƐŝďŝůŝƚŝĞƐĂƐƉƌŽǀŝĚĞĚŝŶdĂďůĞϯ͘Ϯ͘ ϰ͘WƌŽǀŝĚĞDĐ<ŝŶƐƚƌǇǁŝƚŚĐŽƉŝĞƐŽĨĂĐƚƵĂůŵŽŶƚŚůǇƵƚŝůŝƚǇďŝůůŝŶŐŝŶĨŽƌŵĂƚŝŽŶŽŶĂƋƵĂƌƚĞƌůǇďĂƐŝƐĨŽƌƚŚĞ ĚƵƌĂƚŝŽŶŽĨƚŚĞDΘsƐĞƌǀŝĐĞƉĞƌŝŽĚ͘dŚŝƐŝŶĐůƵĚĞƐĞůĞĐƚƌŝĐ͕ŶĂƚƵƌĂůŐĂƐ͕ĂŶĚĨƵĞůŽŝů͘dŚĞĂƐƐŽĐŝĂƚĞĚĨĂĐŝůŝƚŝĞƐ ǁŚĞƌĞƵƚŝůŝƚǇŝŶĨŽƌŵĂƚŝŽŶƐŚĂůůďĞƉƌŽǀŝĚĞĚŝŶĐůƵĚĞĂůůŵĞƚĞƌƐƉƌŽǀŝĚŝŶŐĚŝƌĞĐƚŽƌŝŶĚŝƌĞĐƚƐĞƌǀŝĐĞƚŽĂůů ďƵŝůĚŝŶŐƐŝŶĐůƵĚĞĚŝŶƚŚŝƐƉƌŽũĞĐƚ͘ ϱ͘WƌŽǀŝĚĞDĐ<ŝŶƐƚƌǇĂůůŝŶƚĞƌŶĂůƐƵďͲŵĞƚĞƌĚĂƚĂ͕ŝŶĐůƵĚŝŶŐĞůĞĐƚƌŝĐĂŶĚĐŽŶĚĞŶƐĂƚĞŵĞƚĞƌƐ͕ƉƌŽǀŝĚŝŶŐĚŝƌĞĐƚŽƌ ŝŶĚŝƌĞĐƚƐĞƌǀŝĐĞƚŽĂůůďƵŝůĚŝŶŐƐŝŶĐůƵĚĞĚŝŶƚŚŝƐƉƌŽũĞĐƚ͘ ϲ͘WƌŽǀŝĚĞDĐ<ŝŶƐƚƌǇĂĐĐĞƐƐƚŽŶĞƌŐǇDĂŶĂŐĞŵĞŶƚĂŶĚŽŶƚƌŽů^ǇƐƚĞŵƐĨŽƌƚŚĞƉƵƌƉŽƐĞŽĨĐŽůůĞĐƚŝŶŐĂŶĚ ůŽŐŐŝŶŐĚĂƚĂŽǀĞƌƚŝŵĞĂƐƌĞƋƵŝƌĞĚĨŽƌƉĞƌĨŽƌŵĂŶĐĞǀĞƌŝĨŝĐĂƚŝŽŶ͘ ϳ͘dŚĞKǁŶĞƌƐŚĂůůŶŽƚŝĨǇDĐ<ŝŶƐƚƌǇŝŶǁƌŝƚŝŶŐĐŽŶĐĞƌŶŝŶŐĂŶǇĐŚĂŶŐĞƐŽƌĂůƚĞƌĂƚŝŽŶƐƚŽƚŚĞďƵŝůĚŝŶŐƚŚĂƚǁŝůů ĂĨĨĞĐƚĞŶĞƌŐǇƵƐĂŐĞ͘dŚŝƐŶŽƚŝĨŝĐĂƚŝŽŶƐŚŽƵůĚďĞƉƌŽǀŝĚĞĚǁŝƚŚŝŶƚǁŽǁĞĞŬƐŽĨƚŚĞĐŚĂŶŐĞ͘dŚŝƐŝŶĐůƵĚĞƐ ŽĐĐƵƉĂŶĐǇŽƌƵƐĞĐŚĂŶŐĞƐ͕ĐŽŵƉƵƚĞƌůŽĂĚŽƌŽƚŚĞƌůŽĂĚĐŚĂŶŐĞƐ͕ƐĐŚĞĚƵůŝŶŐĐŚĂŶŐĞƐ͕ĂŶĚƐĞƋƵĞŶĐĞŽĨ ŽƉĞƌĂƚŝŽŶƐĐŚĂŶŐĞƐ͘ ϯ͘ϲEŽŶͲWĞƌĨŽƌŵĂŶĐĞ /ŶƚŚĞĞǀĞŶƚƚŚĞĞƋƵŝƉŵĞŶƚƉĞƌĨŽƌŵĂŶĐĞŝƐŶŽƚŵĞƚ͕DĐ<ŝŶƐƚƌǇĂĐĐĞƉƚƐƌĞƐƉŽŶƐŝďŝůŝƚǇĨŽƌĂĚĚŝƚŝŽŶĂůĞůĞĐƚƌŝĐŝƚǇ ĂŶĚŶĂƚƵƌĂůŐĂƐƵƐĞĚďǇƚŚĞĞƋƵŝƉŵĞŶƚ͕ĚƵĞƚŽƌĞĚƵĐĞĚƉĞƌĨŽƌŵĂŶĐĞ͘DĐ<ŝŶƐƚƌǇŵĂǇ͕ĂƚŝƚƐŽƉƚŝŽŶ͕ĞǆĞĐƵƚĞĂŶǇ ŽĨƚŚĞĨŽůůŽǁŝŶŐŽƉƚŝŽŶƐ͗ ϭ͘ZĞƉĂŝƌŽƌƌĞƉůĂĐĞĞƋƵŝƉŵĞŶƚĂƐŶĞĐĞƐƐĂƌǇƚŽŵĞĞƚƌĞƋƵŝƌĞĚƉĞƌĨŽƌŵĂŶĐĞ͘ Ϯ͘DĂŬĞƉĂǇŵĞŶƚƐĨŽƌƚŚĞĞǆƚƌĂĞŶĞƌŐǇĐŽŶƐƵŵƉƚŝŽŶƚŽƚŚĞKǁŶĞƌ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚDĐ<ŝŶƐƚƌǇĐŚŽŽƐĞƐƚŚĞ ƉĂǇŵĞŶƚŽƉƚŝŽŶ͕DĐ<ŝŶƐƚƌǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƐĞůĞĐƚĞŝƚŚĞƌĂŶĂŶŶƵĂůƉĂǇŵĞŶƚĨŽƌƚŚĞĚƵƌĂƚŝŽŶŽĨƚŚĞ ŐƵĂƌĂŶƚĞĞƚĞƌŵŽƌĂŽŶĞͲƚŝŵĞůƵŵƉͲƐƵŵƉĂǇŵĞŶƚŽĨƚŚĞƐĂŵĞĂŵŽƵŶƚ͘/ŶĞŝƚŚĞƌĐĂƐĞ͕ƚŚĞƉĂǇŵĞŶƚǁŝůůďĞ ĐĂůĐƵůĂƚĞĚďĂƐĞĚƵƉŽŶƚŚĞƋƵĂŶƚŝƚǇŽĨĂĚĚŝƚŝŽŶĂůĞůĞĐƚƌŝĐŝƚǇŽƌŶĂƚƵƌĂůŐĂƐƵƐĞĚĂŶĚƚŚĞĂƐĞhƚŝůŝƚǇZĂƚĞĂƐ ĚĞƐĐƌŝďĞĚĂďŽǀĞ͘ Page 41 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŶĞƌŐǇ^ĂǀŝŶŐƐ'ƵĂƌĂŶƚĞĞ ϯ͘ϳŚĂŶŐĞKĨhƐĞ /ŶƚŚĞĞǀĞŶƚƚŚĂƚƚŚĞKǁŶĞƌĐŚŽŽƐĞƐƚŽŵĂŬĞĐŚĂŶŐĞƐƚŽƚŚĞĨĂĐŝůŝƚǇƚŚĂƚƌĞƋƵŝƌĞƐĞƚƉŽŝŶƚĂĚũƵƐƚŵĞŶƚƐ͕ůŽŶŐĞƌ ŽƉĞƌĂƚŝŶŐŚŽƵƌƐ͕ŽƌĐŽŶƚŝŶƵŽƵƐĞƋƵŝƉŵĞŶƚŽƉĞƌĂƚŝŽŶ͕ƚŚĞKǁŶĞƌĂŐƌĞĞƐƚŚĂƚ͗ ϭ͘^ĂǀŝŶŐƐĚĞĞŵĞĚĂƐŵĞƚĚĞƐĐƌŝďĞĚĂďŽǀĞǁŝůůĐŽŶƚŝŶƵĞƚŽďĞĚĞĞŵĞĚĂƐŵĞƚ͘ Ϯ͘ĚĚŝƚŝŽŶĂůĐŽƐƚŽĨĞǆƚĞŶĚĞĚĞƋƵŝƉŵĞŶƚŽƉĞƌĂƚŝŽŶŝƐĂĐŽƐƚŽĨƚŚĞĐŚĂŶŐĞ͕ŶŽƚĚƵĞƚŽĂĨĂŝůƵƌĞŽĨDĐ<ŝŶƐƚƌǇŽƌ ƚŚĞŝƌĞƋƵŝƉŵĞŶƚ͘ ϯ͘DĐ<ŝŶƐƚƌǇƐŚĂůůŶŽƚďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĂŶǇŝŶĐƌĞĂƐĞŝŶĞŶĞƌŐǇ͕ŵĂŝŶƚĞŶĂŶĐĞ͕ŽƌĂŶǇŽƚŚĞƌĐŽƐƚƐŝŶĐƵƌƌĞĚ ďĞĐĂƵƐĞŽĨƚŚĞĞǆƚĞŶĚĞĚĞƋƵŝƉŵĞŶƚŽƉĞƌĂƚŝŽŶ͘ ϰ͘ƵƌŝŶŐƚŚĞDΘsƉŽƌƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚDĐ<ŝŶƐƚƌǇĂƚŝƚƐŽƉƚŝŽŶŵĂǇŵĂŬĞĂďĂƐĞůŝŶĞĞŶĞƌŐǇƵƐĞĂĚũƵƐƚŵĞŶƚ ƚŽŝĚĞŶƚŝĨǇĂŶĚĂĐĐŽƵŶƚĨŽƌĂĐŚĂŶŐĞͲŽĨͲƵƐĞĂƚƚŚĞĨĂĐŝůŝƚǇ͘ ϱ͘DĐ<ŝŶƐƚƌǇǁŝůůĐĂůĐƵůĂƚĞƚŚĞĐŚĂŶŐĞŝŶĞŶĞƌŐǇĐŽŶƐƵŵƉƚŝŽŶĚƵĞƚŽƚŚĞƐƉĞĐŝĨŝĐĐŚĂŶŐĞŵĂĚĞƚŽƚŚĞƐǇƐƚĞŵ͛Ɛ ŽƉĞƌĂƚŝŽŶ͘ Page 42 of 107 AGENDA ITEM #5. d) Table 3.1 - Energy Savings Summary 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3KZLWK*HQHUDWRU 'DWH 5HYLVLRQ 7RWDO ),0 1XPEHU )DFLOLW\,PSURYHPHQW 0HDVXUHV )DFLOLW\ *XDUDQWHH0XOWLSOLHU IRU3RVLWLYH 1XPEHUV *XDUDQWHH0XOWLSOLHU IRU1HJDWLYH 1XPEHUV 1HW(IIHFWLYH *XDUDQWHH 0XOWLSOLHU N:K N:K 7KHUP 7KHUP $5&+8SJUDGH %RLOHUV3XPSVDQG 6WRUDJH7DQNV 5HQWRQ&LW\+DOO 5&+8SJUDGH,7 5RRP&RROLQJ 5HQWRQ&LW\+DOO &&3*8SJUDGH /LJKWLQJWR/(' 5HQWRQ&LW\&HQWHU 3DUNLQJ*DUDJH 5&+8SJUDGH %XLOGLQJ*HQHUDWRU 5HQWRQ&LW\+DOO 5&+8SJUDGH)LUH 3XPS 5HQWRQ&LW\+DOO 7RWDOV 7KHJXDUDQWHHLVEDVHGRQ.H\3HUIRUPDQFH,QGLFDWRUVVKRZQLQ7DEOH5HIHUWR6HFWLRQRIWKH(63IRUWKHPHWKRGRIFRQYHUWLQJ.H\3HUIRUPDQFH,QGLFDWRUVWRGROODUVGXULQJWKH0 9SHULR 7KHJXDUDQWHHLVEDVHGRQWKHDJJUHJDWHVDYLQJVIRUDOO),0VQRWRQLQGLYLGXDO),0VDYLQJV &RQILGHQWLDODQG3URSULHWDU\ 7KHVDYLQJVVKRZQLQWKLVWDEOHDUHOHVVWKDQWKHFDOFXODWHGVDYLQJVXQOHVVDJXDUDQWHHPXOWLSOLHURILVVKRZQ (OHFWULFLW\ 1DWXUDO*DV AGENDA ITEM #5. d) Table 3.2 - M&V Plan Outline 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3KZLWK*HQHUDWRU 'DWH 5HYLVLRQ $XGLW6WDJH%DVHOLQLQJ 3RVW5HWURILW&RPPLVVLRQLQJ $QQXDO ),01DPH )DFLOLW\ .3, .H\3HUIRUPDQFH,QGLFDWRUV %DVHOLQH9DOXHV 3URSRVHG9DOXHV 7DVNV 7DVNV 7DVNV 2QJRLQJ2ZQHU5HVSRQVLELOLWLHV 6WLSXODWHG)DFWRUV $5&+8SJUDGH %RLOHUV3XPSVDQG6WRUDJH 7DQNV 5HQWRQ&LW\+DOO 6SDFH+HDWLQJ$YHUDJH %RLOHU&RPEXVWLRQ(IILFLHQF\ 6LWH$XGLW8WLOLW\%LOO$QDO\VLV 'DWD/RJJLQJ 5HYLHZ6XEPLWWDODQG&[ V)37RI %RLOHU 7UHQG2$7+:6+:5 DQG%RLOHU(QDEOHWR FRQILUPERLOHULVIXQFWLRQDO 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 2XWGRRUZHDWKHU FRQGLWLRQVLQWHUQDOORDGV DQGRFFXSDQF\VFKHGXOHV H[LVWLQJHQYHORSH SHUIRUPDQFHH[LVWLQJ GRPHVWLFZDWHUORDG H[LVWLQJVSDFHKHDWLQJ ORDG 'RPHVWLF+RW:DWHU $YHUDJH%RLOHU&RPEXVWLRQ (IILFLHQF\ 6LWH$XGLW8WLOLW\%LOO$QDO\VLV 'DWD/RJJLQJ 5HYLHZ6XEPLWWDODQG&[ V)37RI %RLOHU1RQHSURSRVHG 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 2XWGRRUZHDWKHU FRQGLWLRQVLQWHUQDOORDGV DQGRFFXSDQF\VFKHGXOHV H[LVWLQJHQYHORSH SHUIRUPDQFHH[LVWLQJ GRPHVWLFZDWHUORDG H[LVWLQJVSDFHKHDWLQJ ORDG 5&+8SJUDGH,7 5RRP&RROLQJ 5HQWRQ&LW\+DOO $LU6LGH(FRQRPL]HU 1RQH$YDLODEOH $LU6LGH(FRQRPL]HU 6LWH$XGLW5HYLHZRI([LVWLQJ 'HVLJQ'UDZLQJV&DOLEUDWLRQ RIPRGHOWRXWLOLW\ELOOV 'DWD/RJJLQJ 5HYLHZ6XEPLWWDOGDWDIRU PRGXODWLQJGDPSHURXWVLGHDLU GDPSHUDQGUHOLHIIDQ 7UHQG2$7RXWVLGHDLU GDPSHUSRVLWLRQDQGVSDFH WHPSHUDWXUHRUYHULI\ WKURXJKFRQWUROVVHTXHQFH 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 7RWDODLUIORZKRXUVRI RSHUDWLRQDQGORDGDUH VWLSXODWHGWREHWKHVDPH DVWKHEDVHOLQH 8QLW&RROLQJ(IILFLHQF\ 6((5 6((5 6LWH$XGLW5HYLHZRI([LVWLQJ 'HVLJQ'UDZLQJV&DOLEUDWLRQ RIPRGHOWRXWLOLW\ELOOV 'DWD/RJJLQJ 5HYLHZ6XEPLWWDOGDWDIRUWKHQHZ XQLWVLQVWDOOHG1RQHSURSRVHG 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 7RWDODLUIORZKRXUVRI RSHUDWLRQDQGORDGDUH VWLSXODWHGWREHWKHVDPH DVWKHEDVHOLQH([LVWLQJ HTXLSPHQWHIILFLHQF\ &&3*8SJUDGH /LJKWLQJWR/(' 5HQWRQ&LW\&HQWHU 3DUNLQJ*DUDJH 4XDQWLW\DQG7\SHDQG /RFDWLRQRI/LJKWLQJ)L[WXUHV 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ &RPSUHKHQVLYH/LJKWLQJ$XGLW 3HUIRUPHGWR'HWHUPLQH 4XDQWLW\DQG7\SHDQG /RFDWLRQVRI/LJKWLQJ)L[WXUHV 9DOLGDWH5HOHYDQW4XDQWLW\DQG 7\SHRIOLJKWIL[WXUHVLQVWDOOHG EDVHGRQVLWHREVHUYDWLRQVRU$V %XLOW,QIRUPDWLRQ 1RQH3URSRVHG6HH3RVW ,QVWDOODWLRQ &RPPLVVLRQLQJ3KDVH 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV /LJKWLQJ)L[WXUH2SHUDWLQJ +RXUV<HDU 3UH 3RVW)L[WXUH,QSXW 3RZHU:DWWV 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ &RPSUHKHQVLYH/LJKWLQJ$XGLW 3HUIRUPHGDQG5HYLHZRI 6SDUH/DPS,QYHQWRU\3UH ,QVWDOODWLRQ7HVWRI6SHFLILHG 6WDWLVWLFDO6DPSOHRI/LJKWLQJ )L[WXUHVZLWK/LJKW0HWHU 3RVW,QVWDOODWLRQ7HVWRIWKH 6SHFLILHG6WDWLVWLFDO6DPSOHRI /LJKWLQJ)L[WXUHV/LJKW0HWHU 5HYLHZRIOLJKWLQJDVEXLOW LQIRUPDWLRQ 1RQH3URSRVHG6HH3RVW ,QVWDOODWLRQ &RPPLVVLRQLQJ3KDVH 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 5HGXFWLRQRI$QQXDO /LJKWLQJ2SHUDWLRQDO+RXUV LQ$UHDVRU5RRPV:KHUH 2FFXSDQF\6HQVRUVDUH ,QVWDOOHG /LJKWLQJ)L[WXUH2SHUDWLQJ +RXUV<HDU 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ 6HH'HWDLOHG/LJKWLQJ6XUYH\ 6XPPDU\LQ6HFWLRQ /LJKWLQJ'DWD/RJJHUV([LVWLQJ 6FKHGXOHV0RQWKO\8WLOLW\ 'DWD 1RQH3URSRVHG 1RQH3URSRVHG6HH3RVW ,QVWDOODWLRQ &RPPLVVLRQLQJ3KDVH 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 1RQHSURSRVHG 5&+8SJUDGH %XLOGLQJ*HQHUDWRU 5HQWRQ&LW\+DOO 1RVDYLQJV 1$ 1$ 6LWH$XGLWRIH[LVWLQJ HTXLSPHQW 3URYLGHIXQFWLRQDOSHUIRUPDQFH WHVWRIEXLOGLQJJHQHUDWRUV\VWHP 1$ 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 1$ 5&+8SJUDGH)LUH 3XPS 5HQWRQ&LW\+DOO 1RVDYLQJV 1$ 1$ 6LWH$XGLWRIH[LVWLQJ HTXLSPHQW 3URYLGHIXQFWLRQDOSHUIRUPDQFH WHVWRIILUHSXPSV 1$ 0DLQWDLQHTXLSPHQWSHU0F.LQVWU\DQG PDQXIDFWXUHUUHFRPPHQGDWLRQV5HIHU WRSURGXFWGRFXPHQWDWLRQIRUVSHFLILF PDLQWHQDQFHSURFHGXUHV 1$ &RQILGHQWLDODQG3URSULHWDU\ AGENDA ITEM #5. d) Table 3.3 - Base Utility Rates 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3KZLWK*HQHUDWRU 'DWH 5HYLVLRQ %XLOGLQJB1DPH 8WLOLW\B3URYLGHU 5DWHB1DPH 8WLOLW\B7\SH 'ROODUVB3HUB8QLW 8QLWV 3XEOLVKHGB'DWHB(IIHFWLYH ZĞŶƚŽŶŝƚǇĞŶƚĞƌWĂƌŬŝŶŐ'ĂƌĂŐĞ WƵŐĞƚ^ŽƵŶĚŶĞƌŐǇ;W^Ϳ W',ŝƐƚŽƌŝĐůĞĐƚƌŝĐŝƚǇZĂƚĞ ůĞĐƚƌŝĐŝƚǇ ΨϬ͘ϬϵϲϬϵϰ ŬtŚ ϮͬϭͬϮϬϭϵ ZĞŶƚŽŶŝƚǇ,Ăůů WƵŐĞƚ^ŽƵŶĚŶĞƌŐǇ;W^Ϳ ŝƚǇ,ĂůůůĞŶĚĞĚ,ŝƐƚŽƌŝĐůĞĐƚƌŝĐŝƚǇZĂƚĞ ůĞĐƚƌŝĐŝƚǇ ΨϬ͘ϬϴϵϰϮϯ ŬtŚ ϮͬϭͬϮϬϭϵ ZĞŶƚŽŶŝƚǇ,Ăůů WƵŐĞƚ^ŽƵŶĚŶĞƌŐǇ;W^Ϳ ŝƚǇ,ĂůůůĞŶĚĞĚ,ŝƐƚŽƌŝĐ'ĂƐZĂƚĞ EĂƚƵƌĂů'ĂƐ ΨϬ͘ϳϰϳϯϬϬ dŚĞƌŵƐ ϮͬϭͬϮϬϭϵ AGENDA ITEM #5. d) Page 46 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ ϰ͘ϭDĂǆŝŵƵŵWƌŽũĞĐƚůůŽǁĂďůĞŽƐƚ DĐ<ŝŶƐƚƌǇŐƵĂƌĂŶƚĞĞƐƚŚĂƚƚŚĞDĂǆŝŵƵŵWƌŽũĞĐƚŽƐƚǁŝůůŶŽƚĞǆĐĞĞĚƚŚĞŐƵĂƌĂŶƚĞĞĚǀĂůƵĞƐŚŽǁŶŝŶdĂďůĞϰ͘ϭʹ ƵĚŐĞƚ^ƵŵŵĂƌǇ͖ƚŚŝƐĐŽƐƚĚŽĞƐŶŽƚŝŶĐůƵĚĞƐĂůĞƐƚĂǆ͕t^ƚĂƚĞ/ŶƚĞƌĂŐĞŶĐǇĨĞĞƐ͕ŽƌƚŚĞƵƚŝůŝƚǇŝŶĐĞŶƚŝǀĞ͘dŚĞ ƐĂůĞƐƚĂǆĂŶĚŝŶƚĞƌĂŐĞŶĐǇĨĞĞƐĂƌĞƐŚŽǁŶŝŶdĂďůĞϰ͘ϭĨŽƌƌĞĨĞƌĞŶĐĞ͕ĂŶĚƚŚĞƵƚŝůŝƚǇŝŶĐĞŶƚŝǀĞŝƐƐŚŽǁŶŝŶdĂďůĞ ϰ͘ϮĨŽƌƌĞĨĞƌĞŶĐĞ͘;DĐ<ŝŶƐƚƌǇĚŽĞƐŶŽƚŐƵĂƌĂŶƚĞĞƚŚĞǀĂůƵĞŽĨƐĂůĞƐƚĂǆ͕ŝŶƚĞƌĂŐĞŶĐǇĨĞĞƐ͕ŽƌƚŚĞƵƚŝůŝƚǇŝŶĐĞŶƚŝǀĞ͘Ϳ ŽƐƚƐƉƌĞƐĞŶƚĞĚŝŶƚŚŝƐƉƌŽƉŽƐĂůĂƌĞǀĂůŝĚĨŽƌϵϬĚĂǇƐĨƌŽŵƚŚĞĚĂƚĞŽĨƉƵďůŝĐĂƚŝŽŶ͘/ĨƚŚĞŶŽƚŝĐĞƚŽƉƌŽĐĞĞĚŝƐ ŝƐƐƵĞĚĂĨƚĞƌƚŚŝƐƚŝŵĞ͕DĐ<ŝŶƐƚƌǇƌĞƐĞƌǀĞƐƚŚĞƌŝŐŚƚƚŽƌĞͲĞǀĂůƵĂƚĞƚŚĞƉƌŽũĞĐƚĂŶĚŵĂŬĞŶĞĐĞƐƐĂƌǇŵŽĚŝĨŝĐĂƚŝŽŶƐ ƚŽƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶĐŽƐƚƐ͘ ϰ͘ϮWƌŽũĞĐƚŽƐƚdĂďůĞ ^ĞĞdĂďůĞϰ͘ϭʹƵĚŐĞƚ^ƵŵŵĂƌǇ͘ůůĨĞĞƉĞƌĐĞŶƚĂŐĞƐĂŶĚĐŽƐƚƐĂƌĞƵŶŝƋƵĞƚŽƚŚĞƉƌŽũĞĐƚ͘ ϰ͘ϯ/ƚĞŵƐ/ŶĐůƵĚĞĚŝŶDĂǆŝŵƵŵWƌŽũĞĐƚŽƐƚ ϭ͘ŶŐŝŶĞĞƌŝŶŐĂƵĚŝƚ͕ǁŚŝĐŚŝŶĐůƵĚĞƐƚŚĞĐŽƐƚĨŽƌƚŚĞƉƌĞƉĂƌĂƚŝŽŶŽĨƚŚŝƐƉƌŽƉŽƐĂů Ϯ͘ŶŐŝŶĞĞƌŝŶŐĚĞƐŝŐŶ ϯ͘ŽŶƐƚƌƵĐƚŝŽŶŵĂŶĂŐĞŵĞŶƚƐĞƌǀŝĐĞƐ ϰ͘/ŶƐƚĂůůĂƚŝŽŶŽĨDĐ<ŝŶƐƚƌǇƋƵŝƉŵĞŶƚŝŶĐůƵĚŝŶŐƚŚĞĨŽůůŽǁŝŶŐĐŽƐƚƐĂƐƐƉĞĐŝĨŝĞĚŝŶƚŚĞƐĐŽƉĞŽĨǁŽƌŬ͗ Ă͘ůůĐŽƐƚƐƉĂŝĚďǇDĐ<ŝŶƐƚƌǇĨŽƌƚŚĞŝŶƐƚĂůůĂƚŝŽŶŽĨƚŚĞĞƋƵŝƉŵĞŶƚ͘dŚŝƐŝŶĐůƵĚĞƐĐŽƐƚƐƉĂŝĚƚŽ ƐƵďĐŽŶƚƌĂĐƚŽƌƐŽƌĚŝƌĞĐƚůǇƚŽDĐ<ŝŶƐƚƌǇƉĞƌƐŽŶŶĞů͕ǁŚĞŶƌĞůĂƚĞĚƚŽŝŶƐƚĂůůĂƚŝŽŶŽƌƐǇƐƚĞŵ ǀĞƌŝĨŝĐĂƚŝŽŶŽĨDĐ<ŝŶƐƚƌǇĞƋƵŝƉŵĞŶƚ͘ ď͘dŚĞƉŽƌƚŝŽŶŽĨƌĞĂƐŽŶĂďůĞƚƌĂǀĞů͕ůŽĚŐŝŶŐ͕ĂŶĚŵĞĂůĞǆƉĞŶƐĞƐŽĨŽĨĨŝĐĞƌƐŽƌĞŵƉůŽǇĞĞƐŝŶĐƵƌƌĞĚ ǁŚŝůĞƚƌĂǀĞůŝŶŐŝŶĚŝƐĐŚĂƌŐĞŽĨĚƵƚŝĞƐĐŽŶŶĞĐƚĞĚǁŝƚŚƚŚĞǁŽƌŬ͘DĐ<ŝŶƐƚƌǇǁŝůůĐŽŵƉůǇǁŝƚŚK&D ŐƵŝĚĞůŝŶĞƐĨŽƌƌĞŝŵďƵƌƐĞŵĞŶƚŽĨƚƌĂǀĞůĞǆƉĞŶƐĞƐ͘ Đ͘ŽƐƚŽĨĂůůŵĂƚĞƌŝĂůƐ͕ƐƵƉƉůŝĞƐ͕ĂŶĚĞƋƵŝƉŵĞŶƚŝŶĐŽƌƉŽƌĂƚĞĚŝŶƚŚĞtŽƌŬ͕ŝŶĐůƵĚŝŶŐĐŽƐƚƐŽĨ ƚƌĂŶƐƉŽƌƚĂƚŝŽŶƚŚĞƌĞŽĨ͘ Ě͘ŽƐƚŽƌƌĞŶƚĂůĐŚĂƌŐĞƐ͕ŝŶĐůƵĚŝŶŐƚƌĂŶƐƉŽƌƚĂƚŝŽŶĂŶĚŵĂŝŶƚĞŶĂŶĐĞ͕ŽĨĂůůŵĂƚĞƌŝĂůƐ͕ƐƵƉƉůŝĞƐ͕ ĞƋƵŝƉŵĞŶƚ͕ƚĞŵƉŽƌĂƌǇĨĂĐŝůŝƚŝĞƐ͕ĂŶĚŚĂŶĚƚŽŽůƐŶŽƚŽǁŶĞĚďǇƚŚĞǁŽƌŬĞƌƐ͕ǁŚŝĐŚĂƌĞĐŽŶƐƵŵĞĚ ŝŶƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞǁŽƌŬĂŶĚĐŽƐƚůĞƐƐƐĂůǀĂŐĞǀĂůƵĞŽŶƐƵĐŚŝƚĞŵƐƵƐĞĚďƵƚŶŽƚ ĐŽŶƐƵŵĞĚǁŚŝĐŚƌĞŵĂŝŶƚŚĞƉƌŽƉĞƌƚǇŽĨDĐ<ŝŶƐƚƌǇ͘ Ğ͘ŽƐƚŽĨƉƌĞŵŝƵŵƐĨŽƌĂůůďŽŶĚƐĂŶĚŝŶƐƵƌĂŶĐĞ͕ǁŚŝĐŚDĐ<ŝŶƐƚƌǇŝƐƌĞƋƵŝƌĞĚƚŽƉƵƌĐŚĂƐĞĂŶĚ ŵĂŝŶƚĂŝŶ͘ Ĩ͘^ĂůĞƐ͕ƵƐĞ͕ŽƌƐŝŵŝůĂƌƚĂǆĞƐƌĞůĂƚĞĚƚŽƚŚĞtŽƌŬĂŶĚĨŽƌǁŚŝĐŚDĐ<ŝŶƐƚƌǇŝƐůŝĂďůĞŝŵƉŽƐĞĚďǇĂ ŐŽǀĞƌŶŵĞŶƚĂůĂƵƚŚŽƌŝƚǇ͘ Ő͘WĞƌŵŝƚĨĞĞƐ͕ƌŽǇĂůƚŝĞƐ͕ĂŶĚĚĞƉŽƐŝƚƐůŽƐƚĨŽƌĐĂƵƐĞƐŽƚŚĞƌƚŚĂŶDĐ<ŝŶƐƚƌǇ͛ƐŶĞŐůŝŐĞŶĐĞ͘ Ś͘>ŽƐƐĞƐĂŶĚĞǆƉĞŶƐĞƐŶŽƚĐŽŵƉĞŶƐĂƚĞĚďǇŝŶƐƵƌĂŶĐĞŽƌŽƚŚĞƌǁŝƐĞ͕ƐƵƐƚĂŝŶĞĚďǇDĐ<ŝŶƐƚƌǇŝŶ ĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĞǁŽƌŬ͕ƉƌŽǀŝĚĞĚƚŚĞǇŚĂǀĞƌĞƐƵůƚĞĚĨƌŽŵĐĂƵƐĞƐŽƚŚĞƌƚŚĂŶƚŚĞĨĂƵůƚŽƌ ŶĞŐůĞĐƚŽĨDĐ<ŝŶƐƚƌǇ͘^ƵĐŚůŽƐƐĞƐƐŚĂůůŝŶĐůƵĚĞƐĞƚƚůĞŵĞŶƚƐŵĂĚĞǁŝƚŚƚŚĞǁƌŝƚƚĞŶĐŽŶƐĞŶƚĂŶĚ ĂƉƉƌŽǀĂůŽĨƚŚĞKǁŶĞƌĂŶĚƚŚĞ^ŶĞƌŐǇWƌŽŐƌĂŵ͘/Ĩ͕ŚŽǁĞǀĞƌ͕ƐƵĐŚůŽƐƐƌĞƋƵŝƌĞƐ ƌĞĐŽŶƐƚƌƵĐƚŝŽŶĂŶĚDĐ<ŝŶƐƚƌǇŝƐƉůĂĐĞĚŝŶĐŚĂƌŐĞƚŚĞƌĞŽĨ͕DĐ<ŝŶƐƚƌǇƐŚĂůůďĞƉĂŝĚĂĨĞĞĨŽƌƐƵĐŚ ƐĞƌǀŝĐĞƐ͘ Page 47 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ ŝ͘ĞŵŽůŝƚŝŽŶĐŽƐƚĂŶĚĐŽƐƚŽĨƌĞŵŽǀĂůŽĨĂůůĚĞďƌŝƐƵŶůĞƐƐƐƉĞĐŝĨŝĐĂůůǇĞǆĐůƵĚĞĚǁŝƚŚŝŶƚŚĞ^ĐŽƉĞŽĨ tŽƌŬ͘ ũ͘ŽƐƚƐŝŶĐƵƌƌĞĚĚƵĞƚŽĂŶĞŵĞƌŐĞŶĐǇĂĨĨĞĐƚŝŶŐƚŚĞƐĂĨĞƚǇŽĨƉĞƌƐŽŶƐĂŶĚƉƌŽƉĞƌƚǇ͘ Ŭ͘KƚŚĞƌĐŽƐƚƐŝŶĐƵƌƌĞĚŝŶƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞtŽƌŬŝĨĂŶĚƚŽƚŚĞĞǆƚĞŶƚĂƉƉƌŽǀĞĚŝŶĂĚǀĂŶĐĞŝŶ ǁƌŝƚŝŶŐďǇƚŚĞKǁŶĞƌĂŶĚ^͘ ů͘ŽŶƚŝŶŐĞŶĐǇĂƐĚĞĨŝŶĞĚŝŶ^ĞĐƚŝŽŶϰ͘ϰ͘ ŵ͘ůůŽǁĂŶĐĞƐĂƐĚĞĨŝŶĞĚŝŶ^ĞĐƚŝŽŶϰ͘ϱ͘ Ŷ͘ŽƐƚŽĨĞƋƵŝƉŵĞŶƚƐƚĂƌƚƵƉ͕ƚƌĂŝŶŝŶŐ͕ƐǇƐƚĞŵǀĞƌŝĨŝĐĂƚŝŽŶ͕ĂŶĚďĂůĂŶĐŝŶŐƉĞƌĨŽƌŵĞĚďǇDĐ<ŝŶƐƚƌǇ͘ Ž͘ŽŶƐƚƌƵĐƚŝŽŶŽŶĚƐ;ŝŶĐůƵĚŝŶŐWĞƌĨŽƌŵĂŶĐĞΘWĂǇŵĞŶƚŽŶĚͿ͕>ŝĂďŝůŝƚǇ/ŶƐƵƌĂŶĐĞ͕ĂŶĚƵŝůĚĞƌ͛Ɛ ZŝƐŬ/ŶƐƵƌĂŶĐĞ͘ Ɖ͘DĐ<ŝŶƐƚƌǇĨĞĞ͘dŚŝƐŝŶĐůƵĚĞƐDĐ<ŝŶƐƚƌǇ͛ƐƌĞŵƵŶĞƌĂƚŝŽŶĨŽƌĐŽŵƉĞŶƐĂƚŝŽŶŽĨƉĞƌƐŽŶŶĞů͕ ĞǆƉĞŶƐĞƐ͕ƌŝƐŬƐƌĞůĂƚĞĚƚŽƚŚĞƉƌŽũĞĐƚ͕ŽǀĞƌŚĞĂĚ͕ĂŶĚƉƌŽĨŝƚ͘ Ƌ͘DĐ<ŝŶƐƚƌǇƐŚĂůůƉƌŽǀŝĚĞĂ^ĐŚĞĚƵůĞŽĨsĂůƵĞƐ͘dŚĞƐĐŚĞĚƵůĞŽĨǀĂůƵĞƐǁŝůůŝŶĐůƵĚĞĂůůĐŽƐƚƐƌĞůĂƚĞĚ ƚŽƚŚĞŝŶƐƚĂůůĂƚŝŽŶŽĨDĐ<ŝŶƐƚƌǇ͛ƐĞƋƵŝƉŵĞŶƚ͘ ϰ͘ϰŽŶƐƚƌƵĐƚŝŽŶŽŶƚŝŶŐĞŶĐǇ ĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚŝŶŐĞŶĐǇĂƐŝĚĞŶƚŝĨŝĞĚŝŶdĂďůĞϰ͘ϭʹ͞ƵĚŐĞƚ^ƵŵŵĂƌǇ͟ŚĂƐďĞĞŶĞƐƚĂďůŝƐŚĞĚĨŽƌƚŚŝƐƉƌŽũĞĐƚ͘ DĐ<ŝŶƐƚƌǇĐĂŶĞǆƉĞŶĚƚŚĞĐŽŶƚŝŶŐĞŶĐǇĂĨƚĞƌĂĐŚĂŶŐĞŽƌĚĞƌŚĂƐďĞĞŶĂƉƉƌŽǀĞĚďǇƚŚĞKǁŶĞƌ͕DĐ<ŝŶƐƚƌǇ͕ĂŶĚ ƚŚĞ^WƌŽũĞĐƚDĂŶĂŐĞƌĨŽƌŝƚĞŵƐŶĞĐĞƐƐĂƌǇƚŽĐŽŵƉůĞƚĞƚŚĞŽƌŝŐŝŶĂůƐĐŽƉĞŽĨƚŚŝƐƉƌŽũĞĐƚ͘dŚĞŝŶƚĞŶƚŽĨƚŚĞ ĐŽŶƚŝŶŐĞŶĐǇŝƐĨŽƌ͞ƵŶĨŽƌĞƐĞĞŶĐŽŶĚŝƚŝŽŶƐ͟ďĞǇŽŶĚǁŚĂƚǁĂƐŽƌŝŐŝŶĂůůǇĞƐƚŝŵĂƚĞĚ͘DĐ<ŝŶƐƚƌǇĂŶĚƚŚĞKǁŶĞƌĂŶĚ ^ǁŝůůũŽŝŶƚůǇŵĂŶĂŐĞĂŶǇĐŽŶƚŝŶŐĞŶĐǇůĞĨƚĂĨƚĞƌƚŚĞƉƌŽũĞĐƚƐĐŽƉĞŝƐĐŽŵƉůĞƚĞĚ͘ůůƵŶƵƐĞĚĐŽŶƐƚƌƵĐƚŝŽŶ ĐŽŶƚŝŶŐĞŶĐǇĨƵŶĚƐƐŚĂůůƌĞĚƵĐĞƚŚĞŽǀĞƌĂůůƉƌŽũĞĐƚĐŽƐƚƚŽƚŚĞKǁŶĞƌ͘ ϰ͘ϱůůŽǁĂŶĐĞƐ DĐ<ŝŶƐƚƌǇŵĂǇƐĞƚĂƐŝĚĞĂůůŽǁĂŶĐĞƐĂƐŝĚĞŶƚŝĨŝĞĚŝŶdĂďůĞϰ͘ϭͲ͞ƵĚŐĞƚ^ƵŵŵĂƌǇ͟ĨŽƌƐƉĞĐŝĨŝĐĂƌĞĂƐŽĨǁŽƌŬƚŚĂƚ ŚĂǀĞďĞĞŶŝĚĞŶƚŝĨŝĞĚĂƐĂƉŽƚĞŶƚŝĂůĐŽƐƚŝŵƉĂĐƚďƵƚĐĂŶŶŽƚďĞĚĞƚĞƌŵŝŶĞĚĂƚƚŚŝƐƐƚĂŐĞ͘^ŚŽƵůĚƚŚĞĂůůŽǁĂŶĐĞ ŶŽƚďĞĂĚĞƋƵĂƚĞ͕ƚŚĞKǁŶĞƌĂŶĚƚŚĞ^WƌŽũĞĐƚDĂŶĂŐĞƌǁŝůůďĞĂĚǀŝƐĞĚ͘DĐ<ŝŶƐƚƌǇǁŝůůďĞĐŽŵƉĞŶƐĂƚĞĚĨŽƌ ĂŶǇĂĚĚŝƚŝŽŶĂůĐŽƐƚƐǀŝĂŚĂŶŐĞKƌĚĞƌƚŽƚŚĞĐŽŶƚƌĂĐƚƐŚŽƵůĚƚŚĞKǁŶĞƌĂŶĚƚŚĞ^WƌŽũĞĐƚDĂŶĂŐĞƌĂŐƌĞĞ͘/Ŷ ĞǆƚƌĞŵĞƐŝƚƵĂƚŝŽŶƐ͕DĐ<ŝŶƐƚƌǇŵĂǇƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂůĨƵŶĚƐƚŽĐŽǀĞƌĐŽƐƚŽǀĞƌƌƵŶƐƚŚĂƚĐŽƵůĚŶŽƚŚĂǀĞďĞĞŶ ĨŽƌĞƐĞĞŶďǇĞŝƚŚĞƌƉĂƌƚǇ͘ ϰ͘ϲKŶŐŽŝŶŐ^ĞƌǀŝĐĞƐ ZĞĨĞƌƚŽdĂďůĞϰ͘ϭĨŽƌƚŚĞĐŽƐƚĂŶĚĚƵƌĂƚŝŽŶŽĨĂŶǇŽŶŐŽŝŶŐƐĞƌǀŝĐĞƐ͘ ϰ͘ϳĐĐŽƵŶƚŝŶŐZĞĐŽƌĚƐ DĐ<ŝŶƐƚƌǇƐŚĂůůĐŚĞĐŬĂůůŵĂƚĞƌŝĂů͕ĞƋƵŝƉŵĞŶƚ͕ĂŶĚůĂďŽƌĞŶƚĞƌŝŶŐŝŶƚŽƚŚĞǁŽƌŬƐŝƚĞĂŶĚƐŚĂůůŬĞĞƉƐƵĐŚĨƵůůĂŶĚ ĚĞƚĂŝůĞĚĂĐĐŽƵŶƚƐĂƐŵĂǇďĞŶĞĐĞƐƐĂƌǇĨŽƌƉƌŽƉĞƌĨŝŶĂŶĐŝĂůŵĂŶĂŐĞŵĞŶƚƵŶĚĞƌƚŚŝƐŐƌĞĞŵĞŶƚ͘dŚĞKǁŶĞƌĂŶĚ ƚŚĞ^WƌŽũĞĐƚDĂŶĂŐĞƌƐŚĂůůďĞĂĨĨŽƌĚĞĚĂĐĐĞƐƐƚŽĂůůDĐ<ŝŶƐƚƌǇ͛ƐƌĞĐŽƌĚƐ͕ďŽŽŬƐ͕ĐŽƌƌĞƐƉŽŶĚĞŶĐĞ͕ ŝŶƐƚƌƵĐƚŝŽŶƐ͕ĚƌĂǁŝŶŐƐ͕ƌĞĐĞŝƉƚƐ͕ǀŽƵĐŚĞƌƐ͕ŵĞŵŽƌĂŶĚĂ͕ĂŶĚƐŝŵŝůĂƌĚĂƚĂƌĞůĂƚŝŶŐƚŽƚŚŝƐŽŶƚƌĂĐƚ͕ĂŶĚƚŚĞ DĐ<ŝŶƐƚƌǇƐŚĂůůƉƌĞƐĞƌǀĞĂůůƐƵĐŚƌĞĐŽƌĚƐĨŽƌĂƉĞƌŝŽĚŽĨƐĞǀĞŶǇĞĂƌƐ͕ŽƌĨŽƌƐƵĐŚůŽŶŐĞƌƉĞƌŝŽĚĂƐŵĂǇďĞ ƌĞƋƵŝƌĞĚďǇůĂǁ͕ĂĨƚĞƌƚŚĞĨŝŶĂůƉĂǇŵĞŶƚ͘ Page 48 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ ϰ͘ϴZĞĐŽŶĐŝůŝĂƚŝŽŶŽĨ>ĂďŽƌΘDĂƚĞƌŝĂůŽƐƚƐ dŚĞŵĂǆŝŵƵŵƉƌŽũĞĐƚĂůůŽǁĂďůĞĐŽƐƚŝƐďĂƐĞĚŽŶĨŝƌŵŶĞŐŽƚŝĂƚĞĚďŝĚƐŽƌĞƐƚŝŵĂƚĞĚůĂďŽƌĂŶĚŵĂƚĞƌŝĂůĐŽƐƚƐ ĚĞǀĞůŽƉĞĚďǇDĐ<ŝŶƐƚƌǇ͘/ŶƌĞĐŽŐŶŝƚŝŽŶƚŚĂƚĂĐƚƵĂů>ĂďŽƌΘDĂƚĞƌŝĂůĐŽƐƚƐŵĂǇǀĂƌǇĨƌŽŵƚŚĞĞƐƚŝŵĂƚĞ͕ƚŚĞ ĨŽůůŽǁŝŶŐƉƌŽĐĞĚƵƌĞƐĂƌĞĞƐƚĂďůŝƐŚĞĚƚŽƌĞĐŽŶĐŝůĞƚŚŝƐĚŝĨĨĞƌĞŶĐĞ͗ ϭ͘/ĨƚŚĞƚŽƚĂůŵĂǆŝŵƵŵŐƵĂƌĂŶƚĞĞĚƉƌŽũĞĐƚĐŽƐƚĂƚĐŽŵƉůĞƚŝŽŶĞǆĐĞĞĚƐƚŚĞĞƐƚŝŵĂƚĞĚĂŵŽƵŶƚ;ƉůƵƐ ĐŽŶƚŝŶŐĞŶĐǇͿ͕ƚŚĞĂĚĚŝƚŝŽŶĂůĐŽƐƚƐǁŝůůďĞďŽƌŶĞďǇDĐ<ŝŶƐƚƌǇĂƚƚŚĞŝƌĞǆƉĞŶƐĞ͘ Ϯ͘/ĨƚŚĞƚŽƚĂůƉƌŽũĞĐƚĐŽƐƚƐĂƚĐŽŵƉůĞƚŝŽŶĂƌĞůĞƐƐƚŚĂŶƚŚĞĞƐƚŝŵĂƚĞĚƉƌŽƉŽƐĂůĂŵŽƵŶƚ;ůĞƐƐĐŽŶƚŝŶŐĞŶĐǇͿ͕ƚŚĞ ƐĂǀŝŶŐƐǁŝůůďĞƌĞƚĂŝŶĞĚďǇƚŚĞKǁŶĞƌ͘ ϯ͘dŚĞƌĞƐŚĂůůďĞŶŽĐŽƐƚƐĂǀŝŶŐƐƐƉůŝƚďĞƚǁĞĞŶƚŚĞKǁŶĞƌĂŶĚDĐ<ŝŶƐƚƌǇ͘ dŚĞĨŽůůŽǁŝŶŐ&ŝŐƵƌĞϰ͘ŽƵƚůŝŶĞƐƉƌŽƉŽƐĞĚƉƌŽĐƵƌĞŵĞŶƚĂŶĚƉĂǇŵĞŶƚƌĞĐŽŶĐŝůŝĂƚŝŽŶŵĞƚŚŽĚƐ͘ŚĂŶŐŝŶŐƚŚĞ ƉƌŽƉŽƐĞĚŵĞƚŚŽĚŽĨƌĞĐŽŶĐŝůŝĂƚŝŽŶĂĨƚĞƌƚŚĞĂĐĐĞƉƚĂŶĐĞŽĨƚŚĞWƌŽƉŽƐĂůŵĂǇƌĞƋƵŝƌĞĂŶĂĚũƵƐƚŵĞŶƚƚŽƚŚĞ 'ƵĂƌĂŶƚĞĞĚDĂǆŝŵƵŵWƌŽũĞĐƚŽƐƚ͘ &/E/d/KE^͗ DĂũŽƌƋƵŝƉŵĞŶƚ͗ DĂũŽƌƋƵŝƉŵĞŶƚŝƐĂŶǇƐŝŶŐůĞƉŝĞĐĞŽĨĞƋƵŝƉŵĞŶƚƉƵƌĐŚĂƐĞĚďǇDĐ<ŝŶƐƚƌǇǁŝƚŚĂǀĂůƵĞŽǀĞƌΨϱ͕ϬϬϬ͘ EĞŐŽƚŝĂƚĞĚ͗ ŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚǀĂůƵĞŝƐƚŽďĞĞƐƚĂďůŝƐŚĞĚƚŚƌŽƵŐŚŶĞŐŽƚŝĂƚŝŽŶƐǁŝƚŚĂƐĞůĞĐƚŽƌƐŝŶŐůĞĐŽŶƚƌĂĐƚŽƌ;ŝ͘Ğ͘ ŽǁŶĞƌƉƌĞĨĞƌƌĞĚĐŽŶƚƌŽůƐĐŽŶƚƌĂĐƚŽƌ͕ŵĞĐŚĂŶŝĐĂůĐŽŶƚƌĂĐƚŽƌ͕ĞƚĐ͘Ϳ͘ ŝĚ͗ ŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚǀĂůƵĞŝƐƚŽďĞĞƐƚĂďůŝƐŚĞĚƚŚƌŽƵŐŚĂďŝĚƉƌŽĐĞƐƐďĂƐĞĚƵƉŽŶĨŽƌŵĂůďŝĚĚŽĐƵŵĞŶƚƐ ŝŶĐůƵĚŝŶŐƉůĂŶƐĂŶĚƐƉĞĐŝĨŝĐĂƚŝŽŶƐǁŚŝĐŚǁŝůůďĞďŝĚƚŽĂŵŝŶŝŵƵŵŽĨƚǁŽ;ƚǇƉŝĐĂůůǇƚŚƌĞĞͿƉƌĞͲƋƵĂůŝĨŝĞĚ ĐŽŶƚƌĂĐƚŽƌƐĂƐĂƉƉƌŽǀĞĚďǇDĐ<ŝŶƐƚƌǇĂŶĚƚŚĞKǁŶĞƌ͘ ^ĞůĨͲWĞƌĨŽƌŵ͗ DĐ<ŝŶƐƚƌǇŝŶƚĞŶĚƐƚŽƉĞƌĨŽƌŵǁŽƌŬǁŝƚŚDĐ<ŝŶƐƚƌǇƉĞƌƐŽŶŶĞů͘ ^ĐŚĞĚƵůĞŽĨsĂůƵĞƐ;^KsͿ͗ ŽƐƚƐŚĂůůďĞƐƵďƐƚĂŶƚŝĂƚĞĚǁŝƚŚĂƉƌŽƉĞƌůǇĞǆĞĐƵƚĞĚŝŶǀŽŝĐĞĨƌŽŵƚŚĞƐƵďĐŽŶƚƌĂĐƚŽƌŽƌƐƵƉƉůŝĞƌƚŚĂƚŵĂƚĐŚĞƐ ƚŚĞƐĐŚĞĚƵůĞŽĨǀĂůƵĞƐŝŶƚŚĞŝƌĐŽŶƚƌĂĐƚŽƌƉƵƌĐŚĂƐĞŽƌĚĞƌ͘ dŝŵĞΘDĂƚĞƌŝĂůƐ;dΘDͿ͗ WƵďůŝƐŚĞĚƐĞůůƌĂƚĞƐǁŝůůďĞĞƐƚĂďůŝƐŚĞĚƉƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĐŽŶƚƌĂĐƚƚŽƐƵďĐŽŶƚƌĂĐƚŽƌŽƌĐŽŵŵĞŶĐĞŵĞŶƚŽĨǁŽƌŬ ďǇDĐ<ŝŶƐƚƌǇ͘ŵŽŶƚŚůǇůĂďŽƌĂŶĚŵĂƚĞƌŝĂůƌĞƉŽƌƚǁŝůůďĞƉƌŽǀŝĚĞĚǁŚŝĐŚǁŝůůŝŶĐůƵĚĞůĂďŽƌŚŽƵƌƐĂŶĚĚŽůůĂƌƐ ƉĞƌŝŶĚŝǀŝĚƵĂů͕ĂŶĚŵĂƚĞƌŝĂůĂŶĚĞƋƵŝƉŵĞŶƚŝŶǀŽŝĐĞƐ͘ &ŝƌŵ͗ &ĞĞƐƚŚĂƚĂƌĞŶĞŐŽƚŝĂƚĞĚƉƌŝŽƌƚŽƉƌŽƉŽƐĂůĂŶĚĂƌĞŶŽƚƌĞĐŽŶĐŝůĞĚĂƚƚŚĞĞŶĚŽĨƚŚĞƉƌŽũĞĐƚ͘ Page 49 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ &ŝŐƵƌĞϰ͘ KE^dZhd/KEK^dd'KZz ;Z&d>ϰ͘ϭͿ WZKWK^KE^dZhd/KEDd,KEK&WZK:dʹZKE/> ŽŶƚƌŽůƐ^ǇƐƚĞŵƐ EĞŐŽƚŝĂƚĞĚ^ƵďĐŽŶƚƌĂĐƚ^ŽůĞ^ŽƵƌĐĞ ^Ks DĂũŽƌƋƵŝƉŵĞŶƚ EĞŐŽƚŝĂƚĞĚ ^Ks ^ŚĞĞƚDĞƚĂů ^ƵďĐŽŶƚƌĂĐƚŝĚ ^Ks ůĞĐƚƌŝĐĂů ^ƵďĐŽŶƚƌĂĐƚŝĚ ^Ks >ŝŐŚƚŝŶŐ ^ƵďĐŽŶƚƌĂĐƚŝĚ ^Ks 'ĞŶĞƌĂůͬKƚŚĞƌ ^ĞůĨͲWĞƌĨŽƌŵ dΘD dͬ^ƚĂƌƚƵƉ ^ĞůĨͲWĞƌĨŽƌŵ dΘD ŽŵŵŝƐƐŝŽŶŝŶŐ ^ĞůĨͲWĞƌĨŽƌŵ dΘD ŚĂŶŐĞKƌĚĞƌ;KͿ Ɛ^ƉĞĐŝĨŝĞĚŝŶK dΘD &ĞĞƐ ^ĞůĨͲWĞƌĨŽƌŵ &ŝƌŵ ϰ͘ϵŽŵƉĞŶƐĂƚŝŽŶ ϭ͘dZD^͗ EĞƚϯϬĚĂǇƐ;ϰϱĚĂǇƐĨŽƌ^ƚĂƚĞdƌĞĂƐƵƌĞƌƉĂǇŵĞŶƚƐͿĨƌŽŵƚŚĞĚĂƚĞŽĨŝŶǀŽŝĐĞ͕ŵŽŶƚŚůǇďŝůůŝŶŐƐĂƐƚŚĞũŽď ƉƌŽŐƌĞƐƐĞƐ͘ Ϯ͘WzDEd^͗ ƚĂŵŝŶŝŵƵŵ͕ƉĂǇŵĞŶƚƐǁŝůůďĞŵĂĚĞŝŶƚŚĞĂŵŽƵŶƚŽĨϭϬϬйĂƚƚŚĞĐŽŵƉůĞƚŝŽŶĂŶĚŝŵƉůĞŵĞŶƚĂƚŝŽŶŽĨĂŶǇ ŝŶĚŝǀŝĚƵĂůĨĂĐŝůŝƚǇŝŵƉƌŽǀĞŵĞŶƚŵĞĂƐƵƌĞ;&/DͿŝŶƚŚĞĂŵŽƵŶƚŽĨƚŚĂƚ&/DĂƐĚĞůŝŶĞĂƚĞĚŝŶƚŚĞĐŽŶƚƌĂĐƚ͘/Ĩ ŵŽƌĞƚŚĂŶŽŶĞ&/DŝƐĐŽŵƉůĞƚĞĚŝŶĂŵŽŶƚŚůǇƉĞƌŝŽĚ͕ĂůůƚŚŽƐĞ&/D^ǁŝůůďĞƉĂŝĚ͘ ϯ͘&/EE,Z'^KEhEW/>E^͗ WĂǇŵĞŶƚƐĚƵĞĂŶĚƵŶƉĂŝĚƐŚĂůůďĞƐƵďũĞĐƚƚŽŝŶƚĞƌĞƐƚĐŚĂƌŐĞƐǁŝƚŚŝŶϯϬĚĂǇƐ;ϰϱĚĂǇƐĨŽƌ^ƚĂƚĞdƌĞĂƐƵƌĞƌ ƉĂǇŵĞŶƚƐͿŽĨƌĞĐĞŝƉƚŽĨĂƉƌŽƉĞƌůǇĐŽŵƉůĞƚĞĚŝŶǀŽŝĐĞƉĞƌZtϯϵ͘ϳϲ͘&ŝŶĂŶĐĞĐŚĂƌŐĞƐǁŝůůďĞĐĂůĐƵůĂƚĞĚŽŶ ƚŚĞƵŶͲƉĂŝĚďĂůĂŶĐĞƉĞƌZtϯϵ͘ϳϲǁŚŝĐŚƐƉĞĐŝĨŝĞƐƚŚĞŝŶƚĞƌĞƐƚƌĂƚĞƐŚĂůůďĞŽŶĞƉĞƌĐĞŶƚƉĞƌŵŽŶƚŚďƵƚŶŽƚ ůĞƐƐƚŚĂŶŽŶĞĚŽůůĂƌƉĞƌŵŽŶƚŚŽŶĂŵŽƵŶƚƐĚƵĞďĞǇŽŶĚϯϬĚĂǇƐ͘/ŶƚĞƌĞƐƚĐŚĂƌŐĞƐǁŝůůďĞĐĂůĐƵůĂƚĞĚĚĂŝůǇ͕ ĐŽŵƉŽƵŶĚĞĚŵŽŶƚŚůǇ͘ŚĂƌŐĞƐĂĐĐƌƵĞƵŶƚŝůďĂůĂŶĐĞƐĂƌĞƉĂŝĚŝŶĨƵůů͘ ϰ͘KE^dZhd/KEWZ/K&/EE,Z'^͗ DĐ<ŝŶƐƚƌǇŵĂǇĐŚĂƌŐĞĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŝŽĚĨŝŶĂŶĐĞĐŚĂƌŐĞƐĨŽƌƉƌŽũĞĐƚƐ͕ŝŶĚĞƉĞŶĚĞŶƚŽĨĨŝŶĂŶĐŝŶŐŵĞƚŚŽĚ͕ ǁŚĞƌĞďǇƚŚĞĂŶƚŝĐŝƉĂƚĞĚďŝůůŝŶŐůĂŐƐƚŚĞĞĂƌŶĞĚƐĐŚĞĚƵůĞŽĨǀĂůƵĞƐďǇŵŽƌĞƚŚĂŶϵϬĚĂǇƐ͘/ĨKǁŶĞƌ ĐŽŶƚƌŽůůĞĚƐĐŚĞĚƵůĞĚĞůĂǇƐŽĐĐƵƌĚƵƌŝŶŐƚŚĞƉƌŽŐƌĞƐƐŽĨƚŚĞƉƌŽũĞĐƚ͕DĐ<ŝŶƐƚƌǇŵĂǇƌĞƋƵĞƐƚĂĚĚŝƚŝŽŶĂů ĨŝŶĂŶĐĞĐŚĂƌŐĞƐďĞĂĚĚĞĚƚŽƚŚĞƉƌŽũĞĐƚ͘ŽŶƐƚƌƵĐƚŝŽŶƉĞƌŝŽĚĨŝŶĂŶĐĞǁŝůůďĞĐĂůĐƵůĂƚĞĚŽŶƚŚĞƵŶͲƉĂŝĚ ďĂůĂŶĐĞĂƚƚŚĞƌĂƚĞŽĨWƌŝŵĞнϮйƉĞƌĂŶŶƵŵ͘/ŶƚĞƌĞƐƚĐŚĂƌŐĞƐǁŝůůďĞĐĂůĐƵůĂƚĞĚĚĂŝůǇ͕ĐŽŵƉŽƵŶĚĞĚ ŵŽŶƚŚůǇ͘ŚĂƌŐĞƐĂĐĐƌƵĞƵŶƚŝůďĂůĂŶĐĞƐĂƌĞƉĂŝĚŝŶĨƵůů͘ ϱ͘DĐ<ŝŶƐƚƌǇĂŶĚƚŚĞKǁŶĞƌǁŝůůǁŽƌŬƚŽŐĞƚŚĞƌƚŽŵŝŶŝŵŝǌĞĨŝŶĂŶĐĞĐŚĂƌŐĞƐ͘ ϲ͘dŚĞĐŽŶƐƚƌƵĐƚŝŽŶƐĐŚĞĚƵůĞŚĂƐďĞĞŶĚĞǀĞůŽƉĞĚďĂƐĞĚŽŶƚŚĞĨŽůůŽǁŝŶŐĂƐƐƵŵƉƚŝŽŶƐ͗ Ă͘KǁŶĞƌƌĞǀŝĞǁŽĨĨŝŶĂůŶĞƌŐǇ^ĞƌǀŝĐĞƐWƌŽƉŽƐĂů;^WͿϭϬǁŽƌŬŝŶŐĚĂǇƐ ď͘DĐ<ŝŶƐƚƌǇƌĞĐĞŝǀĞƐŶŽƚŝĐĞƚŽƉƌŽĐĞĞĚǁŝƚŚŝŶϭϱǁŽƌŬŝŶŐĚĂǇƐĨƌŽŵƚŚĞĨŝŶĂůƌĞǀŝĞǁƌĞƐƉŽŶƐĞƐ Page 50 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ ϳ͘^h^dEd/d/KEK&&/EE,Z'͗ DĐ<ŝŶƐƚƌǇǁŝůůĚŽĂŶĂĐĐŽƵŶƚŝŶŐŽĨĨŝŶĂŶĐĞĐŚĂƌŐĞƐƉƌŽŐƌĞƐƐŝǀĞůǇƚŚƌŽƵŐŚƚŚĞƉƌŽũĞĐƚ͕ĂŶĚĂƚĐŽŶƚƌĂĐƚ ĐŽŵƉůĞƚŝŽŶƐƵďŵŝƚĂĐŚĂŶŐĞƌĞƋƵĞƐƚŝƚĞŵŝǌŝŶŐƚŚĞƐƵŵŵĂƌǇŽĨĂĚĚŝƚŝŽŶĂůĐŽƐƚƐĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ͘dŚĞ ĐŽŶƚƌĂĐƚǁŝůůƚŚĞŶďĞŝŶĐƌĞĂƐĞĚƚŽƌĞĨůĞĐƚƚŚĞƐĂŵĞĂŶĚĨŝŶĂŶĐĞĐŚĂƌŐĞƐǁŝůůďĞƉĂŝĚǁŝƚŚŝŶϯϬĚĂǇƐŽĨƚŚĞ ĚĂƚĞŽĨĂƉƉƌŽǀĞĚƐƵďƐƚĂŶƚŝĂƚŝŽŶ͘ ϰ͘ϭϬ&ŝŶĂŶĐŝŶŐ DĐ<ŝŶƐƚƌǇĞŶũŽǇƐŽǀĞƌϱϱǇĞĂƌƐŽĨĞǆƉĞƌŝĞŶĐĞǁŝƚŚŝŶƚŚĞĞŶŐŝŶĞĞƌŝŶŐĂŶĚĐŽŶƚƌĂĐƚŝŶŐŝŶĚƵƐƚƌǇĂŶĚŝƚƐĨŝŶĂŶĐŝĂů ƐƚƌĞŶŐƚŚĞǆĐĞĞĚƐƚŚĞŝŶĚƵƐƚƌǇĂǀĞƌĂŐĞ͘dŚŝƐƐƚƌĞŶŐƚŚŵĂŬĞƐŝƚƉŽƐƐŝďůĞƚŽƉƌŽǀŝĚĞĂŶĚĂƐƐŝƐƚǁŝƚŚƚŚĞĨŝŶĂŶĐŝŶŐ ŶĞĞĚƐŽĨŝƚƐĐƵƐƚŽŵĞƌƐ͘>ŽŶŐƐƚĂŶĚŝŶŐƌĞůĂƚŝŽŶƐŚŝƉƐǁŝƚŚǀĞŶĚŽƌƐĂƐƐƵƌĞƐƌĞĂƐŽŶĂďůĞƉƌŝĐŝŶŐĂŶĚĞǆĐĞůůĞŶƚ ƉĂǇŵĞŶƚƚĞƌŵƐ͘ >KE'ͲdZD&/EE/E'͗ dŚĞKǁŶĞƌŚĂƐƐĞǀĞƌĂůŽƉƚŝŽŶƐĂǀĂŝůĂďůĞĨŽƌůŽŶŐƚĞƌŵƉĞƌŵĂŶĞŶƚĨŝŶĂŶĐŝŶŐ͘dŚĞtĂƐŚŝŶŐƚŽŶ^ƚĂƚĞdƌĞĂƐƵƌĞƌ͛Ɛ KĨĨŝĐĞĐĂŶƉƌŽǀŝĚĞĨŝŶĂŶĐŝŶŐ͘dŚŝƌĚWĂƌƚǇĨŝŶĂŶĐŝŶŐŝƐĂůƐŽĂǀĂŝůĂďůĞ͘ ϰ͘ϭϭdĞƌŵŝŶĂƚŝŽŶsĂůƵĞ ^ŚŽƵůĚƚŚĞŽǁŶĞƌĐŚŽŽƐĞƚŽĨŝŶĂŶĐĞƚŚĞƉƌŽũĞĐƚƚŚƌŽƵŐŚDĐ<ŝŶƐƚƌǇ͕ĂƐĐŚĞĚƵůĞǁŝůůďĞƉƌŽǀŝĚĞĚƐŚŽǁŝŶŐƚŚĞ ƚĞƌŵŝŶĂƚŝŽŶǀĂůƵĞŽĨƚŚĞĨŝŶĂŶĐŝŶŐĂŐƌĞĞŵĞŶƚĨŽƌĞĂĐŚǇĞĂƌĚƵƌŝŶŐƚŚĞƚĞƌŵŽĨƚŚĞĂŐƌĞĞŵĞŶƚ͘ ϰ͘ϭϮdĞƌŵƐŽĨŐƌĞĞŵĞŶƚ dŚĞŽŶƚƌĂĐƚƐŚĂůůďĞĞĨĨĞĐƚŝǀĞĂŶĚďŝŶĚŝŶŐƵƉŽŶƚŚĞƉĂƌƚŝĞƐŝŵŵĞĚŝĂƚĞůǇƵƉŽŶŝƚƐĞǆĞĐƵƚŝŽŶĂŶĚƚŚĞƉĞƌŝŽĚĨƌŽŵ ĐŽŶƚƌĂĐƚĞǆĞĐƵƚŝŽŶƵŶƚŝůƚŚĞŽŵŵĞŶĐĞŵĞŶƚŽĨŶĞƌŐǇ^ĂǀŝŶŐƐĂƚĞƐŚĂůůďĞŬŶŽǁŶĂƐƚŚĞΗ/ŶƚĞƌŝŵWĞƌŝŽĚΗ͘ůů ĞŶĞƌŐǇƐĂǀŝŶŐƐĂĐŚŝĞǀĞĚĚƵƌŝŶŐƚŚĞŝŶƚĞƌŝŵƉĞƌŝŽĚǁŝůůďĞĨƵůůǇĐƌĞĚŝƚĞĚƚŽƚŚĞKǁŶĞƌ͘ ϰ͘ϭϯ/ŶƐƵƌĂŶĐĞΘŽŶĚŝŶŐ DĐ<ŝŶƐƚƌǇƐŚĂůůƉƌŽǀŝĚĞĂƉĂǇŵĞŶƚĂŶĚƉĞƌĨŽƌŵĂŶĐĞďŽŶĚĂŶĚďƵŝůĚĞƌƐZŝƐŬ/ŶƐƵƌĂŶĐĞ͘ &ŽƌdŚĞWƵƌƉŽƐĞƐŽĨdŚŝƐŐƌĞĞŵĞŶƚ͕ƚŚĞΗ^ƵŵŵŽƵŶƚŽĨŽŶĚΗ^ŚĂůůĞ;^ĞĞdĂďůĞϰ͘ϭʹ͞ƵĚŐĞƚ^ƵŵŵĂƌǇ͟Ϳ͘ ϭ͘dŚĞďŽŶĚĂŵŽƵŶƚĐŽŶƐŝƐƚƐŽĨ>ĂďŽƌĂŶĚDĂƚĞƌŝĂůƐĂŶĚ^ƚĂƚĞ^ĂůĞƐdĂǆ͘ Ϯ͘dŚŝƐďŽŶĚĚŽĞƐŶŽƚŝŶĐůƵĚĞĂŶǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚŝŶŐĞŶĐŝĞƐ͘ ϯ͘ĞƌƚŝĨŝĐĂƚĞƐŽĨ'ĞŶĞƌĂů>ŝĂďŝůŝƚǇ/ŶƐƵƌĂŶĐĞǁŝůůďĞƉƌŽǀŝĚĞĚƉƌŝŽƌƚŽŽŶƚƌĂĐƚ^ŝŐŶŝŶŐ͘dŚĞ^ƚĂƚĞŽĨtĂƐŚŝŶŐƚŽŶ ƐŚĂůůďĞŶĂŵĞĚĂƐŶĚĚŝƚŝŽŶĂů/ŶƐƵƌĞĚŽŶĂůůŝŶƐƵƌĂŶĐĞĐĞƌƚŝĨŝĐĂƚĞƐ͘ DĐ<ŝŶƐƚƌǇƐŚĂůůƉƌŽǀŝĚĞĂƉĂǇŵĞŶƚĂŶĚƉĞƌĨŽƌŵĂŶĐĞďŽŶĚŝŶƚŚĞĂŵŽƵŶƚŽĨϭϬϬйŽĨƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶĐŽƐƚ͕ĂƐ ĚĞĨŝŶĞĚŝŶƚŚĞŶĞƌŐǇ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚĚĚĞŶĚƵŵ͘dŚĞĂŵŽƵŶƚƐŚĂůůŝŶĐůƵĚĞĂůůĂƵƚŚŽƌŝǌĞĚĐŚĂŶŐĞƐĂŶĚƐƚĂƚĞ ƐĂůĞƐƚĂǆ͘dŚĞŽŶĚƐŚĂůůďĞŝŶƚŚĞĨŽƌŵĂƚƚĂĐŚĞĚƚŽƚŚĞŽŶĚŝƚŝŽŶƐŽĨƚŚĞŶĞƌŐǇ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚ͘dŚĞ ŽŶƚƌĂĐƚůŝƐƚĞĚŽŶƚŚĞďŽŶĚĨŽƌŵƐŚĂůůďĞƚŚĞĚĚĞŶĚƵŵEŽ͘ĂŶĚŐƌĞĞŵĞŶƚEŽ͕͘ǁŚŝĐŚŝŶĐŽƌƉŽƌĂƚĞƐƚŚĞǁŽƌŬ͕ ĂŶĚƚŚĞ͞ŽŶƚƌĂĐƚĂƚĞ͟ƐŚĂůůďĞƚŚĞĚĂƚĞŽĨƚŚĞĚĚĞŶĚƵŵ͘dŚĞĨƵůůĂŶĚũƵƐƚƐƵŵŽĨƚŚĞŽŶĚƐŚĂůůďĞĂƐ ĚĞĨŝŶĞĚĂďŽǀĞĂŶĚƐŚĂůůŝŶĐůƵĚĞƚŚĞĂĐƚƵĂůĐŽƐƚŽĨƉƵƌĐŚĂƐŝŶŐĂŶĚŝŶƐƚĂůůŝŶŐDĐ<ŝŶƐƚƌǇ͛ƐƋƵŝƉŵĞŶƚ͘dŚĞŽŶĚ ƐŚĂůůƐƉĞĐŝĨŝĐĂůůǇĞǆĐůƵĚĞĐŽǀĞƌĂŐĞĨŽƌƚŚŽƐĞƉŽƌƚŝŽŶƐŽĨƚŚĞŶĞƌŐǇ^ĞƌǀŝĐĞƐŐƌĞĞŵĞŶƚĂŶĚͬŽƌŶĞƌŐǇ^ĞƌǀŝĐĞƐ ŐƌĞĞŵĞŶƚĚĚĞŶĚƵŵƉĞƌƚĂŝŶŝŶŐƚŽĚĞƐŝŐŶƐĞƌǀŝĐĞƐ͕ĞŶĞƌŐǇĐŽƐƚƐĂǀŝŶŐƐŐƵĂƌĂŶƚĞĞ͕ŵĂŝŶƚĞŶĂŶĐĞŐƵĂƌĂŶƚĞĞ͕ ƵƚŝůŝƚǇŝŶĐĞŶƚŝǀĞƐ͕ĞĨĨŝĐŝĞŶĐǇŐƵĂƌĂŶƚĞĞƐ͕ĂŶĚĂŶǇŽƚŚĞƌĐůĂƵƐĞƐǁŚŝĐŚĚŽŶŽƚƌĞůĂƚĞƐƉĞĐŝĨŝĐĂůůǇƚŽĐŽŶƐƚƌƵĐƚŝŽŶ ŵĂŶĂŐĞŵĞŶƚĂŶĚƐƵƉĞƌǀŝƐŝŽŶŽĨǁŽƌŬĨŽƌƉƵƌĐŚĂƐŝŶŐĂŶĚŝŶƐƚĂůůŝŶŐŽĨDĐ<ŝŶƐƚƌǇ͛ƐƋƵŝƉŵĞŶƚ͕ŽƌĨŽƌǁŽƌŬƚŽďĞ Page 51 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WƌŽũĞĐƚ&ŝŶĂŶĐŝĂůƐ ĂĐĐŽŵƉůŝƐŚĞĚďǇƚŚĞKǁŶĞƌ͘dŚĞŽŶĚƐŚĂůůďĞǁŝƚŚĂ^ƵƌĞƚǇŽƌŽŶĚŝŶŐŽŵƉĂŶǇƚŚĂƚŝƐƌĞŐŝƐƚĞƌĞĚǁŝƚŚƚŚĞ ^ƚĂƚĞŽĨtĂƐŚŝŶŐƚŽŶ/ŶƐƵƌĂŶĐĞŽŵŵŝƐƐŝŽŶĞƌΖƐKĨĨŝĐĞ͘ tŚŝůĞDĐ<ŝŶƐƚƌǇƐƚĂŶĚƐďĞŚŝŶĚŽƵƌƐĂĨĞƚǇƌĞĐŽƌĚ͕ǁĞĐĂŶŶŽƚĐŽŶƚƌŽůƚŚĞǁŽƌŬĨůŽǁĂƌŽƵŶĚŝƚĞŵƐǁĞŚĂǀĞŶŽ ĐŽŶƚƌŽůŽǀĞƌ͘ƚŶŽƉŽŝŶƚĚŽĞƐDĐ<ŝŶƐƚƌǇĂƐƐƵŵĞĂŶǇƌĞƐƉŽŶƐŝďŝůŝƚǇĨŽƌƚŚĞůŽƐƐŽĨƵƐĞŽĨĂŶǇĞƋƵŝƉŵĞŶƚĂŶĚǁĞ ĞǆĐůƵĚĞĂŶǇĂŶĚĂůůĐůĂŝŵƐĨŽƌĐŽŶƐĞƋƵĞŶƚŝĂůĚĂŵĂŐĞƐƚŚĞƌĞŝŶ͘ ϰ͘ϭϰŝǀĞƌƐĞƵƐŝŶĞƐƐWĂƌƚŝĐŝƉĂƚŝŽŶ'ŽĂůƐĨŽƌƚŚŝƐWƌŽũĞĐƚ DĐ<ŝŶƐƚƌǇŚĂƐĞƐƚĂďůŝƐŚĞĚƚŚĞĨŽůůŽǁŝŶŐĚŝǀĞƌƐĞďƵƐŝŶĞƐƐƉĂƌƚŝĐŝƉĂƚŝŽŶŐŽĂůƐĨŽƌƚŚŝƐƉƌŽũĞĐƚŝŶĐŽŶƐƵůƚĂƚŝŽŶǁŝƚŚ ƚŚĞKǁŶĞƌĂŶĚƚŚĞ^ŶĞƌŐǇWƌŽŐƌĂŵ͘ DĐ<ŝŶƐƚƌǇǁŝůůŶŽƚďĞĂďůĞƚŽŵĞĞƚƚŚĞDĐ<ŝŶƐƚƌǇƐƚĂŶĚĂƌĚ/ŶĐůƵƐŝŽŶWůĂŶĚŝǀĞƌƐĞďƵƐŝŶĞƐƐƉĂƌƚŝĐŝƉĂƚŝŽŶŐŽĂůƐĨŽƌ ƚŚĞĨŽůůŽǁŝŶŐƌĞĂƐŽŶƐ͗ ;ϭͿdŚĞKǁŶĞƌŚĂƐĚŝƌĞĐƚĞĚDĐ<ŝŶƐƚƌǇƚŽƐƵďĐŽŶƚƌĂĐƚƚŽƉĂƌƚŝĐƵůĂƌďƵŝůĚŝŶŐĐŽŶƚƌŽůƐĂŶĚĨŝƌĞƉƌŽƚĞĐƚŝŽŶ ƐƵďĐŽŶƚƌĂĐƚŽƌƐĨŽƌƐƚĂŶĚĂƌĚŝǌĂƚŝŽŶǁŝƚŚƚŚĞŝƌĞǆŝƐƚŝŶŐďƵŝůĚŝŶŐĐŽŶƚƌŽůƐĂŶĚĨŝƌĞƉƌŽƚĞĐƚŝŽŶƐǇƐƚĞŵ͘ WŽƚĞŶƚŝĂůĨŽƌůŽǁǀŽůƚĂŐĞĞůĞĐƚƌŝĐĂůŝŶƐƚĂůůĂƚŝŽŶƐĞĐŽŶĚƚŝĞƌƐƵďĐŽŶƚƌĂĐƚŝŶŐŝƐďĞŝŶŐĞǀĂůƵĂƚĞĚ͘ DĐ<ŝŶƐƚƌǇŚĂƐƉƌŽǀŝĚĞĚŝŶĨŽƌŵĂƚŝŽŶĂŶĚƚƌĂŝŶŝŶŐƚŽŵĂŶǇƉŽƚĞŶƚŝĂůƐƵďĐŽŶƚƌĂĐƚŽƌƐ͕ƐƵƉƉůŝĞƌƐ͕ĂŶĚĐŽŶƐƵůƚĂŶƚƐ ŽŶŚŽǁƚŽƌĞŐŝƐƚĞƌĨŽƌƚŚĞ^ƚĂƚĞĐĞƌƚŝĨŝĐĂƚŝŽŶƐ͘ &ŝŐƵƌĞϰ͘ 6WDWH&HUWLILFDWLRQ &DWHJRULHV 0(6$ $PHQGPHQW1R 3HUFHQWDJHV )RUWKLV3URMHFW 3HUFHQWDJHVIRU &RQVWUXFWLRQ )RUWKLV3URMHFW 3HUFHQWDJHVIRU 3URIHVVLRQDO6HUYLFHV 0LQRULW\RZQHGEXVLQHVV :RPHQRZQHGEXVLQHVV 9HWHUDQRZQHGEXVLQHVV 6PDOOPLQLPLFUREXVLQHVV Page 52 of 107 AGENDA ITEM #5. d) 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3KZLWK*HQHUDWRU 'DWH 5HYLVLRQ(635HY 'DWDEDVH,'0HFKDQLFDO (OHFWULFDO (0&6 /LJKWLQJ *HQHUDO (TXLSPHQW 2WKHU 7RWDO $5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV 5&+8SJUDGH,75RRP&RROLQJ &&3*8SJUDGH/LJKWLQJWR/(' 5&+8SJUDGH%XLOGLQJ*HQHUDWRU 5&+8SJUDGH)LUH3XPS 7RWDO%DVH),0&RVW $&RQVWUXFWLRQ&RVWV &RQVWUXFWLRQ%RQGV 3HUFHQWRI6XEWRWDO),0&RVWDQG$ 7RWDO&RQVWUXFWLRQ&RVW %3URIHVVLRQDO6HUYLFHV&RVWV $XGLW)HH /XPS 'HVLJQ 3HUFHQWRI7RWDO%DVH),0&RVW &RQVW0DQDJHPHQW 3URM$GPLQ 3HUFHQWRI7RWDO%DVH),0&RVW 7RWDO3URIHVVLRQDO6HUYLFHV&RVW &2WKHU3URMHFW&RVWV 3URMHFW&RQWLQJHQF\ 3HUFHQWRI7RWDO%DVH),0&RVW $SSUHQWLFHVKLS,QFHQWLYH /XPS :$6WDWH$SSUHQWLFHVKLS5HTXLUHPHQWIRU3URMHFWVZLWK&RQVWUXFWLRQ&RVW! 0 3HUIRUPDQFH$VVXUDQFH0 9 /XPS 7RWDO2WKHU3URMHFW&RVW '2YHUKHDG&RVWV )HHV 2YHUKHDG 3HUFHQWRI7RWDO&RQVWUXFWLRQ&RVW 3URILW)HH 3HUFHQWRI7RWDO&RQVWUXFWLRQ&RVW 7RWDO2YHUKHDG&RVW )HH (7RWDO*XDUDQWHHG&RQVWUXFWLRQ (6&26HUYLFHV$%&' )1RQ*XDUDQWHHG&RVWV 6DOHV7D[ 3HUFHQWRI6HFWLRQ( ,QWHUDJHQF\)HH /XPS 7RWDO1RQ*XDUDQWHHG&RVW *7RWDO0D[LPXP3URMHFW&RVW() Table 4.1 - Budget Summary ),01DPH AGENDA ITEM #5. d) Page 54 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Table 4.2 - Facility Improvement Measure (FIM) Summary 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3KZLWK*HQHUDWRU 'DWH 5HYLVLRQ )DFLOLW\,PSURYHPHQW 0HDVXUHV ),0'HVFULSWLRQ )DFLOLW\ %XGJHW $QQXDO8WLOLW\ 6DYLQJV $QQXDO 2SHUDWLRQDO 6DYLQJV 6LPSOH3D\EDFN 63% 3RWHQWLDO ,QFHQWLYHV 1HW&XVWRPHU &RVWZLWK ,QFHQWLYHV 6LPSOH3D\EDFN 63% ZLWK,QFHQWLYHV $5&+8SJUDGH %RLOHUV3XPSVDQG6WRUDJH 7DQNV ([LVWLQJ7KHFLW\KDOOLVVHUYHGE\WKUHHKHDWLQJKRWZDWHUERLOHUV7KHVDPHERLOHUV\VWHPDOVRSURYLGHV GRPHVWLFKRWZDWHU'+:IRUWKHORFNHUURRPVDQGVKHOWHU7KLV++:DQG'+:V\VWHPLVDWWKHHQGRILWV VHUYLFHOLIH7KLVPHDVXUHORRNVDWUHSODFLQJWKLVV\VWHPZLWKWZRVHSDUDWH++:DQG'+:V\VWHPV 3URSRVHG8SJUDGHWKH++:ERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJERLOHUV8SJUDGHWKH++:K\GURQLF V\VWHPDQGSURYLGHV\VWHPSXPSV'HPROLVKWKH'+:KHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUVWRUDJH WDQNV3URYLGHWZRKLJKHIILFLHQF\GRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGH GRPHVWLFZDWHUUHFLUFXODWLQJSXPS'+:ZLOOEHGHFRXSOHGIURPWKHEXLOGLQJ++:ORRS 5HQWRQ&LW\ +DOO 1HHGV%DVHG 1HHGV%DVHG 5&+8SJUDGH,7 5RRP&RROLQJ ([LVWLQJ7KH,75RRPLVVHUYHGE\VSOLWV\VWHPIDQFRLOXQLWVORFDWHGDERYHWKHVHUYHUUDFNVDQG FRQGHQVHUXQLWVORFDWHGLQWKH3DUNLQJ*DUDJH9HQWLODWLRQLVSURYLGHGE\WKHFHQWUDOEXLOGLQJYHQWLODWLRQ V\VWHP7KHH[LVWLQJV\VWHPLVWLHGLQWRWKHFHQWUDOILUHDODUPV\VWHPDQGVKXWVGRZQGXULQJWHVWLQJ 3URSRVHG'HPROLVKH[LVWLQJIDQFRLOXQLWVDQGFRQGHQVHUXQLWVVHUYLQJWKH,7URRP3URYLGHRXWVLGHDLUDQG H[KDXVWORXYUHVIRUWKH,75RRPZKLFKZLOODOORZIRUDLUVLGHHFRQRPL]LQJDQGGHFRXSOHGYHQWLODWLRQ3URYLGH ZDOOPRXQWHGVSOLWV\VWHPFRROLQJRQO\XQLWVWRVHUYHWKH,7URRP,IDOORZHGFRROLQJDQGYHQWLODWLRQ V\VWHPWREHGHFRXSOHGIURPWKHFHQWUDOILUHDODUPV\VWHP 5HQWRQ&LW\ +DOO 1HHGV%DVHG 1HHGV%DVHG &&3*8SJUDGH /LJKWLQJWR/(' ([LVWLQJ7KH&LW\&HQWHU3DUNLQJ*DUDJHLVSULPDULO\OLWE\IOXRUHVFHQW7ODPSV 3URYLGH3URYLGHLQWHULRUOLJKWLQJXSJUDGHWR/('/('XSJUDGHVWRLQFOXGH/('ODPSDQGGULYHUUHSODFHPHQWV 5HQWRQ&LW\ &HQWHU 3DUNLQJ *DUDJH 5&+8SJUDGH %XLOGLQJ*HQHUDWRU 3URSRVHG8SJUDGHWKHWZREXLOGLQJJHQHUDWRUVWRDVLQJOHN:JHQHUDWRUEDVHGRQWKHDWWDFKHG6D]DQ GHVLJQGRFXPHQWV3URYLGHDJDOORQGD\WDQNDQGJDOORQGLHVHOWDQN8/FHUWLILHGWDQNZLWKD IXHOSROLVKLQJV\VWHP 5HQWRQ&LW\ +DOO 1HHGV%DVHG 1HHGV%DVHG AGENDA ITEM #5. d) )DFLOLW\,PSURYHPHQW 0HDVXUHV ),0'HVFULSWLRQ )DFLOLW\ %XGJHW $QQXDO8WLOLW\ 6DYLQJV $QQXDO 2SHUDWLRQDO 6DYLQJV 6LPSOH3D\EDFN 63% 3RWHQWLDO ,QFHQWLYHV 1HW&XVWRPHU &RVWZLWK ,QFHQWLYHV 6LPSOH3D\EDFN 63% ZLWK,QFHQWLYHV 5&+8SJUDGH)LUH 3XPS ([LVWLQJ7KHHOHFWULFDQGGLHVHOILUHSXPSVDUHERWKDWWKHHQGRUWKHLUVHUYLFHOLIH 3URSRVHG'XHWRFKDQJHVLQFRGHUHTXLUHPHQWVDVLPSOHUHSODFHPHQWRIWKHILUHSXPSVLVQRWSRVVLEOH &XUUHQWFRGHUHTXLUHVXSVL]LQJWKHILUHSXPSVIURPKSWRRUKSUHTXLULQJDQXSJUDGHRIWKH HOHFWULFDOIHHGHUV$OVRGXHWRWKHKSFKDQJHWKHILUHFRQWUROOHUVPXVWEHXSJUDGHG$OVRWKHH[LVWLQJ FRQWUROOHUVGRQRWKDYHWKHUHTXLUHGPRQLWRUHGSRLQWVDQGZLOOUHTXLUHUHSODFLQJ5HSODFHERWKWKH'LHVHODQG (OHFWULF)LUH3XPSVZLWKFRGHFRPSOLDQW)LUH3XPSV5HSODFHWKHGLHVHOVWRUDJHWDQNWRFRPSO\ZLWKWKH EXLOGLQJFRGH6&23(2):25.,1&/8'(69LEUDWLRQ,VRODWLRQ3URYLGHYLEUDWLRQLVRODWRUV'LHVHO)LUH3XPS'HPR H[LVWLQJGLHVHOILUHSXPS3URYLGHDGLHVHOILUHSXPSUDWHGIRUJSPDWIWKGZLWKDQHZJDOIXHO WDQNFRPSDWLEOHZLWK)LUHWURO,QF'LHVHO)LUH3XPS&RQWUROOHU&DWDORJ1R)7$'/1'&9ROWV 1HJDWLYH*URXQG9+]$PSV5HXVHH[LVWLQJFRPEXVWLRQIOXH3URYLGHQHZFRQQHFWLRQIURPWKH GLHVHOSXPSWRWKHH[LVWLQJIOXH(OHFWULFDO)LUH3XPS%DVLF6FRSH(OHFWULFDOZRUNDVVRFLDWHGZLWKWKH UHSODFHPHQWRIWKHH[LVWLQJILUHSXPSV7ZRRSWLRQVDUHSURYLGHG%RWKRSWLRQVDUHEDVHGRQHTXLSPHQWLQ TXRWHIURP&26&2)LUHGDWHG'D\0HWHULQJ'D\0HWHULQJZLOOQRWEHQHHGHGIRUWKLVSURMHFW VFRSH2SWLRQ5HSODFHPHQWRI(OHFWULFDQG'LHVHO)LUH3XPSVDQG&RQWUROOHUV([LVWLQJV\VWHPFRQILJXUDWLRQ WRUHPDLQ'LHVHOILUHSXPSVHUYHVDVEDFNXSIRU(OHFWULFILUHSXPS'LHVHO)LUH3XPS'LVFRQQHFWYROW SRZHUIURPGLHVHOILUHSXPSFRQWUROOHU5HFRQQHFWYROWSRZHUWRQHZGLHVHOILUHSXPSFRQWUROOHU$OORWKHU ZRUNDVVRFLDWHGZLWKGHPRDQGUHSODFHPHQWRIGLHVHOILUHSXPSDQGFRQWUROOHULVE\)LUH3URWHFWLRQ &RQWUDFWRU(OHFWULF)LUH3XPS([LVWLQJHOHFWULFILUHSXPSLVYROWSKDVHKS5HSODFHPHQWILUHSXPS LVVDPHYROWDJHDQGKS6DIHRIISRZHUWRWKHH[LVWLQJILUHSXPS7KLVZLOOUHTXLUHXWLOLW\VKXWGRZQDVILUH SXPSLVIHGIURPGHGLFDWHGXWLOLW\VHUYLFH'LVFRQQHFWH[LVWLQJFRQGXFWRUVIURPHOHFWULFILUHSXPSFRQWUROOHU DQGHOHFWULFILUHSXPS([LVWLQJHOHFWULFILUHSXPSDQGFRQWUROOHUWREHGHPR¶GE\)LUH3URWHFWLRQ &RQWUDFWRU0HJJHUDOOFRQGXFWRUVWRFRQILUPLQVXODWLRQLQWHJULW\$IWHULQVWDOORIQHZHOHFWULFDOILUHSXPSDQG FRQWUROOHUE\)LUH3URWHFWLRQ&RQWUDFWRUUHFRQQHFWDOOFRQGXFWRUV6WUXFWXUDO6WHHO)LUHSXPSV3URYLGHVHLVPLF DWWDFKPHQWFRQQHFWLRQWRFRQFUHWH+RXVHNHHSLQJSDG$VVXPHGH[LVWLQJFRQFUHWHSDGWRUHPDLQDQG UHXVH3URYLGHVSULQJLVRODWLRQVVQXEEHUVDQGSXPSEDVH0HFK3LSH3URYLGHVHLVPLFEUDFLQJIRUDOO03DQG SOXPELQJWKDWWULJJHUVVHLVPLFEUDFLQJSHUVWUXFWXUDOFRGH$6&(FKDSWHU6SHFLDOLQVSHFWLRQ3RVW LQVWDOOFRQFUHWHDQFKRUVVSHFLDOSHULRGLFLQVSHFWLRQ&RQWUROV3URYLGHIXQFWLRQDOSHUIRUPDQFHWHVWLQJRIQHZ SXPSVZLWKH[LVWLQJILUHFRQWUROOHUV3URYLGHFRQILGHQFHWHVWLQJRIILUHDODUPV\VWHPDQGWZRILUH SXPSV&RPPLVVLRQLQJ3URYLGHVWDUWXSDQGFRPPLVVLRQLQJRIRQHHOHFWULFGLHVHOILUHSXPSDQGRQHGLHVHOILUH SXPS7UDLQLQJ3URYLGHWUDLQLQJDVUHTXLUHGIRUWKLV),0 5HQWRQ&LW\ +DOO 1HHGV%DVHG 1HHGV%DVHG 7RWDOV 6LQFHGHVLJQFRVWDXGLWFRVWHWFDUHGLVWULEXWHGDPRQJWKH),0VWKHWRWDOSURMHFWFRVWZLOOQRWJRXSRUGRZQE\H[DFWO\WKHDPRXQWVVKRZQKHUHLID),0RU),0VDUHGURSSHG )RUQRQUHFXUULQJRSHUDWLRQDOVDYLQJVWKHYDOXHVDUHDYHUDJHGRYHUWKH\HDUOHQJWKRIWKLVDQDO\VLV ,QFHQWLYHVDUHFRQWLQJHQWRQILQDODSSURYDODQGDUHQRWJXDUDQWHHG)XQGVDUHVKRZQIRUUHIHUHQFHRQO\ &RQILGHQWLDODQG3URSULHWDU\ AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz WZK:dED ^Zs/^K&&Zͮϭ ŝƚǇŽĨZĞŶƚŽŶ DƵůƚ͘WƌŽƉĞƌƚŝĞƐWŚϭ /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ZEdKE͕t^,/E'dKE WZ/>ϮϮ͕ϮϬϮϬʹZs/^/KEϭ Page 57 of 107 AGENDA ITEM #5. d) Page 58 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz ŽŶƚĞŶƚƐ ^d/KEϱ͘ϭWhZWK^EKZ'E/d/KE͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϴϳ ^d/KEϱ͘Ϯy/^d/E'&/>/dz^Z/Wd/KE͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϴϵ ^d/KEϱ͘ϯ&/>/dz/DWZKsDEdD^hZ^Ͳ>h>d/KE^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϬϯ &/DηϬϭ͘ϬϭͲZ,͗hW'ZK/>Z^͕WhDW^E^dKZ'dE<^ &/DηϬϯ͘ϬϰͲZ,͗hW'Z/dZKKDKK>/E' &/DηϬϵ͘ϬϭͲW'͗hW'Z>/',d/E'dK> ^d/KEϱ͘ϰ&/D͛^KE^/ZhdEKdh^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮϯ ^d/KEϱ͘ϱhd/>/dzd͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮϳ AGENDA ITEM #5. d) Page 60 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ϱ͘ϭWhZWK^EKZ'E/d/KE dŚŝƐĞǆŚŝďŝƚĚŽĐƵŵĞŶƚƐƚŚĞĂŶĂůǇƐŝƐƉĞƌĨŽƌŵĞĚƚŽĞƐƚĂďůŝƐŚƚŚĞƵƚŝůŝƚǇĂŶĚŽƉĞƌĂƚŝŽŶĂůƐĂǀŝŶŐƐĨŽƌƚŚĞƉƌŽũĞĐƚ͘ dŚĞŝŶĨŽƌŵĂƚŝŽŶŝƐŽƌŐĂŶŝǌĞĚďǇ&/D;&ĂĐŝůŝƚǇ/ŵƉƌŽǀĞŵĞŶƚDĞĂƐƵƌĞͿĂƐĨŽůůŽǁƐ͗ ͻ&/DEĂƌƌĂƚŝǀĞǁŝƚŚŬĞǇĂƐƐƵŵƉƚŝŽŶƐĂŶĚĐƌŝƚĞƌŝĂ ͻ^ĂǀŝŶŐƐĐĂůĐƵůĂƚŝŽŶŵĞƚŚŽĚŽůŽŐǇĂŶĚĂŶĂůǇƐŝƐ ĚĚŝƚŝŽŶĂůůǇ͕ƌĞůĞǀĂŶƚƐŝƚĞƐƵƌǀĞǇĚĂƚĂ͕ŵĞĂƐƵƌĞŵĞŶƚĂŶĚǀĞƌŝĨŝĐĂƚŝŽŶĚĂƚĂ͕ƵƚŝůŝƚǇŝŶĨŽƌŵĂƚŝŽŶĂŶĚŵŝƐĐĞůůĂŶĞŽƵƐ ďĂĐŬͲƵƉŝŶĨŽƌŵĂƚŝŽŶĂƌĞƉƌŽǀŝĚĞĚŝŶƚŚĞƐĞĐƚŝŽŶƐĨŽůůŽǁŝŶŐƚŚĞǀĂƌŝŽƵƐ&/DƐĞĐƚŝŽŶƐ͘ Page 61 of 107 AGENDA ITEM #5. d) Page 62 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ϱ͘Ϯy/^d/E'&/>/dz^Z/Wd/KE ZEdKE/dz,>> *(1(5$/,1)250$7,21 dŚĞZĞŶƚŽŶŝƚǇ,Ăůů͕ůŽĐĂƚĞĚĂƚϭϬϱϱ^'ƌĂĚǇtĂǇ͕ZĞŶƚŽŶ͕tϵϴϬϱϳ͕ŝƐƚŚĞƉƌŝŵĂƌǇůŽĐĂƚŝŽŶŽĨƚŚĞŝƚǇ͛Ɛ ĂĚŵŝŶŝƐƚƌĂƚŝǀĞŽĨĨŝĐĞƐŝŶĐůƵĚŝŶŐƚŚĞDĂǇŽƌ͛ƐKĨĨŝĐĞ͕WŽůŝĐĞĞƉĂƌƚŵĞŶƚ,ĞĂĚƋƵĂƌƚĞƌƐ͕DƵŶŝĐŝƉĂůŽƵƌƚƌŽŽŵƐĂŶĚ ƵŝůĚŝŶŐWĞƌŵŝƚĞƉĂƌƚŵĞŶƚ͘dŚĞZĞŶƚŽŶŝƚǇ,ĂůůŝƐĂƐĞǀĞŶͲƐƚŽƌǇďƵŝůĚŝŶŐǁŝƚŚƚǁŽůĞǀĞůƐŽĨĞŶĐůŽƐĞĚŐĂƌĂŐĞ ďĞůŽǁƚŚĞϭƐƚĨůŽŽƌ͘dŚĞůŽǁĞƐƚůĞǀĞůŽĨƉĂƌŬŝŶŐ;>ĞǀĞůWϭͿŝƐŽŶͲŐƌĂĚĞĂƚƚŚĞŶŽƌƚŚĞŶĚŽĨƚŚĞďƵŝůĚŝŶŐĂŶĚŝƐ ďĞůŽǁͲŐƌĂĚĞĂƚƚŚĞƐŽƵƚŚĞŶĚ͘dŚĞϭƐƚĨůŽŽƌŝƐŽŶͲŐƌĂĚĞĂƚƚŚĞƐŽƵƚŚĞŶĚŽĨƚŚĞďƵŝůĚŝŶŐĂŶĚƚǁŽĨůŽŽƌƐĂďŽǀĞ ƚŚĞƐƚƌĞĞƚůĞǀĞůĂƚƚŚĞŶŽƌƚŚĞŶĚ͘KƉĞŶƉĂƌŬŝŶŐƐƵƌƌŽƵŶĚƐƚŚĞďƵŝůĚŝŶŐƚŽƚŚĞǁĞƐƚĂŶĚƐŽƵƚŚŽĨƚŚĞďƵŝůĚŝŶŐ͘dŚĞ ŽƉĞŶƉĂƌŬŝŶŐůŽƚŝƐĂƉƉƌŽǆŝŵĂƚĞůǇϱϰ͕ϭϬϬƐƋƵĂƌĞĨĞĞƚĂŶĚƚŚĞĞŶĐůŽƐĞĚŐĂƌĂŐĞ;>ĞǀĞůƐWϭΘWϮͿĂƌĞ ĂƉƉƌŽǆŝŵĂƚĞůǇϭϯϳ͕ϱϲϬƐƋƵĂƌĞĨĞĞƚĨŽƌĂƚŽƚĂůŽĨϱϯϭƉĂƌŬŝŶŐƐƚĂůůƐ͘dŚĞŐƌŽƐƐĐŽŶĚŝƚŝŽŶĞĚĂƌĞĂŽĨƚŚĞŽĨĨŝĐĞ ;>ĞǀĞůƐϭƚŚƌŽƵŐŚϳͿŝƐϭϮϮ͕ϴϯϴƐƋƵĂƌĞĨĞĞƚ͘hƐĞďǇůĞǀĞůƐĂƌĞĂƐĨŽůůŽǁƐ͗ •WĂƌŬŝŶŐ>ĞǀĞůWϭ͗^ĞĐƵƌĞĚŵƉůŽǇĞĞWĂƌŬŝŶŐ •WĂƌŬŝŶŐ>ĞǀĞůWϮ͗^ĞĐƵƌĞĚŵƉůŽǇĞĞWĂƌŬŝŶŐĂŶĚtŽŵĞŶ͛Ɛ^ŚĞůƚĞƌ •>ĞǀĞůϭ͗DĂŝŶ>ŽďďǇ͕sŝƐŝƚŽƌWĂƌŬŝŶŐ>ĞǀĞů͕&ŝŶĂŶĐĞĞƉĂƌƚŵĞŶƚ͕/ŶĨŽƌŵĂƚŝŽŶdĞĐŚŶŽůŽŐǇ͕WŽůŝĐĞ ĞƉĂƌƚŵĞŶƚĂŶĚ,ƵŵĂŶZĞƐŽƵƌĐĞƐ •>ĞǀĞůϮ͗WŽůŝĐĞĞƉĂƌƚŵĞŶƚĂŶĚŽŵĞƐƚŝĐsŝŽůĞŶĐĞĚǀŽĐĂƚĞ •>ĞǀĞůϯ͗DƵŶŝĐŝƉĂůŽƵƌƚ͕WĂƐƐƉŽƌƚƐ͕ŽŵƉƵƚĞƌdƌĂŝŶŝŶŐZŽŽŵĂŶĚŝƚǇ^ĐĞŶĞĂĨĠ •>ĞǀĞůϰ͗ŵĞƌŐĞŶĐǇDĂŶĂŐĞŵĞŶƚĂŶĚsĂĐĂŶƚdĞŶĂŶƚ^ƉĂĐĞ •>ĞǀĞůϱ͗WƵďůŝĐtŽƌŬƐĂŶĚ&ŝŶĂŶĐĞĞƉĂƌƚŵĞŶƚ •>ĞǀĞůϲ͗ŽŵŵƵŶŝƚǇĂŶĚĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚ;ŝŶĐůƵĚŝŶŐƵŝůĚŝŶŐWĞƌŵŝƚƐĂŶĚ/ŶƐƉĞĐƚŝŽŶƐͿĂŶĚ ŽŵŵƵŶŝƚǇ^ĞƌǀŝĐĞƐ •>ĞǀĞůϳ͗DĂǇŽƌ͛ƐKĨĨŝĐĞ͕ŽƵŶĐŝůŵĞŵďĞƌKĨĨŝĐĞƐ͕ŝƚǇŽƵŶĐŝůŚĂŵďĞƌƐ͕ŝƚǇůĞƌŬ͕ŽŵŵƵŶŝĐĂƚŝŽŶƐ͕ ŽŶĨĞƌĞŶĐĞĞŶƚĞƌƐĂŶĚ&ŝƌĞĂŶĚŵĞƌŐĞŶĐǇ^ĞƌǀŝĐĞƐ dŚĞďƵŝůĚŝŶŐǁĂƐŽƌŝŐŝŶĂůůǇďƵŝůƚŝŶϭϵϴϳĂŶĚƚŚĞŶƉƵƌĐŚĂƐĞĚĂŶĚƌĞŵŽĚĞůĞĚďǇƚŚĞŝƚǇŝŶϭϵϵϳ͘dŚĞďƵŝůĚŝŶŐ ǁĂƐďƵŝůƚƚŽĐŽŵƉůǇǁŝƚŚƚŚĞϭϵϴϮhŶŝĨŽƌŵƵŝůĚŝŶŐŽĚĞĂŶĚǁĂƐĐůĂƐƐŝĨŝĞĚĂƐĂͲϮKĨĨŝĐĞǁŝƚŚͲϯWĂƌŬŝŶŐ 'ĂƌĂŐĞ͘ŽŶƐƚƌƵĐƚŝŽŶǁĂƐĐůĂƐƐŝĨŝĞĚĂƐdǇƉĞ/&͘Z͘^ƉƌŝŶŬůĞƌĞĚ;,ŝŐŚZŝƐĞͿĂŶĚƚŚĞǌŽŶŝŶŐǁĂƐͲϭZĞŶƚŽŶ͘sĂƌŝŽƵƐ ƌĞŵŽĚĞůŝŶŐĂŶĚƚĞŶĂŶƚŝŵƉƌŽǀĞŵĞŶƚƐŚĂǀĞďĞĞŶĐŽŶĚƵĐƚĞĚďǇƚŚĞŝƚǇƐŝŶĐĞĨŝƌƐƚŽĐĐƵƉǇŝŶŐƚŚĞďƵŝůĚŝŶŐ͕ ŝŶĐůƵĚŝŶŐ͗ •ϮϬϬϴ͗ƌĞŶŽǀĂƚŝŽŶŽĨƚŚĞϮŶĚĨůŽŽƌWŽůŝĐĞĞƉĂƌƚŵĞŶƚ͕ĂƌĞŵŽĚĞůŽĨƚŚĞϭƐƚĨůŽŽƌ,ZĞƉĂƌƚŵĞŶƚĂŶĚ ϯƌĚĨůŽŽƌĐŽƵƌƚ͕ĨŝƚŶĞƐƐƌŽŽŵĂŶĚŽĨĨŝĐĞƌĞŵŽĚĞůƐ •ϮϬϭϮ͗ƚĞŶĂŶƚŝŵƉƌŽǀĞŵĞŶƚĨŽƌƚŚĞϳƚŚĨůŽŽƌŽŵŵƵŶŝƚǇKĨĨŝĐĞ •ϮϬϭϯ͗ĐŽŶǀĞƌƐŝŽŶŽĨƚŚĞWϮ>ĞǀĞů:ĂŝůŝŶƚŽĂtŽŵĞŶ͛Ɛ^ŚĞůƚĞƌĂŶĚĂƌĞŵŽĚĞůŽĨƚŚĞϲƚŚĨůŽŽƌ ĚŵŝŶŝƐƚƌĂƚŽƌKĨĨŝĐĞ •ϮϬϭϱ͗ƌĞƉůĂĐĞŵĞŶƚŽĨƚŚĞĞŶƚƌĂŶĐĞĚŽŽƌƐ •ϮϬϭϲ͗ƚĞŶĂŶƚŝŵƉƌŽǀĞŵĞŶƚĂŶĚŵŽǀŝŶŐŽĨƚŚĞŵĞƌŐĞŶĐǇDĂŶĂŐĞŵĞŶƚĞƉĂƌƚŵĞŶƚƚŽƚŚĞϰƚŚĨůŽŽƌ ĂŶĚĂƌĞŵŽĚĞůŽĨƚŚĞϲƚŚĨůŽŽƌWĞƌŵŝƚĞŶƚĞƌ Page 63 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ 'ĞŶĞƌĂů^ƉĂĐĞdǇƉĞƐ *(20(75<$1'(19(/23( dŚĞŝƚǇ,ĂůůŝƐƌĞĐƚĂŶŐƵůĂƌǁŝƚŚƚǁŽŽƉƉŽƐŝŶŐƚƌĂƉĞǌŽŝĚĂůĐŽƌŶĞƌƐ;ƐĞĞƚŚĞĞYh^d'ĞŽŵĞƚƌǇDŽĚĞů ƐĐƌĞĞŶƐŚŽƚƐďĞůŽǁͿ͘dŚĞŝƚǇ,ĂůůŝƐŽƌŝĞŶƚĞĚŶŽƌƚŚƚŽƐŽƵƚŚ͕ĂůŽŶŐƚŚĞůŽŶŐĂǆŝƐŽĨƚŚĞďƵŝůĚŝŶŐ͘ dŚĞĞǆƚĞƌŝŽƌǁĂůůƐĂƌĞƚŝůĞŽƌĐƵƌƚĂŝŶǁĂůůƌĞĨůĞĐƚŝǀĞŐůĂƐƐƐƉĂŶĚƌĞůƉĂŶĞůƐǁŝƚŚZͲϭϭďĂƚƚŝŶƐƵůĂƚŝŽŶĂŶĚƉĂŝŶƚĞĚ ŝŶƚĞƌŝŽƌϱͬϴ͟ŐǇƉƐƵŵǁĂůůďŽĂƌĚ͘ǆƚĞƌŝŽƌĐŽůƵŵŶƐĂƌĞĐŽŶĐƌĞƚĞǁŝƚŚƚŝůĞĐůĂĚĚŝŶŐ͘hŶĚĞƌŐƌŽƵŶĚĞǆƚĞƌŝŽƌǁĂůůƐŝŶ ƚŚĞƉĂƌŬŝŶŐŐĂƌĂŐĞĂƌĞƵŶŝŶƐƵůĂƚĞĚĐŽŶĐƌĞƚĞǁĂůůƐ͘ǆƚĞƌŝŽƌŐůĂǌŝŶŐŝƐĚŽƵďůĞͲƉĂŶĞĂŶĚŝƐĐŽŵƉƌŝƐĞĚŽĨĐƵƌƚĂŝŶ ǁĂůůƌĞĨůĞĐƚŝǀĞǀŝƐŝŽŶŐůĂƐƐǁŝƚŚĂĚĂƌŬƚŝŶƚ͘dŚĞĞǆƚĞƌŝŽƌĚŽŽƌƐĂƌĞĚŽƵďůĞͲƉĂŶĞŐůĂƐƐĚŽŽƌƐǁŝƚŚŵĞƚĂůĨƌĂŵĞƐ͘ dŚĞϳƚŚĨůŽŽƌƌŽŽĨŝƐĐŽŶĐƌĞƚĞǁŝƚŚZͲϭϵƌŝŐŝĚŝŶƐƵůĂƚŝŽŶĂŶĚƐŝŶŐůĞͲŵĞŵďƌĂŶĞƌŽŽĨŝŶŐ͘dŚĞŝƚǇ,ĂůůƌŽŽĨŚĂƐĂŶ ĞƐƚŝŵĂƚĞĚƌĞŵĂŝŶŝŶŐůŝĨĞŽĨϱǇĞĂƌƐ͘ /ŶƚĞƌŝŽƌĐĞŝůŝŶŐƐĂƌĞƉƌŝŵĂƌŝůǇdͲďĂƌƐƵƐƉĞŶĚĞĚĐĞŝůŝŶŐƐ͘ZĞƐƚƌŽŽŵƐĂŶĚŝŶƚĞƌŝŽƌĐŽƌƌŝĚŽƌƐŚĂǀĞŚĂƌĚͲůŝĚŐǇƉƐƵŵ ǁĂůůďŽĂƌĚĐĞŝůŝŶŐƐ͘/ŶƚĞƌŝŽƌǁĂůůƐĂƌĞŵĞƚĂůͲĨƌĂŵĞĚŐǇƉƐƵŵǁĂůůďŽĂƌĚ͘ dŚĞŝƚǇ,ĂůůĨůŽŽƌƐĂƌĞĐŽŶĐƌĞƚĞǁŝƚŚĐĂƌƉĞƚ͘dŚĞ>ĞǀĞůϭĨůŽŽƌŚĂƐZͲϭϬƐƉƌĂǇŽŶŝŶƐƵůĂƚŝŽŶŽŶƚŚĞƉĂƌŬŝŶŐŐĂƌĂŐĞ ƵŶĚĞƌƐŝĚĞ͘>ĞǀĞůϭ͛ƐĨůŽŽƌͲƚŽͲĨůŽŽƌŚĞŝŐŚƚŝƐϭϯĨĞĞƚ͕ϲŝŶĐŚĞƐ͘dŚĞŚĞŝŐŚƚŽĨ>ĞǀĞůƐϮƚŚƌŽƵŐŚϲĂƌĞϭϮĨĞĞƚĨůŽŽƌͲ ƚŽͲĨůŽŽƌ͘dŚĞϭϯƌĚĨůŽŽƌŚĞŝŐŚƚŝƐϭϯĨĞĞƚ͕ϲŝŶĐŚĞƐĨƌŽŵĨůŽŽƌƚŽƌŽŽĨĚĞĐŬ͘ 6SDFH)XQFWLRQ7\SH *URVV)ORRU $UHD :HHNO\ 2SHUDWLQJ +RXUV :HHNV <HDU 2FFXSDQWV 3&V 3ULQFLSDO /LJKWLQJ7\SH 3ULQFLSDO+9$& 7\SH RI 6SDFHV +HDWHG RI 6SDFHV &RROHG 3 3DUNLQJ /('/LQHDU ([KDXVW)DQV +\GURQLF+HDW 3XPSV 3 3DUNLQJ /('/LQHDU ([KDXVW)DQV 3 5HVLGHQFH+DOO 7)OXRUHVFHQW +\GURQLF+HDW 3XPSV 2IILFH 7)OXRUHVFHQW +\GURQLF+HDW 3XPSV 'DWD&HQWHU 7)OXRUHVFHQW +\GURQLF+HDW 3XPSV 2IILFH 7)OXRUHVFHQW +\GURQLF+HDW 3XPSV &RXUWKRXVH 7)OXRUHVFHQW 9$97HUPLQDOV 2IILFH 7)OXRUHVFHQW 9$97HUPLQDOV 2IILFH 7)OXRUHVFHQW 9$97HUPLQDOV 2IILFH 7)OXRUHVFHQW 9$97HUPLQDOV 2IILFH 7)OXRUHVFHQW 9$97HUPLQDOV 7RWDO Page 64 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ĞYh^d'ĞŽŵĞƚƌǇDŽĚĞůŽĨZĞŶƚŽŶŝƚǇ,Ăůů;>ŽŽŬŝŶŐĂƚtĞƐƚ&ĂĕĂĚĞͿĂŶĚƚŚĞŶĐůŽƐĞĚWĂƌŬŝŶŐ'ĂƌĂŐĞ ĞYh^d'ĞŽŵĞƚƌǇDŽĚĞůŽĨZĞŶƚŽŶŝƚǇ,Ăůů;>ŽŽŬŝŶŐĂƚĂƐƚ&ĂĕĂĚĞͿĂŶĚƚŚĞŶĐůŽƐĞĚWĂƌŬŝŶŐ'ĂƌĂŐĞ 6&+('8/(6 dŚĞŝƚǇ,ĂůůŝƐŽƉĞŶƚŽƚŚĞƉƵďůŝĐĨƌŽŵϴĂ͘ŵ͘ƚŽϱƉ͘ŵ͕͘DŽŶĚĂǇƚŚƌŽƵŐŚ&ƌŝĚĂǇ͘dŚĞŝƚǇŽƵŶĐŝůŵĞĞƚƐŝŶƚŚĞ ŽƵŶĐŝůŚĂŵďĞƌƐ͕ƚŚĞĨŽƵƌƚŚDŽŶĚĂǇŽĨƚŚĞŵŽŶƚŚĂƚϳƉ͘ŵ͘dŚĞWŽůŝĐĞĞƉĂƌƚŵĞŶƚ͕ůŽĐĂƚĞĚŽŶƚŚĞϭƐƚĂŶĚϮŶĚ ĨůŽŽƌƐ͕ŽƉĞƌĂƚĞƐϮϰŚŽƵƌƐĂĚĂǇ͘ /,*+7,1* /ŶƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐƉƌĞƐĞŶƚůǇĂŵŝǆŽĨĨůƵŽƌĞƐĐĞŶƚůĂŵƉƐ͘DŽƐƚŽĨĨŝĐĞůŝŐŚƚŝŶŐŝƐƉƌŽǀŝĚĞĚďǇϯϮͲǁĂƚƚdͲϴůĂŵƉƐ ǁŝƚŚĞůĞĐƚƌŽŶŝĐďĂůůĂƐƚƐŝŶϮ͛ǆϰ͛ĨŝǆƚƵƌĞƐ͘dŚĞϳƚŚĨůŽŽƌĐŽŶĨĞƌĞŶĐĞƌŽŽŵƐŚĂǀĞϭϳͲǁĂƚƚdͲϴůĂŵƉƐǁŝƚŚĞůĞĐƚƌŽŶŝĐ ďĂůůĂƐƚƐŝŶϮ͛ǆϮ͛ĨŝǆƚƵƌĞƐ͘&ŝǆƚƵƌĞƐŝŶĂŶůĞĐƚƌŝĐĂůZŽŽŵ͕ZĞƐƚZŽŽŵƐĂŶĚůŝŵŝƚĞĚϮŶĚĂŶĚϱƚŚĨůŽŽƌŽĨĨŝĐĞƐƐƚŝůů ŚĂǀĞϰϬͲǁĂƚƚdͲϭϮůĂŵƉƐǁŝƚŚŵĂŐŶĞƚŝĐďĂůůĂƐƚƐ͘,ĂůůǁĂǇƐ͕ůĞǀĂƚŽƌ>ŽďďŝĞƐ͕ZĞƐƚZŽŽŵƐ͕ŽŶĨĞƌĞŶĐĞZŽŽŵĂŶĚ ŽƚŚĞƌĐŽŵŵŽŶĂƌĞĂƐŚĂǀĞĂŵŝǆŽĨϭϴƚŽϰϮͲǁĂƚƚĐŽŵƉĂĐƚĨůƵŽƌĞƐĐĞŶƚůĂŵƉƐǁŝƚŚŵŽƐƚůǇϰͲƉŝŶƐŽĐŬĞƚƐ͘;ϯϰͿ Ϯ͛ǆϮ͛ĨŝǆƚƵƌĞƐŚĂǀĞϯϮͲǁĂƚƚĨůƵŽƌĞƐĐĞŶƚdͲϴůĂŵƉƐǁŝƚŚĞůĞĐƚƌŽŶŝĐďĂůůĂƐƚƐ͘ǆŝƚƐŝŐŶƐĂƌĞŝŶĐĂŶĚĞƐĐĞŶƚdͲůĂŵƉƐ͘ ĨĞǁϳƚŚĨůŽŽƌƐƉĂĐĞƐŚĂǀĞŝŶĐĂŶĚĞƐĐĞŶƚƉĂƌĂďŽůŝĐĂůƵŵŝŶŝǌĞĚƌĞĨůĞĐƚŽƌ;WZͿůĂŵƉƐ͘ϭϱϵĨŝǆƚƵƌĞƐŚĂǀĞĂůƌĞĂĚǇ Page 65 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ďĞĞŶĐŽŶǀĞƌƚĞĚƚŽ>ĂŶĚĚŽŶŽƚƌĞƋƵŝƌĞĐŽŶǀĞƌƐŝŽŶ͘ǆƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐĂŵŝǆŽĨϳϬƚŽϭϳϱͲǁĂƚƚŚŝŐŚŝŶƚĞŶƐŝƚǇ ĚŝƐĐŚĂƌŐĞ;,/ͿŵĂŐŶĞƚŝĐďĂůůĂƐƚůĂŵƉƐ͘^ĞĞƚŚĞĚĞƚĂŝůĞĚůŝŐŚƚŝŶŐĂƵĚŝƚĨŽƌĨŝǆƚƵƌĞĐŽƵŶƚƐĂŶĚĚĞƚĂŝůƐ͘ '20(67,&+27:$7(5 dŚĞŵĂũŽƌŝƚǇŽĨƚŚĞŝƚǇ,Ăůů͛ƐĚŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌŝƐŚĞĂƚĞĚďǇƚŚĞŵĂŝŶďƵŝůĚŝŶŐďŽŝůĞƌƐ͕ůŽĐĂƚĞĚŝŶƚŚĞWϮ DĞĐŚĂŶŝĐĂůZŽŽŵ͕ƚŚƌŽƵŐŚŚĞĂƚĞǆĐŚĂŶŐĞƌ,yͲϭ;ŝŶƐƚĂůůĞĚŝŶϭϵϵϴͿ͘,yͲϭƐĞƌǀĞƐƚǁŽƐƚŽƌĂŐĞƚĂŶŬƐ;^dͲϭĂŶĚ^dͲ Ϯ͕ϯϳϱŐĂůůŽŶƐĞĂĐŚͿ͘ŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌŝƐĐŝƌĐƵůĂƚĞĚďǇĐŝƌĐƵůĂƚŝŽŶƉƵŵƉ͕WͲϱ͘ŝƌĐƵůĂƚŝŽŶƉƵŵƉ͕WͲϰƉƌŽǀŝĚĞƐ ĐŝƌĐƵůĂƚŝŽŶďĞƚǁĞĞŶƚŚĞďŽŝůĞƌƐĂŶĚ,yͲϭ͘^ŵĂůůĞƌĚŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌŚĞĂƚĞƌƐƐĞƌǀĞƐŝŶŬƐůŽĐĂƚĞĚŝŶƚŚĞWƌŝŶƚ ĂŶĚDĂŝů^ĞƌǀŝĐĞZŽŽŵ͕ƚŚĞϯƌĚĨůŽŽƌŵƉůŽǇĞĞ>ŽƵŶŐĞĂŶĚƚŚĞϳƚŚĨůŽŽƌƌĞĂŬZŽŽŵ͘ϭϮϬͲŐĂůůŽŶŚĞĂƚĞƌŝƐĂůƐŽ ůŽĐĂƚĞĚŝŶƚŚĞWĞŶƚŚŽƵƐĞ͘ )LJXUH+; +9$&$1'&21752/6 ŽŝůĞƌƐ ,ĞĂƚŝŶŐŚŽƚǁĂƚĞƌĨŽƌƚŚĞŝƚǇ,ĂůůŝƐƉƌŽǀŝĚĞĚďǇƚŚƌĞĞ;ϯͿ>ŽĐŚŝŶǀĂƌ,EϬϱϬϬƐĞƌŝĞƐďŽŝůĞƌƐ͕ŝŶƐƚĂůůĞĚŝŶϭϵϵϲ͘ dŚĞǁĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉĐŽŶĚĞŶƐĞƌǁĂƚĞƌůŽŽƉŝƐŚĞĂƚĞĚƚŚƌŽƵŐŚŚĞĂƚĞǆĐŚĂŶŐĞƌ,yͲϮ;ƌĞƉůĂĐĞĚŝŶϮϬϭϱͿ͘ ŝƌĐƵůĂƚŝŽŶƉƵŵƉ͕WͲϯƉƌŽǀŝĚĞƐĐŝƌĐƵůĂƚŝŽŶďĞƚǁĞĞŶƚŚĞďŽŝůĞƌƐĂŶĚ,yͲϮ͘dŚĞďŽŝůĞƌƐĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌ ƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘ Page 66 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ )LJXUH%RLOHU3ODQW&RQWURO6FUHHQ )LJXUH7\SLFDO%RLOHU ŽŽůŝŶŐdŽǁĞƌ ĐůŽƐĞĚͲĐŝƌĐƵŝƚĐŽŽůŝŶŐƚŽǁĞƌ͕ĨůƵŝĚĐŽŽůĞƌ;dͲϭ͕ǀĂƉĐŽDŽĚĞůη>^tϰϭ͕ŝŶƐƚĂůůĞĚϭϵϴϳĂŶĚƌĞĨƵƌďŝƐŚĞĚŝŶ ϮϬϭϵͿƉƌŽǀŝĚĞƐŚĞĂƚƌĞũĞĐƚŝŽŶĨŽƌƚŚĞǁĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉĐŽŶĚĞŶƐĞƌǁĂƚĞƌůŽŽƉ͕ůŽĐĂƚĞĚŽŶƚŚĞƌŽŽĨŽĨƚŚĞ ŝƚǇ,Ăůů͘dͲϭŚĂƐĂŵĂŝŶĨĂŶŵŽƚŽƌ;ϮϬŚƉͿǁŝƚŚĂs&͘>ĞĂĚͬůĂŐĐŝƌĐƵůĂƚŝŽŶƉƵŵƉƐWͲϭĂŶĚWͲϮĐŝƌĐƵůĂƚĞƚŚĞ ĐŽŶĚĞŶƐĞƌǁĂƚĞƌƚŽƚŚĞǁĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉƐƐĞƌǀŝŶŐƚŚĞϭƐƚĂŶĚϮŶĚĨůŽŽƌƐĂŶĚ/dĞƋƵŝƉŵĞŶƚĐůŽƐĞƚƐůŽĐĂƚĞĚ ŽŶĞĂĐŚĨůŽŽƌ͘dŚĞĨůƵŝĚĐŽŽůĞƌĐŝƌĐƵůĂƚŝŽŶƉƵŵƉŝƐϭͲϭͬϮŚƉ͘dͲϭĂůƐŽŚĂƐĂϯͲŬtƉĂŶŚĞĂƚĞƌĨŽƌĨƌĞĞǌĞ ƉƌŽƚĞĐƚŝŽŶ͕ƐŝŶĐĞŝƚŽƉĞƌĂƚĞƐǇĞĂƌͲƌŽƵŶĚ͘ Page 67 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ŝƌ,ĂŶĚůĞƌƐ dŚĞĞǆŝƐƚŝŶŐƉĞŶƚŚŽƵƐĞƵŶŝƚ͕W,Ͳϭ͕ƉƌŽǀŝĚĞƐǀĞŶƚŝůĂƚŝŽŶƚŽƚŚĞϭƐƚĂŶĚϮŶĚĨůŽŽƌŚĞĂƚƉƵŵƉƐĂŶĚƉƌŽǀŝĚĞƐ ƉƌŝŵĂƌǇĂŝƌƚŽƚŚĞǀĂƌŝĂďůĞĂŝƌǀŽůƵŵĞ;ssͿƚĞƌŵŝŶĂůƐƚŚƌŽƵŐŚŽƵƚƚŚĞŝƚǇ,Ăůů͘W,ͲϭǁĂƐƌĞƉůĂĐĞĚŝŶϮϬϭϵĂŶĚ ŚĞĂƚƌĞĐŽǀĞƌǇǁĂƐĂĚĚĞĚƚŽƚŚĞƵŶŝƚ͘ŽŽůŝŶŐŝƐƉƌŽǀŝĚĞĚďǇŝŶƚĞŐƌĂůǁĂƚĞƌͲĐŽŽůĞĚĐŽŵƉƌĞƐƐŽƌƐ ƐŵĂůůĞƌŵĂŬĞͲƵƉƵŶŝƚ͕,hͲϭ͕ůŽĐĂƚĞĚŽŶƚŚĞƌŽŽĨ͕ƐĞƌǀŝŶŐƚŚĞϮŶĚĨůŽŽƌůŽĐŬĞƌƌŽŽŵƐǁĂƐĂůƐŽƌĞƉůĂĐĞĚŝŶ ϮϬϭϵ͘ dǁŽƐŵĂůůWĂĐĞĂŝƌŚĂŶĚůĞƌƐ͕,hͲϭĂŶĚ,hͲϮ͕ůŽĐĂƚĞĚŝŶƚŚĞWϮWĂƌŬŝŶŐ'ĂƌĂŐĞ>ĞǀĞů͕ƐĞƌǀĞƚŚĞtŽŵĞŶ͛Ɛ ^ŚĞůƚĞƌ͘ tĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉƐ;t^,W͛ƐͿ͕ŝŶƐƚĂůůĞĚŝŶϭϵϵϳ͕ƐĞƌǀĞƚŚĞϭƐƚĨůŽŽƌĂŶĚƚŚĞƐŽƵƚŚŚĂůĨŽĨƚŚĞϮŶĚĨůŽŽƌ͘ t^,W͛ƐĂůƐŽƐĞƌǀĞ/dĐůŽƐĞƚƐŽŶĞĂĐŚĨůŽŽƌĂƐǁĞůůĂƐƚŚĞƐŵĂůůĚĂƚĂĐĞŶƚĞƌůŽĐĂƚĞĚŽŶƚŚĞϭƐƚĨůŽŽƌ;ĐƵƌƌĞŶƚůǇǁŝƚŚ ĂďŽƵƚĂŶϭϴŬs/důŽĂĚͿ͘dŚĞt^,WΖƐĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘ ŝƌͲ,ĂŶĚůŝŶŐ^ǇƐƚĞŵŽŶƚƌŽůƐ dŚĞďƵŝůĚŝŶŐĂƵƚŽŵĂƚŝŽŶƐǇƐƚĞŵ;^ͿŝƐĂĚŝƌĞĐƚĚŝŐŝƚĂůĐŽŶƚƌŽů;ͿƐǇƐƚĞŵƉƌŽǀŝĚĞĚďǇůĞƌƚŽŶŽŶƚƌŽůƐ͘dŚĞ ĨƌŽŶƚĞŶĚĂŶĚŵĂŝŶĂŝƌŚĂŶĚůĞƌĐŽŶƚƌŽůƐǁĞƌĞƌĞƉůĂĐĞĚŝŶϮϬϭϵ͕ǁŚŝůĞƚŚĞƚĞƌŵŝŶĂůƵŶŝƚƐĂƌĞƐƚŝůů/yĐŽŶƚƌŽůƐ͘ dŚĞƚĞƌŵŝŶĂůƵŶŝƚĐŽŶƚƌŽůƐǇƐƚĞŵŝƐƉĂƐƚŝƚƐƐĞƌǀŝĐĞůŝĨĞĂŶĚǁŝůůƌĞƋƵŝƌĞƌĞƉůĂĐĞŵĞŶƚĂƐƐƵƉƉŽƌƚǁŝůůďĞĞŶĚŝŶŐ͘ WĂƌƚƐĨŽƌƚŚŝƐĐŽŶƚƌŽůƐǇƐƚĞŵĂƌĞŶŽǁŽŶůǇĂǀĂŝůĂďůĞŝŶƚŚĞƵƐĞĚŵĂƌŬĞƚĂŶĚĂƌĞǀĞƌǇĞǆƉĞŶƐŝǀĞƚŽƌĞƉĂŝƌ͘ ŝƌ^ǇƐƚĞŵdĞƌŵŝŶĂůhŶŝƚƐ DŽƐƚŽĨƚŚĞƚĞƌŵŝŶĂůƵŶŝƚƐƐĞƌǀŝŶŐƚŚĞŝƚǇ,ĂůůĂƌĞǀĂƌŝĂďůĞĂŝƌǀŽůƵŵĞ;ssͿƵŶŝƚƐǁŝƚŚĞůĞĐƚƌŝĐƌĞŚĞĂƚĨŽƌƚŚĞ ƉĞƌŝŵĞƚĞƌǌŽŶĞƐ͘/ŶƚĞƌŶĂůǌŽŶĞƐĂƌĞƐĞƌǀĞĚďǇss͛ƐǁŝƚŚŶŽƌĞŚĞĂƚ͘dŚĞss͛ƐǁĞƌĞŝŶƐƚĂůůĞĚŝŶϭϵϴϳĂŶĚϭϵϵϳ͘ ǆŚĂƵƐƚ&ĂŶƐ dŚƌĞĞĞǆŚĂƵƐƚĨĂŶƐ͕ŝŶƐƚĂůůĞĚŝŶϭϵϴϳĂŶĚϭϵϵϳĂŶĚůŽĐĂƚĞĚŽŶƚŚĞƌŽŽĨ͕ƐĞƌǀĞƚŚĞƌĞƐƚƌŽŽŵƐůŽĐĂƚĞĚŝŶƚŚĞ ďƵŝůĚŝŶŐĐŽƌĞĂƐǁĞůůĂƐƚŚĞϮŶĚĨůŽŽƌ>ŽĐŬĞƌZŽŽŵĂŶĚ&ŝƚŶĞƐƐĞŶƚĞƌ͘DƵůƚŝƉůĞĞǆŚĂƵƐƚĨĂŶƐ͕ůŽĐĂƚĞĚĂƚƚŚĞϮŶĚ &ůŽŽƌ'ĂƌĂŐĞ͕ƐĞƌǀĞǀĂƌŝŽƵƐƐŵĂůůĂƌĞĂƐĂŶĚƚŚĞtŽŵĞŶ͛Ɛ^ŚĞůƚĞƌ͘dŚĞĞŶĐůŽƐĞĚ'ĂƌĂŐĞŝƐĂůƐŽǀĞŶƚŝůĂƚĞĚďǇƚǁŽ ůĂƌŐĞƉƌŽƉĞůůĞƌƚǇƉĞĞǆŚĂƵƐƚĨĂŶƐ͘ ^W/>dzEW>h'>K^ ŽŶǀĞǇĂŶĐĞĨŽƌƚŚĞŝƚǇ,ĂůůŝƐƉƌŽǀŝĚĞĚďǇĨŽƵƌĞůĞǀĂƚŽƌƐ;ƐĞƌǀŝŶŐ>ĞǀĞůƐWϭƚŽϳͿ͘dŚĞĞůĞǀĂƚŽƌƐĂƌĞƉƌĞƐĞŶƚůǇ ďĞŝŶŐƵƉŐƌĂĚĞĚ;ďĞƚǁĞĞŶϮϬϭϵĂŶĚϮϬϮϬͿ͘WůƵŐůŽĂĚƐĂƌĞƚǇƉŝĐĂůĨŽƌŽĨĨŝĐĞƐƉĂĐĞ͕ŝŶĐůƵĚŝŶŐĐŽŵƉƵƚĞƌƐ͕ĚĞƐŬ ůĂŵƉƐ͕ĐŽƉŝĞƌƐ͕ƌĞĨƌŝŐĞƌĂƚŽƌƐĂŶĚĐŽĨĨĞĞƉŽƚƐ͘dŚĞƌĞŝƐĂƐŵĂůůĚĂƚĂĐĞŶƚĞƌ͕ůŽĐĂƚĞĚŽŶƚŚĞϭƐƚ>ĞǀĞů͘ Page 68 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ZEdKEKDDhE/dzEdZ *(1(5$/,1)250$7,21 dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌ͕ůŽĐĂƚĞĚĂƚϭϳϭϱDĂƉůĞsĂůůĞǇ,ǁǇ͕ZĞŶƚŽŶ͕tϵϴϬϱϳ͕ŝƐĂŽŵŵƵŶŝƚǇĞŶƚĞƌ ǁŝƚŚǀĂƌŝŽƵƐƐĞƌǀŝĐĞƐĂŶĚĨĂĐŝůŝƚŝĞƐƚŚĂƚŝŶĐůƵĚĞĂĂŶƋƵĞƚZŽŽŵ͕ƚǁŽĨƵůůƐŝǌĞďĂƐŬĞƚďĂůůĐŽƵƌƚƐ͕ĂĨĞǁƐŵĂůů ĐůĂƐƐƌŽŽŵƐ͕ĂĨŝƚŶĞƐƐĂŶĚǁŽƌŬŽƵƚƌŽŽŵ͕ƌĂĐƋƵĞƚďĂůůĐŽƵƌƚƐ͕ĂƐŵĂůůĚĂŶĐĞƐƚƵĚŝŽĂŶĚƐŚŽǁĞƌĂŶĚůŽĐŬĞƌ ĨĂĐŝůŝƚŝĞƐ͘/ƚŝƐĂϯϳ͕ϴϬϭƐƋƵĂƌĞĨŽŽƚ͕ƐŝŶŐůĞƐƚŽƌǇƐƚƌƵĐƚƵƌĞ͕ůŽĐĂƚĞĚŶĞǆƚƚŽƚŚĞĞĚĂƌZŝǀĞƌ͕ďƵŝůƚŝŶϭϵϴϴ͘KƉĞŶ ƐƵƌĨĂĐĞƉĂƌŬŝŶŐŝƐĂǀĂŝůĂďůĞƚŽƚŚĞǁĞƐƚĂŶĚĞĂƐƚƐŝĚĞƐŽĨƚŚĞďƵŝůĚŝŶŐĂŶĚŝƐƐŚĂƌĞĚǁŝƚŚƚŚĞĂĚũĂĐĞŶƚĂƌĐŽ dŚĞĂƚƌĞĂŶĚ,ĞŶƌǇDŽƐĞƐƋƵĂƚŝĐĞŶƚĞƌ͘ *(20(75<$1'(19(/23( dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐƉƌĞĚŽŵŝŶĂŶƚůǇƌĞĐƚĂŶŐƵůĂƌŝŶƐŚĂƉĞ͘^ĞĞƚŚĞĨůŽŽƌƉůĂŶďĞůŽǁ͘ dŚĞ'ǇŵŶĂƐŝƵŵĂŶĚZĂĐƋƵĞƚďĂůůŽƵƌƚƐĂƌĞĂƚƚŚĞŶŽƌƚŚĞŶĚŽĨƚŚĞďƵŝůĚŝŶŐĂŶĚƚŚĞĂŶƋƵĞƚZŽŽŵŝƐĂƚƚŚĞ ƐŽƵƚŚĞŶĚ͘ dŚĞĞǆƚĞƌŝŽƌǁĂůůƐĂƌĞƉƌŝŵĂƌŝůǇĐŽŶĐƌĞƚĞŵĂƐŽŶƌǇƵŶŝƚƐ;DhͿǁŝƚŚϯͲϰ͟ďŽĂƌĚŝŶƐƵůĂƚŝŽŶĂŶĚĂďƌŝĐŬǀĞŶĞĞƌ͘ ǆƚĞƌŝŽƌŐůĂǌŝŶŐŝƐĐůĞĂƌ͕ĚŽƵďůĞƉĂŶĞŝŶĂůƵŵŝŶƵŵĨƌĂŵĞƐ͘DĂŝŶĞŶƚƌǇĚŽŽƌƐĂƌĞĚŽƵďůĞƉĂŶĞƐƚŽƌĞĨƌŽŶƚ͘dŚĞ ĂŶƋƵĞƚZŽŽŵŚĂƐƌŽůůƵƉŐůĂƐƐďĂǇĚŽŽƌƐƚŚĂƚĂƌĞŽƉĞŶĞĚĨŽƌŽƵƚĚŽŽƌĞǀĞŶƚƐ͘dŚĞƌŽŽĨŝƐǁŽŽĚǁŝƚŚŐůƵĞͲůĂŵ ďĞĂŵƐĂŶĚǁŽŽĚĨƌĂŵŝŶŐ͘/ŶƐƵůĂƚŝŽŶŝƐĐŽŶƚŝŶƵŽƵƐŽŶƚŽƉŽĨƉůǇǁŽŽĚƐŚĞĂƚŚŝŶŐ͘ZŽŽĨŝŶŐŝƐďƵŝůƚͲƵƉŽƌƐƚĂŶĚŝŶŐ Page 69 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ƐĞĂůƐĞĂŵ͘ )LJXUH7\SLFDO5RRI&RQVWUXFWLRQ )LJXUH7\SLFDO6WDQGLQJ6HDP5RRI /ŶƚĞƌŝŽƌĐĞŝůŝŶŐƐĂƌĞƉƌŝŵĂƌŝůǇƚŽƐƚƌƵĐƚƵƌĞŝŶƚŚĞ'ǇŵŶĂƐŝƵŵ͕&ŝƚŶĞƐƐZŽŽŵ͕DĂŝŶŶƚƌĂŶĐĞĂŶĚ,ĂůůǁĂǇĂŶĚ ĂŶƋƵĞƚZŽŽŵ͘ůůŽƚŚĞƌĂƌĞĂƐĂƌĞŐǇƉƐƵŵǁĂůůďŽĂƌĚ;'tͿĐĞŝůŝŶŐƐ͘DĞĐŚĂŶŝĐĂůDĞǌǌĂŶŝŶĞƐĂƌĞůŽĐĂƚĞĚĂďŽǀĞ ƚŚĞDĂŝŶŽƌƌŝĚŽƌ͕>ŽĐŬĞƌZŽŽŵƐ͕<ŝƚĐŚĞŶĂŶĚůĂƐƐƌŽŽŵƐ͘dŚĞĨůŽŽƌƐĂƌĞĐĂƌƉĞƚĞĚŝŶƚŚĞDĂŝŶŽƌƌŝĚŽƌĂŶĚ ŚĂƌĚƐƵƌĨĂĐĞƐŝŶƚŚĞŽƚŚĞƌƌŽŽŵƐ͘ Page 70 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ )LJXUH*\PQDVLXP )LJXUH0DLQ+DOOZD\ 6&+('8/(6 dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐŶŽƌŵĂůůǇŽƉĞŶƚŽƚŚĞƉƵďůŝĐĨƌŽŵϲĂ͘ŵ͘ƚŽϴƉ͘ŵ͕͘DŽŶĚĂǇƚŚƌŽƵŐŚdŚƵƌƐĚĂǇ͕ ϲĂ͘ŵ͘ƚŽϭϭƉ͘ŵ͘ŽŶ&ƌŝĚĂǇĂŶĚϵĂ͘ŵ͘ƚŽϭϭƉ͘ŵŽŶ^ĂƚƵƌĚĂǇ͘dŚĞŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐŶŽƌŵĂůůǇĐůŽƐĞĚŽŶ ^ƵŶĚĂǇ͘ /,*+7,1* /ŶƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐƉƌĞĚŽŵŝŶĂŶƚůǇϯϮͲǁĂƚƚdͲϴĨůƵŽƌĞƐĐĞŶƚůŝŐŚƚŝŶŐ͘dŚĞƌĞĂƌĞƐŽŵĞŵĂŐŶĞƚŝĐďĂůůĂƐƚdͲϭϮůĂŵƉƐŝŶ Page 71 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ^ƚŽƌĂŐĞĂŶĚDĞĐŚĂŶŝĐĂůZŽŽŵƐ͘ͲůĂŵƉĨŝǆƚƵƌĞƐŚĂǀĞĂŵŝǆŽĨŝŶĐĂŶĚĞƐĐĞŶƚ͕ĐŽŵƉĂĐƚĨůƵŽƌĞƐĐĞŶƚĂŶĚ> ůĂŵƉƐ͘ǆƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐƉƌĞĚŽŵŝŶĂŶƚůǇŚŝŐŚǁĂƚƚĂŐĞ,/ŵĂŐŶĞƚŝĐďĂůůĂƐƚůŝŐŚƚŝŶŐ͘^ĞĞƚŚĞůŝŐŚƚŝŶŐƐĐŽƉĞŽĨ &/D͞Ϭϵ͘ϬϭͲZ͗hƉŐƌĂĚĞ>ŝŐŚƚŝŶŐƚŽ>͟ŝŶ^ĞĐƚŝŽŶϮĨŽƌƌĞĨĞƌĞŶĐĞ͘ '20(67,&+27:$7(5 ŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌŝƐƉƌŽǀŝĚĞĚďǇƚǁŽĞůĞĐƚƌŝĐǁĂƚĞƌŚĞĂƚĞƌƐ͘KŶĞǁĂƚĞƌŚĞĂƚĞƌŝƐϱϬŐĂůůŽŶƐĂŶĚƚŚĞŽƚŚĞƌŝƐ ϭϬϬŐĂůůŽŶƐ͘ϯϬϬŐĂůůŽŶƐƚŽƌĂŐĞƚĂŶŬƐĞƌǀĞƐƚŚĞƐŚŽǁĞƌƐĂŶĚůŽĐŬĞƌƌŽŽŵƐ͘ +9$&$1'&21752/6 ŝƌŽŽůĞĚŚŝůůĞƌ DĐYƵĂǇĂŝƌĐŽŽůĞĚĐŚŝůůĞƌƉƌŽǀŝĚĞƐĐŚŝůůĞĚǁĂƚĞƌƚŽƚŚĞďƵŝůĚŝŶŐĂŝƌŚĂŶĚůĞƌĐŚŝůůĞĚǁĂƚĞƌĐŽŝůƐƚŚƌŽƵŐŚĂ ƉƌŝŵĂƌǇĐŝƌĐƵůĂƚŝŽŶůŽŽƉ͘/ƚŚĂƐĂŶŽŵŝŶĂůĐŽŽůŝŶŐĐĂƉĂĐŝƚǇŽĨϲϱdŽŶƐĂŶĚǁĂƐŝŶƐƚĂůůĞĚŝŶϭϵϵϭ;ϮϵǇĞĂƌƐŽůĚͿ͘/ƚ ŝƐĂƚƚŚĞĞŶĚŽĨŝƚƐƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞĂŶĚŝŶŶĞĞĚŽĨƌĞƉůĂĐĞŵĞŶƚ͘ĐŽŶƐƚĂŶƚǀŽůƵŵĞ͕ϱŚƉƉƵŵƉƉƌŽǀŝĚĞƐ ĐŝƌĐƵůĂƚŝŽŶĨŽƌƚŚĞƉƌŝŵĂƌǇĐŚŝůůĞĚǁĂƚĞƌůŽŽƉ͘ ŝƌ,ĂŶĚůĞƌƐ dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐƐĞƌǀĞĚďǇƐĞǀĞŶƚĞĞŶ;ϭϳͿĂŝƌŚĂŶĚůĞƌƐ;,h͛ƐͿĂŶĚĂƌĞŽƌŝŐŝŶĂůƚŽƚŚĞďƵŝůĚŝŶŐ ;ϯϮǇĞĂƌƐŽůĚͿ͘ĂĐŚ,hŚĂƐĂĐŚŝůůĞĚǁĂƚĞƌĐŽŝůĨŽƌĐŽŽůŝŶŐĂŶĚĂŶĞůĞĐƚƌŝĐĚƵĐƚĐŽŝůĨŽƌŚĞĂƚŝŶŐ͘dŚĞ,h͛ƐĂƌĞ ĐŽŶƐƚĂŶƚǀŽůƵŵĞĂŶĚŚĂǀĞƌĞƚƵƌŶĂŝƌĂŶĚŽƵƚƐŝĚĞĂŝƌĚƵĐƚĞĚƚŽƚŚĞŵ͘ƐŝŶŐůĞŚĞĂƚƌĞĐŽǀĞƌǇƵŶŝƚƐĞƌǀĞƐƚŚĞ >ŽĐŬĞƌZŽŽŵƐƚŽŵŝŶŝŵŝǌĞĞŶĞƌŐǇůŽƐƐƚŚƌŽƵŐŚůĂƌŐĞǀŽůƵŵĞƐŽĨŽƵƚƐŝĚĞĂŝƌ͘dŚĞ,h͛ƐĂƌĞŝŶƚŚĞDĞĐŚĂŶŝĐĂů DĞǌǌĂŶŝŶĞƐƚŚƌŽƵŐŚŽƵƚƚŚĞĨĂĐŝůŝƚǇ͘dŚĞ,h͛ƐĂƌĞĂƉƉƌŽĂĐŚŝŶŐƚŚĞŝƌĞŶĚŽĨƐĞƌǀŝĐĞůŝĨĞĂŶĚǁŝůůƌĞƋƵŝƌĞ ƌĞĨƵƌďŝƐŚŵĞŶƚŽƌƌĞƉůĂĐĞŵĞŶƚ͘ )LJXUH7\SLFDO$+8 Page 72 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ )LJXUH0HFKDQLFDO0H]]DQLQH ŝƌͲ,ĂŶĚůŝŶŐ^ǇƐƚĞŵŽŶƚƌŽůƐ dŚĞďƵŝůĚŝŶŐĂƵƚŽŵĂƚŝŽŶƐǇƐƚĞŵ;^ͿŝƐĂĚŝƌĞĐƚĚŝŐŝƚĂůĐŽŶƚƌŽů;ͿƐǇƐƚĞŵƉƌŽǀŝĚĞĚďǇůĞƌƚŽŶŽŶƚƌŽůƐ͘dŚĞ ĐŽŶƚƌŽůƐǇƐƚĞŵŝƐƉĂƐƚŝƚƐƐĞƌǀŝĐĞůŝĨĞĂŶĚǁŝůůƌĞƋƵŝƌĞƌĞƉůĂĐĞŵĞŶƚĂƐƐƵƉƉŽƌƚǁŝůůďĞĞŶĚŝŶŐ͘WĂƌƚƐĨŽƌƚŚŝƐĐŽŶƚƌŽů ƐǇƐƚĞŵĂƌĞŶŽǁŽŶůǇĂǀĂŝůĂďůĞŝŶƚŚĞƵƐĞĚŵĂƌŬĞƚĂŶĚĂƌĞǀĞƌǇĞǆƉĞŶƐŝǀĞƚŽƌĞƉĂŝƌ͘ ǆŚĂƵƐƚ&ĂŶƐ EŝŶĞ;ϵͿĞǆŚĂƵƐƚĨĂŶƐ;&͛ƐͿƐĞƌǀĞƚŚĞŽŵŵƵŶŝƚǇĞŶƚĞƌ͘DŽƐƚŽĨƚŚĞ&͛ƐĂƌĞĨƌĂĐƚŝŽŶĂůŚŽƌƐĞƉŽǁĞƌ;ŚƉͿǁŝƚŚ ƚŚĞůĂƌŐĞƐƚĂƚϭ͘ϱŚƉ͕ƐĞƌǀŝŶŐƚŚĞ>ŽĐŬĞƌZŽŽŵƐ͘dŚĞĞǆŚĂƵƐƚĨĂŶƐĂƌĞŽƌŝŐŝŶĂůƚŽƚŚĞďƵŝůĚŝŶŐĂŶĚĂƉƉƌŽĂĐŚŝŶŐ ƚŚĞĞŶĚŽĨƚŚĞŝƌƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘ ^W/>dzEW>h'>K^ WůƵŐůŽĂĚƐĂƌĞƚǇƉŝĐĂůĨŽƌĂĐŽŵŵƵŶŝƚǇĐĞŶƚĞƌŝŶĐůƵĚŝŶŐĐŽŵƉƵƚĞƌƐ͕ĚĞƐŬůĂŵƉƐ͕ĐŽƉŝĞƌƐ͕ƌĞĨƌŝŐĞƌĂƚŽƌƐĂŶĚĐŽĨĨĞĞ ƉŽƚƐŝŶƐƵƉƉŽƌƚŽĨƚŚĞŽĨĨŝĐĞĂƌĞĂƐĂŶĚǀĞŶĚŝŶŐŵĂĐŚŝŶĞƐŝŶƚŚĞDĂŝŶ,ĂůůǁĂǇ͘dŚĞƌĞŵĂŝŶĚĞƌŽĨƚŚĞƉůƵŐůŽĂĚƐ ŝŶĐůƵĚĞǁŽƌŬŽƵƚŵĂĐŚŝŶĞƐůŽĐĂƚĞĚŝŶƚŚĞ&ŝƚŶĞƐƐĞŶƚĞƌĂŶĚƉůƵŐͲŝŶƉƌŽƉĞůůĞƌĨĂŶƐĨŽƌĂŝƌŵŽǀĞŵĞŶƚŝŶƚŚĞ &ŝƚŶĞƐƐĞŶƚĞƌ͘ Page 73 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ /dzEdZWZ</E''Z' *(1(5$/,1)250$7,21 dŚĞZĞŶƚŽŶŝƚǇĞŶƚĞƌWĂƌŬŝŶŐ'ĂƌĂŐĞ͕ůŽĐĂƚĞĚĂƚϲϱϱ^ŽƵƚŚ^ĞĐŽŶĚ^ƚƌĞĞƚ͕ZĞŶƚŽŶ͕tϵϴϬϱϳŝƐĂƉƵďůŝĐ ƉĂƌŬŝŶŐŐĂƌĂŐĞƐĞƌǀŝŶŐĚŽǁŶƚŽǁŶZĞŶƚŽŶĂŶĚƚŚĞŽǁŶƚŽǁŶDĞƚƌŽdƌĂŶƐŝƚ^ƚĂƚŝŽŶ͘/ƚŝƐĞŝŐŚƚƐƚŽƌŝĞƐƚĂůůĂŶĚŝƐ ϭϳϵ͕ϮϰϯŐƌŽƐƐƐƋƵĂƌĞĨĞĞƚ͘/ƚŚĂƐϱϲϮƉĂƌŬŝŶŐƐƚĂůůƐ͕ǁŝƚŚϰϭϭŽĨƚŚŽƐĞĂƐŚŽƵƌůǇŽƌƉĞƌŵŝƚƉĂƌŬŝŶŐĂŶĚϭϱϬƐƚĂůůƐ ƌĞƐĞƌǀĞĚĨŽƌDĞƚƌŽWĂƌŬĂŶĚZŝĚĞ;ϱĂ͘ŵ͘ƚŽϭϭƉ͘ŵ͘Ϳ͘ *(20(75<$1'(19(/23( dŚĞŝƚǇĞŶƚĞƌWĂƌŬŝŶŐ'ĂƌĂŐĞŝƐƌĞĐƚĂŶŐƵůĂƌĂŶĚĐŽŶƐƚƌƵĐƚĞĚŽĨĐŽŶĐƌĞƚĞ͘dŚĞƉĂƌŬŝŶŐŐĂƌĂŐĞŝƐĐŽŶƐŝĚĞƌĞĚĂŶ ŽƉĞŶƉĂƌŬŝŶŐŐĂƌĂŐĞĂƐĞĂĐŚĨůŽŽƌŝƐŽƉĞŶƚŽƚŚĞŽƵƚĚŽŽƌƐĂŶĚĚŽĞƐŶŽƚŚĂǀĞĂĐůŽƐĞĚŝŶĞǆƚĞƌŝŽƌǁĂůů͘ )LJXUH*DUDJH6RXWK([WHULRU dǁŽĐŽŶĚŝƚŝŽŶĞĚƐƉĂĐĞƐĞǆŝƐƚŽŶƚŚĞĨŝƌƐƚĨůŽŽƌ͘KŶĞŽŶƚŚĞǁĞƐƚƐŝĚĞĂŶĚŽŶĞŽŶƚŚĞĞĂƐƚƐŝĚĞŽĨƚŚĞŐĂƌĂŐĞ͘ dŚĞƐĞĂƌĞƵƐĞĂƐWŽůŝĐĞWƌĞĐŝŶĐƚƐĨŽƌƚŚĞŝƚǇŽĨZĞŶƚŽŶ͘dŚĞĐŽŶĚŝƚŝŽŶĞĚƐƉĂĐĞŚĂƐĨƵƌƌĞĚ͕ŝŶƐƵůĂƚĞĚǁĂůůƐĂŶĚ Page 74 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ĚŽƵďůĞƉĂŶĞŐůĂǌŝŶŐ͘ 6&+('8/(6 dŚĞŝƚǇĞŶƚĞƌWĂƌŬŝŶŐ'ĂƌĂŐĞŝƐŽƉĞŶĚĂŝůǇĨƌŽŵϰ͗ϯϬĂ͘ŵ͘ƚŽϭ͗ϯϬĂ͘ŵ͕͘^ƵŶĚĂǇƚŚƌŽƵŐŚ^ĂƚƵƌĚĂǇ͘EŽŽǀĞƌŶŝŐŚƚ ƉĂƌŬŝŶŐŝƐĂůůŽǁĞĚ͘ /,*+7,1* >ŝŐŚƚŝŶŐŝƐƉƌĞĚŽŵŝŶĂŶƚůǇϰϮͲǁĂƚƚƚƌŝƉůĞĐŽŵƉĂĐƚĨůƵŽƌĞƐĐĞŶƚĨŝǆƚƵƌĞƐŝŶƚŚĞĐŽǀĞƌĞĚƉĂƌŬŝŶŐĂƌĞĂƐ͘dŚĞƚŽƉĨůŽŽƌ ŝƐůŝƚďǇϮϱϬǁĂƚƚ,/ŵĂŐŶĞƚŝĐƉŽůĞůŝŐŚƚŝŶŐdŚĞŽĨĨŝĐĞƐƉĂĐĞƐĂƌĞƉƌĞĚŽŵŝŶĂŶƚůǇϯϮǁĂƚƚϰ͛ůŝŶĞĂƌdͲϴĨŝǆƚƵƌĞƐ͘ )LJXUH7\SLFDO3DUNLQJ*DUDJH/LJKW)L[WXUH '20(67,&+27:$7(5 ŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌĨŽƌƚŚĞƐŵĂůůƌĞƐƚƌŽŽŵŝƐƉƌŽǀŝĚĞĚďǇĂƐŵĂůůĞůĞĐƚƌŝĐǁĂƚĞƌŚĞĂƚĞƌ͘ +9$&$1'&21752/6 ^ƉůŝƚŽŶĚĞŶƐĞƌ,ĞĂƚWƵŵƉƐ dŚĞƉĂƌŬŝŶŐĂƌĞĂƐĂƌĞƵŶĐŽŶĚŝƚŝŽŶĞĚĂŶĚĞǆƉŽƐĞĚƚŽƚŚĞŽƵƚĚŽŽƌƐ͘dŚĞƐŵĂůůŽĨĨŝĐĞƐĂƌĞŚĞĂƚĞĚĂŶĚĐŽŽůĞĚďǇ ƐƉůŝƚĐŽŶĚĞŶƐĞƌŚĞĂƚƉƵŵƉƐ͘ Page 75 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ )LJXUH7\SLFDO2IILFH6SOLW+HDW3XPS ŝƌͲ,ĂŶĚůŝŶŐ^ǇƐƚĞŵŽŶƚƌŽůƐ ŽŶƚƌŽůƐĨŽƌƚŚĞŚĞĂƚƉƵŵƉƐĂƌĞŵĂŶƵĨĂĐƚƵƌĞƌƐƉĞĐŝĨŝĐůŽĐĂůĐŽŶƚƌŽůƐǁŝƚŚƉƌŽŐƌĂŵŵĂďůĞƐƉĂĐĞƚŚĞƌŵŽƐƚĂƚƐ͘ ǆŚĂƵƐƚ&ĂŶƐ ƐŵĂůů͕ĨƌĂĐƚŝŽŶĂůŚŽƌƐĞƉŽǁĞƌĞǆŚĂƵƐƚĨĂŶƐĞƌǀĞƐƚŚĞŐĂƌĂŐĞƌĞƐƚƌŽŽŵ͘ ^W/>dzEW>h'>K^ WůƵŐůŽĂĚƐŝŶƚŚĞŽĨĨŝĐĞƐƉĂĐĞƐĂƌĞƚǇƉŝĐĂůĨŽƌĂƐŵĂůůŽĨĨŝĐĞŝŶĐůƵĚŝŶŐĐŽŵƉƵƚĞƌƐ͕ĚĞƐŬůĂŵƉƐ͕ĐŽƉŝĞƌƐ͕Ă ƌĞĨƌŝŐĞƌĂƚŽƌĂŶĚĐŽĨĨĞĞƉŽƚ͘ Page 76 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ϱ͘ϯ&/>/dz/DWZKsDEdD^hZ^ʹ>h>d/KE^ &/DηϬϭ͘ϬϭͲZ,͗hƉŐƌĂĚĞŽŝůĞƌƐ͕WƵŵƉƐĂŶĚ^ƚŽƌĂŐĞdĂŶŬƐ &/DηϬϯ͘ϬϰͲZ,͗hƉŐƌĂĚĞ/dZŽŽŵŽŽůŝŶŐ &/DηϬϵ͘ϬϭͲW'͗hƉŐƌĂĚĞ>ŝŐŚƚŝŶŐƚŽ> Page 77 of 107 AGENDA ITEM #5. d) Page 78 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Facility Improvement Measure (FIM) Detail 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3K 'DWH )HEUXDU\ ),0,')DFLOLW\ ),01DPH $5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV &RQILGHQWLDO 3URSULHWDU\ 5HQWRQ&LW\+DOO ),0'HVFULSWLRQ 6DYLQJV0HWKRGRORJ\ ([LVWLQJ7KHFLW\KDOOLVVHUYHGE\WKUHHKHDWLQJKRWZDWHUERLOHUV7KHVDPHERLOHUV\VWHPDOVRSURYLGHVGRPHVWLFKRWZDWHU'+: IRUWKHORFNHUURRPVDQGVKHOWHU7KLV++:DQG'+:V\VWHPLVDWWKHHQGRILWVVHUYLFHOLIH7KLVPHDVXUHORRNVDWUHSODFLQJWKLV V\VWHPZLWKWZRVHSDUDWH++:DQG'+:V\VWHPV3URSRVHG8SJUDGHWKH++:ERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJERLOHUV 8SJUDGHWKH++:K\GURQLFV\VWHPDQGSURYLGHV\VWHPSXPSV'HPROLVKWKH'+:KHDWH[FKDQJHU+;DQGGRPHVWLFZDWHU VWRUDJHWDQNV3URYLGHWZRKLJKHIILFLHQF\GRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGHGRPHVWLFZDWHUUH FLUFXODWLQJSXPS'+:ZLOOEHGHFRXSOHGIURPWKHEXLOGLQJ++:ORRS %LQ&DOFXODWLRQGHPRQVWUDWLQJVDYLQJVIURPLPSURYHGERLOHUHIILFLHQF\ZKHQPRYLQJIURPQRQFRQGHQVLQJWRFRQGHQVLQJERLOHUV'H FRXSOHGRPHVWLFKRWZDWHUKHDWLQJIURPVSDFHKHDWLQJORDGV Page 79 of 107 AGENDA ITEM #5. d) BB o i l e r C a l c Sum mar y 01 .01-RCH: Up grade Boilers, Pumps and Storage Tanks Project Information: 3URMHFW1DPH &LW\RI5HQWRQ ),01DPH 5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV 7&23URMHFW,'(QJLQHHU -RKQ.HDUQV 7&27RRO),0,''DWH Desc rip tion of FIM From TCO Tool: FIM Calculation Method From TCO Tool: Calculations:%DVH 3URSRVHG 6DYLQJV 8QLWV %DVLVRI9DOXH &6SDFH+HDWLQJ%RLOHU6DYLQJV 7KHUPV &'+:+HDWLQJ6DYLQJV 7KHUPV Total S avings %DVH 3URSRVHG 6DYLQJV 8QLWV &1DWXUDO*DV 7KHUPV 680&& ([LVWLQJ7KHWKUHHEXLOGLQJKHDWLQJKRWZDWHUERLOHUVPDLQIRXUFLUFXODWLRQSXPSVGRPHVWLFZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUUHFLUFXODWLRQSXPS DQGWZRGRPHVWLFVWRUDJHWDQNV(TXLSPHQWLVDWWKHHQGRIWKHLUXVHIXOOLIHDQGVKDOOEHUHSODFHG3URSRVHG8SJUDGHWKHERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJ ERLOHUV8SJUDGHWKHK\GURQLFV\VWHPDQGSURYLGHV\VWHPSXPSV'HPROLVKWKHGRPHVWLFKRWZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUVWRUDJHWDQNV3URYLGH KLJKHIILFLHQF\WZRGRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGHGRPHVWLFZDWHUUHFLUFXODWLQJSXPS'RPHVWLFKRWZDWHUZLOOEHGH FRXSOHGIURPWKHEXLOGLQJKHDWLQJKRWZDWHUORRS %LQ&DOFXODWLRQGHPRQVWUDWLQJVDYLQJVIURPLPSURYHGERLOHUHIILFLHQF\ZKHQPRYLQJIURPQRQFRQGHQVLQJWRFRQGHQVLQJERLOHUV'HFRXSOHGRPHVWLFKRWZDWHU KHDWLQJIURPVSDFHKHDWLQJORDGV 3URSULHWDU\DQG&RQILGHQWLDO Page 80 of 107 AGENDA ITEM #5. d) SS p a c e Heati ng S a v in g s 01 .01-RCH: Up grade Boilers, Pumps and Storage Tanks Project Information: 3URMHFW1DPH &LW\RI5HQWRQ ),01DPH 5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV 7&23URMHFW,'(QJLQHHU -RKQ.HDUQV 7&27RRO),0,''DWH Desc rip tion of FIM From TCO Tool: FIM Calculation Method From TCO Tool: Inputs:%DVH 3URSRVHG 8QLWV %DVLVRI9DOXH &1XPEHURIERLOHUV 4XDQWLW\6LWH'DWD &%RLOHU7\SH 1RQ&RQGHQVLQJ &RQGHQVLQJ 6LWH'DWD3URSRVHG &7RWDO5DWHG&DSDFLW\,QSXW 0%+ 0(3'UDZLQJV3URSRVHG &7RWDO5DWHG&DSDFLW\2XWSXW 0%+ 0(3'UDZLQJV3URSRVHG &%RLOHU6HDVRQDO(IILFLHQF\ 5HWXUQ:DWHU.1(IILFLHQF\&XUYH & & )RUPXODH 5HIHUHQFH5RZ & PRVWUHFHQW PRQWKV 0,1'' 0$;' ( ) &' & & 0RQWK 0HWHUHG%DVHOLQH (VWLPDWHG 'RPHVWLF+HDWLQJ 8VH &DOFXODWHG6SDFH +HDWLQJ8VH 6SDFH+HDWLQJ )XHO6DYLQJV &7KHUPV<U 7KHUPV<U 7KHUPV<U 7KHUPV<U & & -DQ & )HE & 0DU & $SU & 0D\ & -XQ & -XO & $XJ & 6HS & 2FW & 1RY & 'HF & & & & & &Calculated Valu e s:%DVH 3URSRVHG 6DYLQJV 8QLWV &6SDFH+HDWLQJ1DWXUDO*DV 7KHUPV ' ([LVWLQJ7KHWKUHHEXLOGLQJKHDWLQJKRWZDWHUERLOHUVPDLQIRXUFLUFXODWLRQSXPSVGRPHVWLFZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUUHFLUFXODWLRQSXPS DQGWZRGRPHVWLFVWRUDJHWDQNV(TXLSPHQWLVDWWKHHQGRIWKHLUXVHIXOOLIHDQGVKDOOEHUHSODFHG3URSRVHG8SJUDGHWKHERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJ ERLOHUV8SJUDGHWKHK\GURQLFV\VWHPDQGSURYLGHV\VWHPSXPSV'HPROLVKWKHGRPHVWLFKRWZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUVWRUDJHWDQNV3URYLGH KLJKHIILFLHQF\WZRGRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGHGRPHVWLFZDWHUUHFLUFXODWLQJSXPS'RPHVWLFKRWZDWHUZLOOEHGH FRXSOHGIURPWKHEXLOGLQJKHDWLQJKRWZDWHUORRS %LQ&DOFXODWLRQGHPRQVWUDWLQJVDYLQJVIURPLPSURYHGERLOHUHIILFLHQF\ZKHQPRYLQJIURPQRQFRQGHQVLQJWRFRQGHQVLQJERLOHUV'HFRXSOHGRPHVWLFKRWZDWHU KHDWLQJIURPVSDFHKHDWLQJORDGV 3URSULHWDU\DQG&RQILGHQWLDO Page 81 of 107 AGENDA ITEM #5. d) DD o m e s t ic Hot Wate r S a v i n gs 01 .01-RCH: Up grade Boilers, Pumps and Storage Tanks Project Information: 3URMHFW1DPH &LW\RI5HQWRQ ),01DPH 5&+8SJUDGH%RLOHUV3XPSVDQG6WRUDJH7DQNV 7&23URMHFW,'(QJLQHHU 7&27RRO),0,''DWH Desc rip tion of FIM From TCO Tool: FIM Calculation Method From TCO Tool: Inputs:%DVH 3URSRVHG 8QLWV %DVLVRI9DOXH &1XPEHURIERLOHUV 4XDQWLW\6LWH'DWD &%RLOHU7\SH 1RQ&RQGHQVLQJ &RQGHQVLQJ 6LWH'DWD3URSRVHG &7RWDO5DWHG&DSDFLW\,QSXW 0%+ 0(3'UDZLQJV3URSRVHG &7RWDO5DWHG&DSDFLW\2XWSXW 0%+ 0(3'UDZLQJV3URSRVHG &%RLOHU6HDVRQDO(IILFLHQF\ (VWLPDWHGEDVHGRQVLWHGDWD3URSRVHG+HDWHU(II & & )RUPXODH 5HIHUHQFH5RZ & PRVWUHFHQW PRQWKV 0,1'' 0$;' ( ( &' & & 0RQWK 0HWHUHG%DVHOLQH (VWLPDWHG 'RPHVWLF+HDWLQJ 8VH &DOFXODWHG6SDFH +HDWLQJ8VH 'RPHVWLF+RW :DWHU)XHO 6DYLQJV &7KHUPV<U 7KHUPV<U 7KHUPV<U 7KHUPV<U & & -DQ & )HE & 0DU & $SU & 0D\ & -XQ & -XO & $XJ & 6HS & 2FW & 1RY & 'HF & & & & & &Calculated Valu e s:%DVH 3URSRVHG 6DYLQJV 8QLWV &1DWXUDO*DV 7KHUPV ( ([LVWLQJ7KHWKUHHEXLOGLQJKHDWLQJKRWZDWHUERLOHUVPDLQIRXUFLUFXODWLRQSXPSVGRPHVWLFZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUUHFLUFXODWLRQSXPS DQGWZRGRPHVWLFVWRUDJHWDQNV(TXLSPHQWLVDWWKHHQGRIWKHLUXVHIXOOLIHDQGVKDOOEHUHSODFHG3URSRVHG8SJUDGHWKHERLOHUVZLWKKLJKHIILFLHQF\FRQGHQVLQJ ERLOHUV8SJUDGHWKHK\GURQLFV\VWHPDQGSURYLGHV\VWHPSXPSV'HPROLVKWKHGRPHVWLFKRWZDWHUKHDWH[FKDQJHU+;DQGGRPHVWLFZDWHUVWRUDJHWDQNV3URYLGH KLJKHIILFLHQF\WZRGRPHVWLFZDWHUKHDWHUVVHFRQGRQHLVIRUUHGXQGDQF\RQO\3URYLGHGRPHVWLFZDWHUUHFLUFXODWLQJSXPS'RPHVWLFKRWZDWHUZLOOEHGH FRXSOHGIURPWKHEXLOGLQJKHDWLQJKRWZDWHUORRS %LQ&DOFXODWLRQGHPRQVWUDWLQJVDYLQJVIURPLPSURYHGERLOHUHIILFLHQF\ZKHQPRYLQJIURPQRQFRQGHQVLQJWRFRQGHQVLQJERLOHUV'HFRXSOHGRPHVWLFKRWZDWHU KHDWLQJIURPVSDFHKHDWLQJORDGV 3URSULHWDU\DQG&RQILGHQWLDO Page 82 of 107 AGENDA ITEM #5. d) Facility Improvement Measure (FIM) Detail 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3K 'DWH )HEUXDU\ ),0,')DFLOLW\ ),01DPH 5&+8SJUDGH,75RRP&RROLQJ &RQILGHQWLDO 3URSULHWDU\ 5HQWRQ&LW\+DOO ),0'HVFULSWLRQ 6DYLQJV0HWKRGRORJ\ ([LVWLQJ7KH,75RRPLVVHUYHGE\VSOLWV\VWHPIDQFRLOXQLWVORFDWHGDERYHWKHVHUYHUUDFNVDQGFRQGHQVHUXQLWVORFDWHGLQ WKH3DUNLQJ*DUDJH9HQWLODWLRQLVSURYLGHGE\WKHFHQWUDOEXLOGLQJYHQWLODWLRQV\VWHP7KHH[LVWLQJV\VWHPLVWLHGLQWRWKHFHQWUDOILUH DODUPV\VWHPDQGVKXWVGRZQGXULQJWHVWLQJ3URSRVHG'HPROLVKH[LVWLQJIDQFRLOXQLWVDQGFRQGHQVHUXQLWVVHUYLQJWKH,7URRP 3URYLGHRXWVLGHDLUDQGH[KDXVWORXYUHVIRUWKH,75RRPZKLFKZLOODOORZIRUDLUVLGHHFRQRPL]LQJDQGGHFRXSOHGYHQWLODWLRQ 3URYLGHZDOOPRXQWHGVSOLWV\VWHPFRROLQJRQO\XQLWVWRVHUYHWKH,7URRP,IDOORZHGFRROLQJDQGYHQWLODWLRQV\VWHPWREHGH FRXSOHGIURPWKHFHQWUDOILUHDODUPV\VWHP 7KLVFDOFXODWLRQXVHGDQ([FHOEDVHGHQHUJ\FDOFXODWLRQWKDWVLPXODWHVRQH\HDUHQHUJ\FRQVXPSWLRQXVLQJ70<GDWDWRPRGHO WKHH[LVWLQJDQGSURSRVHGV\VWHPVEDVHGRQLQSXWVLQFOXGLQJEXLOGLQJXVHDQGPHFKDQLFDOV\VWHPW\SHDQGRSHUDWLRQ3URSRVHG FKDQJHVLQFOXGHFRROLQJHIILFLHQFLHVDQGDLUVLGHHFRQRPL]HU Page 83 of 107 AGENDA ITEM #5. d) McK8760 - General Information 03.04-RCH: Upgrade IT Room Cooling Project Information: 3URMHFW1DPH &LW\RI5HQWRQ ),01DPH 5&+8SJUDGH,75RRP&RROLQJ 7&23URMHFW,'7HFK&RQWDFW 7&27RRO),0,''DWH Weather Data: 6WDWLRQ,'7<[OV Description of FIM From TCO Tool: HVAC & Load Schedules: 6FKHGXOH$7LWOH 2IILFH 6FKHGXOH%7LWOH 2IILFH 6FKHGXOH&7LWOH 2IILFH Utility Rate Schedules 6FKHGXOH7LWOH 6FKHGXOH7LWOH 6FKHGXOH7LWOH Zone Data (for multi-model buildings) =RQH1DPH =RQH1DPHHJ578RU:HVW:LQJ =RQH'HVFULSWLRQ =RQH'HVFULSWLRQ Savings Tracker (Use if Modeling Multiple Efficiency Measures) (OHFWULF'HPDQG N: (OHFWULFLW\N:K 1DWXUDO*DV 7KHUP 6WHDP N/% (8, N%786T)W<U 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► 6DYLQJV► 8VDJH► Notes: /RDG6FKHGXOH& 0HDVXUH'HVFULSWLRQ %DVHOLQH%XLOGLQJ3HUIRUPDQFH $6+5$(6FKHGXOH7\SH $6+5$(6FKHGXOH7\SH 1HDUHVW:HDWKHU6WDWLRQ :$5(1721081, ([LVWLQJ7KH,75RRPLVVHUYHGE\VSOLWV\VWHPIDQFRLOXQLWVORFDWHGDERYHWKHVHUYHUUDFNVDQGFRQGHQVHUXQLWVORFDWHGLQWKH3DUNLQJ*DUDJH 9HQWLODWLRQLVSURYLGHGE\WKHFHQWUDOEXLOGLQJYHQWLODWLRQV\VWHP7KHH[LVWLQJV\VWHPLVWLHGLQWRWKHFHQWUDOILUHDODUPV\VWHPDQGVKXWVGRZQGXULQJ WHVWLQJ3URSRVHG'HPROLVKH[LVWLQJIDQFRLOXQLWVDQGFRQGHQVHUXQLWVVHUYLQJWKH,7URRP3URYLGHRXWVLGHDLUDQGH[KDXVWORXYUHVIRUWKH,75RRPZKLFK ZLOODOORZIRUDLUVLGHHFRQRPL]LQJDQGGHFRXSOHGYHQWLODWLRQ3URYLGHZDOOPRXQWHGVSOLWV\VWHPFRROLQJRQO\XQLWVWRVHUYHWKH,7URRP,IDOORZHG FRROLQJDQGYHQWLODWLRQV\VWHPWREHGHFRXSOHGIURPWKHFHQWUDOILUHDODUPV\VWHP $6+5$(6FKHGXOH7\SH/RDG6FKHGXOH$ 5DWH6FKHGXOH 5DWH6FKHGXOH 5DWH6FKHGXOH /RDG6FKHGXOH% Page 84 of 107 AGENDA ITEM #5. d) McK8760 - Outputs 03.04-RCH: Upgrade IT Room Cooling Electric Demand 7DJ 'HVFULSWLRQ 8QLWV %DVHOLQH (8, 3URSRVHG (8, 6DYLQJV 6DYLQJV (8, 2&RROLQJ3HDNN: N: 2$+8+HDWLQJ3HDNN: N: 2=RQH+HDWLQJ3HDNN: N: 2)DQ3HDNN: N: 2,QWHULRU/LJKWLQJ3HDNN: N: 2([WHULRU/LJKWLQJ3HDNN: N: 23OXJ/RDG3HDNN: N: 20LVFHOODQHRXV/RDG3HDNN: N: 22WKHU3HDNN: N: 2 3HDNN: N: 2 3HDNN:6XP0RQWKO\3HDNV N: Electricity 7DJ 'HVFULSWLRQ 8QLWV %DVHOLQH (8, 3URSRVHG (8, 6DYLQJV 6DYLQJV (8, 2&RROLQJ N:K<U 2$+8+HDWLQJ N:K<U 2=RQH+HDWLQJ N:K<U 2$+8)DQV N:K<U 2=RQH)DQV N:K<U 2,QWHULRU/LJKWLQJ N:K<U 2([WHULRU/LJKWLQJ N:K<U 23OXJ/RDGV N:K<U 20LVFHOODQHRXV/RDGV N:K<U 2'RPHVWLF+RW:DWHU N:K<U 22WKHU(OHFWULFLW\ N:K<U 2 7RWDO N:K<U Natural Gas 7DJ 'HVFULSWLRQ 8QLWV %DVHOLQH (8, 3URSRVHG (8, 6DYLQJV 6DYLQJV (8, 2$+8+HDWLQJ 7KHUP<U 2=RQH+HDWLQJ 7KHUP<U 2'RPHVWLF+RW:DWHU 7KHUP<U 22WKHU1DWXUDO*DV 7KHUP<U 2 7RWDO 7KHUP<U Steam 7DJ 'HVFULSWLRQ 8QLWV %DVHOLQH (8, 3URSRVHG (8, 6DYLQJV 6DYLQJV (8, 2$+8+HDWLQJ N/%<U 2=RQH+HDWLQJ N/%<U 2'RPHVWLF+RW:DWHU N/%<U 22WKHU6WHDP N/%<U 2 7RWDO6WHDP N/%<U Total Energy 7DJ 'HVFULSWLRQ 8QLWV %DVHOLQH (8, 3URSRVHG (8, 6DYLQJV 6DYLQJV (8, 2 7RWDO(QHUJ\ N%WX<U Page 85 of 107 AGENDA ITEM #5. d) McK8760 - Inputs 03.04-RCH: Upgrade IT Room Cooling Zone Inputs: 7DJ 8QLWV %DVHOLQH 3URSRVHG %DVLV ,IW 'UDZLQJ7DNHRII ,IW1$ ,IW 'UDZLQJ7DNHRII ,*OD]LQJ$UHD *OD]LQJ IW 'UDZLQJ7DNHRII ,5RRI8)DFWRU 5RRI %78IWR) 1$ ,2SDTXH:DOO8)DFWRU :DOOV %78IWR) &RQFUHWH3OXV,QVXO ,*OD]LQJ8)DFWRU *OD]LQJ %78IWR) 'RXEOH3DQH ,*OD]LQJ6RODU+HDW*DLQ&RHIILFLHQW6+*&*OD]LQJ 7\S , 7\S ,IW 'ZJ7DNHRII ,DFK /RRVH ,4W\ ,%WXK /LJKW2IILFH:RUN ,/DWHQW+HDW*DLQ3HU3HUVRQ %WXK /LJKW2IILFH:RUN ,:IW /LJKWLQJ$XGLW ,:IW 6SDFHQRWXVHG ,N: 1$ ,:DWW 6HUYHU ,<HV1R <HV <HV ,R) /RJJHU'DWD ,R) /RJJHU'DWD ,R) /RJJHU'DWD ,R) /RJJHU'DWD AHU & Plant Inputs: 7DJ 8QLWV %DVHOLQH 3URSRVHG %DVLV ,7\SH &9 &9 ,7\SH &RQWLQXRXV &RQWLQXRXV ,&)0 %/0D[&)0SHU)&83U , , %/1R(FRQ3URS(FRQ , 0LQLPXP3+3OXV5RRP5HFLUF2 , 1$ ,R) ,R) ,'HPDQG&RQWUROOHG9HQWLODWLRQ)RU2XWVLGH$LU&RQWURO <HV1R 1R 1R 1$ ,'&9$LUIORZ3HU3HUVRQ%DVHGRQ6SDFH7\SH'&97DE &)03HU 1$ ,'&9$LUIORZ3HU$UHD%DVHGRQ6SDFH7\SH'&97DE &)0IW1$ ,LQZF %/DQG3URS)DQ3RZHU , 7\S ,2FFXSLHG6XSSO\$LU7HPSHUDWXUH#2$7! R)6LQJOH=RQH 6LQJOH=RQH 7\S ,2FFXSLHG6XSSO\$LU7HPSHUDWXUH#2$7! R)1$ ,R)8VH2FF6$7 8VH2FF6$7 1$ ,R)1$ ,%78:DWW ([LVWLQJ&XWVKHHW'HUDWHE\DJHDQG , 1$ ,R) 1$ ,$+8+HDWLQJ(IILFLHQF\RU&23#2$7! &23 1$1R+HDWLQJ ,$+8+HDWLQJ(IILFLHQF\RU&23#2$7! &23 1$1R+HDWLQJ ,7\SH (OHFWULF (OHFWULF 1$ ,R) 1$1R+HDWLQJ ,<HV1R 1R 1R 1$ , 1$ Terminal Devices Inputs (Reheat Coils, VAV Boxes, Baseboard Heaters, etc) 7DJ 8QLWV %DVHOLQH 3URSRVHG %DVLV ,<HV1R 1R 1R 1$ ,R)1$ ,=RQH+HDWLQJ(IILFLHQF\RU&23#2$7! &23 1$ ,=RQH+HDWLQJ(IILFLHQF\RU&23#2$7! &23 1$ ,7\SH (OHFWULF (OHFWULF 1$ ,=RQH$+8 $+8&RLO $+8&RLO 1$ ,:&)0 1$ Domestic Hot Water Inputs: 7DJ 8QLWV %DVHOLQH 3URSRVHG %DVLV ,7\SH 1DWXUDO*DV 1DWXUDO*DV 1$ , 1$ ,4W\ 1$ ,*DOORQV 1$ ,R) 1$ ,R) 1$ 8QRFFXSLHG+HDWLQJ6XSSO\$LU7HPSHUDWXUH6HWSRLQW 8QRFFXSLHG&RROLQJ6XSSO\$LU7HPSHUDWXUH6HWSRLQW '+:)XHO7\SH (QHUJ\)DFWRU :RUNLQJ'D\V3HU<HDU8VHG2QO\)RU'+:&DOF $YHUDJH'DLO\+RW:DWHU&RQVXPSWLRQ3HU3HUVRQ $YHUDJH(QWHULQJ&ROG:DWHU7HPSHUDWXUH 6XSSO\+RW:DWHU7HPSHUDWXUH 9DULDEOH'HVFULSWLRQ 9DULDEOH'HVFULSWLRQ +HDWLQJ(QHUJ\6RXUFH=RQH 8QRFFXSLHG+HDWLQJ'RQH%\ 6)30%7HUPLQDO8QLW3RZHU 7HUPLQDO'HYLFHV =RQH+HDWLQJ/RFNRXW$ERYH +HDW5HFRYHU\(IIHFWLYHQHVV $+8&RROLQJ(IILFLHQF\((5 (YDSRUDWLYH&RROLQJ(IIHFWLYHQHVV$LUVLGH $+8&RROLQJ/RFNRXW%HORZ $+8+HDWLQJ(QHUJ\6RXUFH $+8+HDWLQJ/RFNRXW$ERYH (YDSRUDWLYH3UH&RROLQJRQ&RQGHQVHU )DQ(IILFLHQF\ +9$&2Q+HDWLQJ6SDFH7HPSHUDWXUH6HW3RLQW +9$&2II+HDWLQJ6SDFH7HPSHUDWXUH6HW3RLQW $+8)DQ3RZHUEDVHGRQ&RQWURO7\SH 0D[LPXP$+8&)0 0LQ$+8&)0RI0D[&)0,I&9&\FOHVPLQRFFUXQWLPH 9DULDEOH'HVFULSWLRQ 0D[LPXP2XWVLGH$LU(FRQRPL]HU26$ 0LQLPXP2XWVLGH$LU2FFXSLHG (FRQRPL]HU+LJK/LPLW6HW3RLQW $+8)DQ763$W0D[&)0 0LQLPXP2XWVLGH$LU8QRFFXSLHG 2FFXSLHG)DQ2SHUDWLRQ (FRQRPL]HU/RZ/LPLW6HW3RLQW +9$&2II&RROLQJ6SDFH7HPSHUDWXUH6HW3RLQW *OD]LQJ6RODU*DLQ%OGJ6KDSH)DFWRU $YHUDJH6SDFH+HLJKW)ORRUWR&HLOLQJ ,QILOWUDWLRQ 3HDN1XPEHURI2FFXSDQWV 3HDN/LJKWLQJ/RDG3RZHU'HQVLW\ 3HDN3OXJ/RDG3RZHU'HQVLW\ +9$&2Q&RROLQJ6SDFH7HPSHUDWXUH6HW3RLQW 6HQVLEOH+HDW*DLQ3HU3HUVRQ 3HDN0LVFHOODQHRXV/RDG(OHFWULFDO 0LVFHOODQHRXV/RDG/RFDWHGLQ&RQGLWLRQHG6SDFH 3HDN([WHULRU/LJKWLQJ/RDG 9DULDEOH'HVFULSWLRQ )ORRU$UHD 5RRI$UHD 2SDTXH:DOO$UHD Page 86 of 107 AGENDA ITEM #5. d) McK8760 - HVAC Schedules 03.04-RCH: Upgrade IT Room Cooling Baseline HVAC Equipment Daily Schedules 8QRFFXSLHG0RGH 2FFXSLHG0RGH 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R Proposed HVAC Equipment Daily Schedules 8QRFFXSLHG0RGH 2FFXSLHG0RGH 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R 'DLO\7RWDOV 'DLO\7RWDOV 'DLO\7RWDOV 'DLO\7RWDOV 'DLO\7RWDOV 6FKHGXOH&/RDG6FKHGXOH& +RXU 6FKHGXOH&/RDG6FKHGXOH& +RXU+RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$6FKHGXOH%/RDG6FKHGXOH% +RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$6FKHGXOH%/RDG6FKHGXOH% 'DLO\7RWDOV Page 87 of 107 AGENDA ITEM #5. d) McK8760 - Occupancy Schedules 03.04-RCH: Upgrade IT Room Cooling Baseline Occupancy Load Profiles (Percent of Peak Occupancy) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R Proposed Occupancy Load Profiles (Percent of Peak Occupancy) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R 6FKHGXOH&/RDG6FKHGXOH& +RXU 6FKHGXOH&/RDG6FKHGXOH& +RXU+RXU +RXU +RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% Page 88 of 107 AGENDA ITEM #5. d) McK8760 - Interior Lighting Schedules 03.04-RCH: Upgrade IT Room Cooling Baseline Lighting Load Profiles (Percent of Peak Lighting Load) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R Proposed Lighting Load Profiles (Percent of Peak Lighting Load) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R 6FKHGXOH&/RDG6FKHGXOH& +RXU 6FKHGXOH&/RDG6FKHGXOH& +RXU+RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% +RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% Page 89 of 107 AGENDA ITEM #5. d) McK8760 - Plug Load Schedules 03.04-RCH: Upgrade IT Room Cooling Baseline Plug Load Profiles (Percent of Peak Plug Load) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R Proposed Plug Load Profiles (Percent of Peak Plug Load) 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW 6XQ 0RQ 7XH :HG 7KX )UL 6DW )URP7R )URP7R )URP7R 6FKHGXOH&/RDG6FKHGXOH& +RXU 6FKHGXOH&/RDG6FKHGXOH& +RXU+RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% +RXU +RXU 6FKHGXOH$/RDG6FKHGXOH$ 6FKHGXOH%/RDG6FKHGXOH% Page 90 of 107 AGENDA ITEM #5. d) McK8760 - Calendar 03.04-RCH: Upgrade IT Room Cooling Calendar :HHNHQGV+LJKOLJKWHG<HOORZ)RU5HIHUHQFH<HDU 0RQWK 'D\ -DQ )HE 0DU $SU 0D\ -XQ -XO $XJ 6HS 2FW 1RY 'HF $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $$$$$$$$$$$$ $ $$$$$$$$$$ $ $$$$$$$$$$ $$$$$$$ Holidays and Observances: (Reference Year 1989) -DQ 1HZ<HDU V'D\ 0D\ 0HPRULDO'D\ 2FW +DOORZHHQ -DQ 0/.'D\ -XO ,QGHSHQGHQFH'D\ 1RY 9HWHUDQV'D\ )HE 3UHVLGHQWV 'D\ 6HS /DERU'D\ 1RY 7KDQNVJLYLQJ'D\ 0DU (DVWHU6XQGD\ 2FW &ROXPEXV'D\ 'HF &KULVWPDV'D\ Schedules Summary %DVHOLQH +9$&2Q+UV<U 3URSRVHG +9$&2Q+UV<U 7RWDOV 6FKHGXOH& 6FKHGXOH 7RWDO+UV<U 7RWDO'D\V<U 6FKHGXOH$ 6FKHGXOH% 6FKHGXOH'HVFULSWLRQ /RDG6FKHGXOH$ /RDG6FKHGXOH% /RDG6FKHGXOH& Page 91 of 107 AGENDA ITEM #5. d) Page 92 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Facility Improvement Measure (FIM) Detail 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3K 'DWH 0DUFK ),0,')DFLOLW\ ),01DPH &&3*8SJUDGH &RQILGHQWLDO 3URSULHWDU\ 5HQWRQ&LW\&HQWHU3DUNLQJ*DUDJH ),0'HVFULSWLRQ 6DYLQJV0HWKRGRORJ\ ([LVWLQJ7KH&LW\&HQWHU3DUNLQJ*DUDJHLVSULPDULO\OLWE\IOXRUHVFHQW7ODPSV 3URYLGH3URYLGHLQWHULRUOLJKWLQJXSJUDGHWR/('/('XSJUDGHVWRLQFOXGH/('ODPSDQGGULYHUUHSODFHPHQWV (OHFWULFDOHQHUJ\VDYLQJVLVFDOFXODWHGE\FRPSDULQJH[LVWLQJOLJKWLQJIL[WXUHZDWWDJHEDOODVWHIILFLHQF\DQGEXUQKRXUVDJDLQVW WKRVHRIWKHSURSRVHGOLJKWLQJIL[WXUHVDQGEDOODVWV2SHUDWLRQDQGPDLQWHQDQFHVDYLQJVLVFDOFXODWHGE\FRPSDULQJWKHRSHUDWLRQDO OLIHDQGIL[WXUHFRVWVRIWKHH[LVWLQJOLJKWLQJIL[WXUHVYHUVXVWKRVHRIWKHSURSRVHGOLJKWLQJIL[WXUHV Page 93 of 107 AGENDA ITEM #5. d) Page 94 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) !" # $ % $ & ' $ # $ % $ & # ( & ' )*+ * ,$ -). ./0'0) './0%' )1 .2/ 3450 !.1 6!,* $ )1 )03 3450 .*+ ,$ -). )-/'0) ')-/%' ) .)0 3450 !3)!,'!)17/68 %.--9 ) )- 3450 4 *+ 6 , -.3 .1!0) 8.1% .5 40 5-10 !30 !,*!!83 %8:);!89 8 )0% .5 )0 5-10 3 *+ ,(% ,$ -). )5!0) 8)5%*! )3 )2 3450 !.0 !,*!!83 %8:);!89 8 -% )3 - 3450 /*+ ,(, , -). .1!0. 8.1% ./ 10 3450 !)5 !,*!!83 %8:.;! 8'< 8)1% ./ )1 3450 1 *+ *+ -.3 3.!04 6= 83.% , 8 41 )4. 5-10 !/.6!,$ 41 3. 5-10 -*+ *+ 6(& > ,(=$ -.3 3.!04 6= 83.% , 8 41 )4. 5-10 !/)6!,$6= 41 3. 41 07/0 3450 5 *+& *+ & ,( $ -). 3.!04 6= 83.% , 8 -- )4. 3450 !/)6!,$6= -- 3. -- 07/0 .)20 2 *+,$ '6 -.3 !,,? ,$!,,$!,( )- 4 5-10 * )- 4 5-10 )0 *+!) /). )5!0) * + 8)5% *! 4 )2 4).2 !.-!,)2!81%8 6 4 1 4).2 ))*+ +" , /). 4. 50., 3@4.% 83@>0A 5 , 8 5 5 /2 4).2 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; 5 .5 &:% 6 =; 4 07./ .431 ).*+,( ,( , -.3 4. 50., 4.% 83@>0A 5 , 8 5 ) /2 5-10 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; ) .5 &:% 6 =; ) 07./ 1/-0 )4 *+= -.3 4. 504, 3@ %4.% 83@>0A 5 , 8 5 . 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; . 3. &:% 6 =; ) 07./ 1/-0 )3 *+* " /). 4. 50., 3@4.% 83@>0A 5 , 8 5 . /2 4).2 !. 3@!, 5!(B8:.; 6=:);.> (8.5%: ; . .5 &:% 6 =; ) 07./ .431 )/*+* " -.3 4. 504, 4.% 83@>0A 5, 8 5 .2 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; .2 3. & :; 3 07./ 1/-0 )1 *+* " & -.3 4. 504, 4.% 83@>0A 5, 8 5 3 51 5-10 !4 3@!, 5!(B8:4; 6=:);4> (83.%: ; 3 3. &:% 6 =; ) 07./ 1/-0 )-*+.,( ,( , -.3 /0)1 '8)1 ). /0 5-10 !.5 !,)18-68* ). - 5-10 )5 *+,$, , , -). /0)1 '8)1./ /0 3450 !.5 !,)18-68* ./ - 3450 )2 *+,$, , , -). )-/'0) ')-/%' .- .)0 3450 !35 6!,&%* + .- /0 3450 .0 0 00 00 0 &, !*&*, C 4)0.0.0Page 95 of 107 AGENDA ITEM #5. d) Page 96 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ϱ͘ϰ&/D^KE^/ZhdEKdh^ dŚĞĨŽůůŽǁŝŶŐ&/DƐǁĞƌĞĐŽŶƐŝĚĞƌĞĚďƵƚŶŽƚĐŚŽƐĞŶĨŽƌƚŚŝƐƉŚĂƐĞ͘dŚĞŵĞĂƐƵƌĞƐďĞůŽǁĂƌĞƌĞĐŽŵŵĞŶĚĞĚĨŽƌ ĨƵƌƚŚĞƌĐŽŶƐŝĚĞƌĂƚŝŽŶŝŶƚŚĞĨƵƚƵƌĞ͘ Ϭϭ͘ϬϭͲZ,͗hW'ZK/>Z^͕ZEdKE/dz,>> dŚŝƐŵĞĂƐƵƌĞǁĂƐƌĞƉůĂĐĞĚďǇ&/DϬϭ͘ϯϬϭͲZ,͘dŚŝƐŵĞĂƐƵƌĞǁŽƵůĚŚĂǀĞƵƉŐƌĂĚĞĚŽŶůǇƚŚĞ,,t ďŽŝůĞƌƐǁŝƚŚŚŝŐŚͲĞĨĨŝĐŝĞŶĐǇĐŽŶĚĞŶƐŝŶŐďŽŝůĞƌƐĂŶĚƌĞƵƐĞĚƚŚĞĞǆŝƐƚŝŶŐƐǇƐƚĞŵĂŶĚƐǇƐƚĞŵƉƵŵƉƐ͘ ϬϮ͘ϬϭͲZ͗hW'Z/ZͲKK>,/>>Z͕ZEdKEKDDhE/dzEdZ ǆŝƐƚŝŶŐ͗dŚĞĞǆŝƐƚŝŶŐDĐYƵĂǇĂŝƌͲĐŽŽůĞĚĐŚŝůůĞƌǁĂƐŝŶƐƚĂůůĞĚŝŶϭϵϵϭĂŶĚŝƐĂƚƚŚĞĞŶĚŽĨŝƚƐƵƐĞĨƵů ƐĞƌǀŝĐĞůŝĨĞ͘dŚĞĞǆŝƐƚŝŶŐĐŚŝůůĞĚǁĂƚĞƌƐǇƐƚĞŵŝƐƐĞƌǀĞĚďǇĂĐŽŶƐƚĂŶƚǀŽůƵŵĞϯ,WĐŚŝůůĞĚǁĂƚĞƌ ƉƵŵƉ͘ WƌŽƉŽƐĞĚ͗hƉŐƌĂĚĞƚŚĞĐŚŝůůĞƌƚŽĂƌŝŐŚƚͲƐŝǌĞĚŚŝŐŚͲĞĨĨŝĐŝĞŶĐǇŵŽĚĞů͘hƉŐƌĂĚĞƚŚĞĐŚŝůůĞĚǁĂƚĞƌ ƐǇƐƚĞŵƉƵŵƉĂŶĚƉƌŽǀŝĚĞĂs&ĨŽƌďĂůĂŶĐŝŶŐĂŶĚĞŶĞƌŐǇĞĨĨŝĐŝĞŶĐǇ͘ dŚŝƐŵĞĂƐƵƌĞǁĂƐŶŽƚƐĞůĞĐƚĞĚĂƚƚŚŝƐƚŝŵĞďǇƚŚĞŽǁŶĞƌ͘tĞƌĞĐŽŵŵĞŶĚƚŚŝƐŵĞĂƐƵƌĞďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂůĂƚĞƌƉŚĂƐĞ͘ Ϭϯ͘ϬϭͲD'͗hW'ZhE/d^͕DW>tKK'K>&KhZ^ /ŶǀĞƐƚŝŐĂƚĞƵƉŐƌĂĚŝŶŐƚŚĞĂŝƌĐŽŶĚŝƚŝŽŶŝŶŐƵŶŝƚƐƚŚĂƚĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Ϭϯ͘ϬϭͲZ͗hW'Z/Z,E>Z^͕ZEdKEKDDhE/dzEdZ ǆŝƐƚŝŶŐ͗dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐƐĞƌǀĞĚďǇ;ϭϳͿŝƌ,ĂŶĚůŝŶŐhŶŝƚƐ;,hƐͿ͘dŚĞ,hƐĂƌĞ ůŽĐĂƚĞĚƚŚƌŽƵŐŚŽƵƚƚŚĞďƵŝůĚŝŶŐŝŶŵƵůƚŝƉůĞŵĞĐŚĂŶŝĐĂůĂƚƚŝĐƐ͘dŚĞ,hƐĂƌĞŽƌŝŐŝŶĂůƚŽƚŚĞďƵŝůĚŝŶŐ ĂŶĚĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌƵƐĞĨƵůůŝĨĞ͘ WƌŽƉŽƐĞĚ͗WƌŽǀŝĚĞ,hƌĞĨƵƌďŝƐŚŵĞŶƚĚƵĞƚŽůŝŵŝƚĞĚĂĐĐĞƐƐƚŽƚŚĞŵĞĐŚĂŶŝĐĂůĂƚƚŝĐƐ͘,h ƌĞĨƵƌďŝƐŚŵĞŶƚƚŽŝŶĐůƵĚĞĐůĞĂŶŝŶŐ͕ŶĞǁŚŝŐŚĞĨĨŝĐŝĞŶĐǇŵŽƚŽƌƐ͕ŶĞǁďĞĂƌŝŶŐƐĨŽƌĨĂŶƐŚĂĨƚƐ͕ĂŶĚŶĞǁ ĞůĞĐƚƌŝĐŚĞĂƚĞƌƐ͘ZĞĨƵƌďŝƐŚĞĚ,hƐƚŽŝŶĐůƵĚĞWƌĞƐƐƵƌĞ/ŶĚĞƉĞŶĚĞŶƚŽŶƚƌŽůsĂůǀĞƐ;W/sƐͿǁŚŝĐŚǁŝůů ŝŵƉƌŽǀĞƚŚĞĞŶĞƌŐǇĞĨĨŝĐŝĞŶĐǇŽĨƚŚĞƐǇƐƚĞŵ dŚŝƐŵĞĂƐƵƌĞǁĂƐŶŽƚƐĞůĞĐƚĞĚĂƚƚŚŝƐƚŝŵĞďǇƚŚĞŽǁŶĞƌ͘tĞƌĞĐŽŵŵĞŶĚƚŚŝƐŵĞĂƐƵƌĞďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂůĂƚĞƌƉŚĂƐĞ͘ Ϭϯ͘ϬϮͲZ,͗hW'Z,dWhDW^͕ZEdKE/dz,>> dŚĞďƵŝůĚŝŶŐǁĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉƐ;t^,WΖƐͿĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌƵƐĞĨƵůƐĞƌǀŝĐĞůŝĨĞ͘hƉŐƌĂĚĞ ƚŚĞt^,WΖƐǁŝƚŚŚŝŐŚͲĞĨĨŝĐŝĞŶĐǇŵŽĚĞůƐ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Ϭϯ͘ϬϯͲZ,͗hW'ZssKy^͕ZEdKE/dz,>> /ŶǀĞƐƚŝŐĂƚĞƵƉŐƌĂĚŝŶŐŽƌƌĞƉůĂĐŝŶŐƚŚĞǀĂƌŝĂďůĞĂŝƌǀŽůƵŵĞ;ssͿƚĞƌŵŝŶĂůƐ͘ŽŶƐŝĚĞƌĐŽŶǀĞƌƚŝŶŐƚŽ ǁĂƚĞƌƐŽƵƌĐĞŚĞĂƚƉƵŵƉƐǁŝƚŚĚĞĚŝĐĂƚĞĚŽƵƚƐŝĚĞĂŝƌŽƌƌĞƉůĂĐŝŶŐǁŝƚŚŚŝŐŚͲƉĞƌĨŽƌŵĂŶĐĞss ƚĞƌŵŝŶĂůƐ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Page 97 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ Ϭϵ͘ϬϭͲD'͗hW'Z/EdZ/KZ>/',d/E'dK>͕DW>tKK'K>&KhZ^ hƉŐƌĂĚĞŝŶƚĞƌŝŽƌůŝŐŚƚŝŶŐƚŽ>͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Ϭϵ͘ϬϭͲZ͗hW'Z>/',d/E'dK>͕ZEdKEKDDhE/dzEdZ ǆŝƐƚŝŶŐ͗dŚĞZĞŶƚŽŶŽŵŵƵŶŝƚǇĞŶƚĞƌŝƐƉƌŝŵĂƌŝůǇůŝƚďǇĨůƵŽƌĞƐĐĞŶƚdϴůĂŵƉƐ͘ WƌŽǀŝĚĞ͗WƌŽǀŝĚĞŝŶƚĞƌŝŽƌůŝŐŚƚŝŶŐƵƉŐƌĂĚĞƚŽ>͘>ƵƉŐƌĂĚĞƐƚŽŝŶĐůƵĚĞ>ůĂŵƉĂŶĚĚƌŝǀĞƌ ƌĞƉůĂĐĞŵĞŶƚƐ͘ dŚŝƐŵĞĂƐƵƌĞǁĂƐŶŽƚƐĞůĞĐƚĞĚĂƚƚŚŝƐƚŝŵĞďǇƚŚĞŽǁŶĞƌ͘tĞƌĞĐŽŵŵĞŶĚƚŚŝƐŵĞĂƐƵƌĞďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂůĂƚĞƌƉŚĂƐĞ͘ Ϭϵ͘ϬϭͲZ,͗hW'Z>/',d/E'dK>͕ZEdKE/dz,>> ǆŝƐƚŝŶŐ͗/ŶƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐƉƌĞƐĞŶƚůǇĂŵŝǆŽĨĨůƵŽƌĞƐĐĞŶƚůĂŵƉƐ͘DŽƐƚŽĨĨŝĐĞůŝŐŚƚŝŶŐŝƐƉƌŽǀŝĚĞĚďǇ ϯϮͲǁĂƚƚdͲϴůĂŵƉƐǁŝƚŚĞůĞĐƚƌŽŶŝĐďĂůůĂƐƚƐŝŶϮ͛ǆϰ͛ĨŝǆƚƵƌĞƐ͘dŚĞϳƚŚĨůŽŽƌĐŽŶĨĞƌĞŶĐĞƌŽŽŵƐŚĂǀĞϭϳͲ ǁĂƚƚdͲϴůĂŵƉƐǁŝƚŚĞůĞĐƚƌŽŶŝĐďĂůůĂƐƚƐŝŶϮ͛ǆϮ͛ĨŝǆƚƵƌĞƐ͘&ŝǆƚƵƌĞƐŝŶĂŶůĞĐƚƌŝĐĂůZŽŽŵ͕ZĞƐƚZŽŽŵƐ ĂŶĚůŝŵŝƚĞĚϮŶĚĂŶĚϱƚŚĨůŽŽƌŽĨĨŝĐĞƐƐƚŝůůŚĂǀĞϰϬͲǁĂƚƚdͲϭϮůĂŵƉƐǁŝƚŚŵĂŐŶĞƚŝĐďĂůůĂƐƚƐ͘,ĂůůǁĂǇƐ͕ ůĞǀĂƚŽƌ>ŽďďŝĞƐ͕ZĞƐƚZŽŽŵƐ͕ŽŶĨĞƌĞŶĐĞZŽŽŵĂŶĚŽƚŚĞƌĐŽŵŵŽŶĂƌĞĂƐŚĂǀĞĂŵŝǆŽĨϭϴƚŽϰϮͲ ǁĂƚƚĐŽŵƉĂĐƚĨůƵŽƌĞƐĐĞŶƚůĂŵƉƐǁŝƚŚŵŽƐƚůǇϰͲƉŝŶƐŽĐŬĞƚƐ͘;ϯϰͿϮ͛ǆϮ͛ĨŝǆƚƵƌĞƐŚĂǀĞϯϮͲǁĂƚƚ ĨůƵŽƌĞƐĐĞŶƚdͲϴůĂŵƉƐǁŝƚŚĞůĞĐƚƌŽŶŝĐďĂůůĂƐƚƐ͘ǆŝƚƐŝŐŶƐĂƌĞŝŶĐĂŶĚĞƐĐĞŶƚdͲůĂŵƉƐ͘ĨĞǁϳƚŚĨůŽŽƌ ƐƉĂĐĞƐŚĂǀĞŝŶĐĂŶĚĞƐĐĞŶƚƉĂƌĂďŽůŝĐĂůƵŵŝŶŝǌĞĚƌĞĨůĞĐƚŽƌ;WZͿůĂŵƉƐ͘ϭϱϵĨŝǆƚƵƌĞƐŚĂǀĞĂůƌĞĂĚǇďĞĞŶ ĐŽŶǀĞƌƚĞĚƚŽ>ĂŶĚĚŽŶŽƚƌĞƋƵŝƌĞĐŽŶǀĞƌƐŝŽŶ͘ǆƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐĂŵŝǆŽĨϳϬƚŽϭϳϱͲǁĂƚƚŚŝŐŚ ŝŶƚĞŶƐŝƚǇĚŝƐĐŚĂƌŐĞ;,/ͿŵĂŐŶĞƚŝĐďĂůůĂƐƚůĂŵƉƐ͘^ĞĞƚŚĞĚĞƚĂŝůĞĚůŝŐŚƚŝŶŐĂƵĚŝƚĨŽƌĨŝǆƚƵƌĞĐŽƵŶƚƐĂŶĚ ĚĞƚĂŝůƐ͘ WƌŽƉŽƐĞĚ͗ZĞͲƵƐĞĞǆŝƐƚŝŶŐůŝŐŚƚŝŶŐĐŽŶƚƌŽůƐ͘WƌŽǀŝĚĞ;ϰϬͿǁĂůůƐǁŝƚĐŚŽĐĐƵƉĂŶĐǇƐĞŶƐŽƌƐŝŶĐŽŶĨĞƌĞŶĐĞ͕ ŬŝƚĐŚĞŶĂŶĚƐŵĂůůƌŽŽŵƐ͘ZĞƚƌŽĨŝƚϮ͛ǆϮ͛hͲďĞŶĚůĂŵƉƐƚŽĂϮϱͲǁĂƚƚůĞŶƐĞĚƌĞƚƌŽĨŝƚŬŝƚǁŝƚŚĚŝƌĞĐƚ ǁŝƌŝŶŐ͘hƉŐƌĂĚĞdͲϴůŝŐŚƚŝŶŐƚŽ>dͲϴůĂŵƉƐ͕ŝŶĐůƵĚŝŶŐůĂŵƉĂŶĚĚƌŝǀĞƌƵƉŐƌĂĚĞƐ͘ZĞƉůĂĐĞŶŽŶͲ> WZůĂŵƉƐǁŝƚŚϭϯͲǁĂƚƚ>͛Ɛ͘ZĞƉůĂĐĞĞǆŝƚƐŝŐŶƐǁŝƚŚϮͲǁĂƚƚ>ĞǆŝƚƐŝŐŶƐ͘ZĞƚƌŽĨŝƚĞǆƚĞƌŝŽƌĨŝǆƚƵƌĞƐ ǁŝƚŚ>,/ƌĞƚƌŽĨŝƚůĂŵƉƐ͘ dŚŝƐŵĞĂƐƵƌĞǁĂƐŶŽƚƐĞůĞĐƚĞĚĂƚƚŚŝƐƚŝŵĞďǇƚŚĞŽǁŶĞƌ͘tĞƌĞĐŽŵŵĞŶĚƚŚŝƐŵĞĂƐƵƌĞďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂůĂƚĞƌƉŚĂƐĞ͘ Ϭϵ͘ϬϮͲD'͗hW'ZydZ/KZ>/',d/E'dK>͕DW>tKK'K>&KhZ^ hƉŐƌĂĚĞĞǆƚĞƌŝŽƌůŝŐŚƚŝŶŐƚŽ>͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Ϭϵ͘ϬϮͲZ,͗hW'ZydZ/KZ>/',d/E'dK>͕ZEdKE/dz,>> hƉŐƌĂĚĞĞǆƚĞƌŝŽƌůŝŐŚƚŝŶŐƚŽ>͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϭ͘ϬϭͲZ͗hW'ZZzdZE^&KZDZ^͕ZEdKEKDDhE/dzEdZ hƉŐƌĂĚĞƚŚĞĚƌǇƚƌĂŶƐĨŽƌŵĞƌƐƚŽŝŵƉƌŽǀĞĞůĞĐƚƌŝĐĂůƐǇƐƚĞŵĞĨĨŝĐŝĞŶĐǇĂŶĚƌĞĚƵĐĞĐŽŽůŝŶŐůŽĂĚƐŝŶƚŚĞ ĞůĞĐƚƌŝĐĂůƌŽŽŵƐ͘ Page 98 of 107 AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϭ͘ϬϭͲZ,͗hW'ZZzdZE^&KZDZ^͕ZEdKE/dz,>> hƉŐƌĂĚĞƚŚĞƚĞŶ;ϭϬͿĚƌǇƚƌĂŶƐĨŽƌŵĞƌƐƚŽŝŵƉƌŽǀĞĞůĞĐƚƌŝĐĂůƐǇƐƚĞŵĞĨĨŝĐŝĞŶĐǇĂŶĚƌĞĚƵĐĞĐŽŽůŝŶŐ ůŽĂĚƐŝŶƚŚĞĞůĞĐƚƌŝĐĂůƌŽŽŵƐ;ĞŝŐŚƚ;ϴͿϰϱŬsĂŶĚƚǁŽ;ϮͿϳϱŬsƚƌĂŶƐĨŽƌŵĞƌƐͿ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϮ͘ϬϭͲW'͗tdZKE^Zsd/KE͕ZEdKE/dzEdZWZ</E''Z' WƌŽǀŝĚĞůŽǁͲĨůŽǁĂĞƌĂƚŽƌƐĨŽƌůĂǀĂƚŽƌŝĞƐ͘ĂůĂŶĐĞĨůŽǁŽƌƵƉŐƌĂĚĞĨůƵƐŚŽŵĞƚĞƌƐĨŽƌƵƌŝŶĂůƐĂŶĚǁĂƚĞƌ ĐůŽƐĞƚƐ;ďĂƐŝƐŽĨĚĞƐŝŐŶŝƐ,ǇĚƌĂDĞƚƌŝĐƐĨŝǆƚƵƌĞĨůŽǁĂĚũƵƐƚŵĞŶƚƐͿ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϮ͘ϬϭͲD'͗tdZKE^Zsd/KE͕DW>tKK'K>&KhZ^ WƌŽǀŝĚĞůŽǁͲĨůŽǁĂĞƌĂƚŽƌƐĨŽƌůĂǀĂƚŽƌŝĞƐ͘ĂůĂŶĐĞĨůŽǁŽƌƵƉŐƌĂĚĞĨůƵƐŚŽŵĞƚĞƌƐĨŽƌƵƌŝŶĂůƐĂŶĚǁĂƚĞƌ ĐůŽƐĞƚƐ;ďĂƐŝƐŽĨĚĞƐŝŐŶŝƐ,ǇĚƌĂDĞƚƌŝĐƐĨŝǆƚƵƌĞĨůŽǁĂĚũƵƐƚŵĞŶƚƐͿ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϮ͘ϬϭͲZ͗hW'Z,t,dZ^͕ZEdKEKDDhE/dzEdZ dŚĞϭϬϬĂŶĚϱϬͲŐĂůůŽŶĚŽŵĞƐƚŝĐŚŽƚǁĂƚĞƌ;,tͿŚĞĂƚĞƌƐĂƌĞĂƚƚŚĞĞŶĚŽĨƚŚĞŝƌƐĞƌǀŝĐĞůŝĨĞ͘hƉŐƌĂĚĞ ƚŚĞƚǁŽt,ΖƐƚŽŚŝŐŚĞĨĨŝĐŝĞŶĐǇ͕ĐŽŶĚĞŶƐŝŶŐŵŽĚĞůƐ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϮ͘ϬϭͲZ͗tdZKE^Zsd/KE͕ZEdKEKDDhE/dzEdZ WƌŽǀŝĚĞůŽǁͲĨůŽǁĂĞƌĂƚŽƌƐĨŽƌůĂǀĂƚŽƌŝĞƐ͘ĂůĂŶĐĞĨůŽǁŽƌƵƉŐƌĂĚĞĨůƵƐŚŽŵĞƚĞƌƐĨŽƌƵƌŝŶĂůƐĂŶĚǁĂƚĞƌ ĐůŽƐĞƚƐ;ďĂƐŝƐŽĨĚĞƐŝŐŶŝƐ,ǇĚƌĂDĞƚƌŝĐƐĨŝǆƚƵƌĞĨůŽǁĂĚũƵƐƚŵĞŶƚƐͿ͘ dŚŝƐŵĞĂƐƵƌĞǁĂƐŶŽƚƐĞůĞĐƚĞĚĂƚƚŚŝƐƚŝŵĞďǇƚŚĞŽǁŶĞƌ͘tĞƌĞĐŽŵŵĞŶĚƚŚŝƐŵĞĂƐƵƌĞďĞ ĐŽŶƐŝĚĞƌĞĚĂƚĂůĂƚĞƌƉŚĂƐĞ͘ ϭϮ͘ϬϭͲZ,͗tdZKE^Zsd/KE͕ZEdKE/dz,>> WƌŽǀŝĚĞůŽǁͲĨůŽǁĂĞƌĂƚŽƌƐĨŽƌůĂǀĂƚŽƌŝĞƐ͘ĂůĂŶĐĞĨůŽǁŽƌƵƉŐƌĂĚĞĨůƵƐŚŽŵĞƚĞƌƐĨŽƌƵƌŝŶĂůƐĂŶĚǁĂƚĞƌ ĐůŽƐĞƚƐ;ďĂƐŝƐŽĨĚĞƐŝŐŶŝƐ,ǇĚƌĂDĞƚƌŝĐƐĨŝǆƚƵƌĞĨůŽǁĂĚũƵƐƚŵĞŶƚƐͿ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ ϭϯ͘ϬϭͲZ,͗hW'ZZKK&/E'/E^h>d/KE͕ZEdKE/dz,>> dŚĞŝƚǇ,ĂůůƌŽŽĨŚĂƐĂŶĞƐƚŝŵĂƚĞĚƌĞŵĂŝŶŝŶŐůŝĨĞŽĨϱǇĞĂƌƐ͘hƉŐƌĂĚĞƚŚĞŝŶƐƵůĂƚŝŽŶƚŽŝŵƉƌŽǀĞ ĞŶǀĞůŽƉĞƚŚĞƌŵĂůĞĨĨŝĐŝĞŶĐǇĚƵƌŝŶŐƌĞƉůĂĐĞŵĞŶƚŽĨƚŚĞƌŽŽĨŵĞŵďƌĂŶĞ͘ dŚŝƐŵĞĂƐƵƌĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŝŐĂƚŝŽŶ͘ Page 99 of 107 AGENDA ITEM #5. d) Page 100 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) KE&/Ed/>ΘWZKWZ/dZz /ŶǀĞƐƚŵĞŶƚ'ƌĂĚĞƵĚŝƚ ϱ͘ϱhd/>/dzd Page 101 of 107 AGENDA ITEM #5. d) Page 102 of 107 THIS PAGE LEFT INTENTIONALLY BLANK AGENDA ITEM #5. d) Before and After Energy Utilization Index (EUI) Analysis 3URMHFW &LW\RI5HQWRQ 6FHQDULR 5HQWRQ3K 'DWH $SULO ([LVWLQJ7RWDO 3URSRVHG7RWDO 3URSRVHG6DYLQJV([LVWLQJN%WX 3URSRVHGN%WX ([LVWLQJ(8, 3URSRVHG(8, %XLOGLQJ 6T)W (OHFWULF >N:K@ *DV >7KHUPV@ 7RWDO(QHUJ\ &RVW (OHFWULF >N:K@ *DV >7KHUPV@ (OHFWULF >N:K@ *DV >7KHUP@ (OHFWULF >N%WX@ *DV>N%WX@ (OHFWULF >N%WX@ *DV>N%WX@ (OHFWULF (8,*DV(8,7RWDO (8, (OHFWULF (8,*DV(8,7RWDO (8, 6DYLQJV 5HQWRQ&LW\&HQWHU3DUNLQJ*DUDJH 5HQWRQ&LW\+DOO Page 103 of 107 AGENDA ITEM #5. d) City of Renton Environmental Impact Calculator 1RQ%DVHORDG /RDG)DFWRUWR8VH 1:33 6HOHFWH*5,'6XEUHJLRQ OEV&2HN:KH*5,'6XEUHJLRQ(OHFWULFLW\(PLVVLRQV)DFWRU $PRXQW(DFK8WLOLW\7\SH:LOO%H5HGXFHG3HU<HDU (OHFWULFLW\ N:K OEV&20HWULF7RQQHV&2 1DWXUDO*DV 1XPEHURI9HKLFOHV5HPRYHG)URP5RDGV$YJ6L]HRU 7KHUPV OEV&20HWULF7RQQHV&21XPEHURI0LOHV1RW'ULYHQ3HU<HDU$YJ6L]HRU 6WHDP 1XPEHURI:DWW/LJKWEXOEV1RW(QHUJL]HGRU 0OEV OEV&20HWULF7RQQHV&21XPEHURI$YJ6L]HG+RXVHV5HPRYHG)URP3RZHU*ULGRU )XHO2LO $FUHVRI7UHHV3ODQWHGRU *DOORQV OEV&20HWULF7RQQHV&23RXQGVRI&RDO1RW%XUQHG3HU<HDU 3URSDQH *DOORQV OEV&20HWULF7RQQHV&2 7RWDO5HGXFWLRQ OEV&20HWULF7RQQHV&2 1DWXUDO*DVOEV&27KHUP 6WHDPOEV&20OEV6HDWWOH6WHDP )XHO2LOOEV&2JDO 3URSDQHOEV&2JDO &RQYHUVLRQOEV&20HWULF7RQQHV&2 &DU(PPLVVLRQVOEV&2FDU\U 7UHH&DUERQ6HTXHVWDWLRQOEV&2DFUH\U 9HKLFOH0LOHDJH(PPLVVLRQVOEV&2PLOH :/LJKW%XOE(PPLVVLRQVOEV&2/LJKW%XOE\U 7UHH&DUERQ6HTXHVWDWLRQOEV&2DFUH\U &RDO(PPLVLRQVOEV&2SRXQG&RDO +RXVHV5HPRYHGOEV&2KRXVH (QHUJ\,QIRUPDWLRQ$JHQF\(,$ (QYLURQPHQWDO3URWHFWLRQ$JHQF\(3$ (1(5*<67$5 H*5,' 7KLV$QQXDO(PLVVLRQV5HGXFWLRQ,V(TXLYDOHQW7R7KH)ROORZLQJ 2WKHU(PLVVLRQV)DFWRUV (TXLYDOHQWV&RQYHUVLRQV 6RXUFHV Page 104 of 107 AGENDA ITEM #5. d) Utility Data Analysis &21),'(17,$/ 35235,(7$5< &LW\RI5HQWRQ&255HQWRQ&RPPXQLW\&HQWHU$QDO\VLV $1$/<6,66800$5< 0F.LQVWU\KDVJDWKHUHGHQHUJ\XVHEHQFKPDUNGDWDLQRUGHUWRFRPSDUH&LW\RI5HQWRQ&RPPXQLW\&HQWHU¶VHQHUJ\XVH ZLWKVLPLODUIDFLOLWLHV(QHUJ\8VH,QWHQVLW\UHIHUVWRWKHWRWDODQQXDOHQHUJ\XVHIRUDIDFLOLW\GLYLGHGE\WKHIDFLOLW\ V VTXDUHIRRWDJH%\QRUPDOL]LQJHQHUJ\XVHE\VTXDUHIRRWDJHZHDUHDEOHWRFRPSDUH&LW\RI5HQWRQ&RPPXQLW\ &HQWHU¶VHQHUJ\ZLWKVLPLODUIDFLOLWLHV 0217+/<87,/,7<'$7$352),/(6 7KHILJXUHDERYHVKRZVWKHEXLOGLQJ¶VFKURQRORJLFDOHOHFWULFSURILOHIURP-DQXDU\WKURXJK)HEUXDU\7KHHOHFWULFXVHDW 5HQWRQ&RPPXQLW\&HQWHULQFUHDVHGVLJQLILFDQWO\LQ-DQXDU\7KLVFRXOGEHWRFKDQJHVLQEXLOGLQJRSHUDWLRQGXULQJWKRVHPRQWKV RUIDLOHGHTXLSPHQW(OHFWULFFRQVXPSWLRQUHWXUQHGWRDYHUDJHYDOXHVIROORZLQJWKRVHPRQWKV 7KHILJXUHVEHORZVKRZWKHQDWXUDOJDVSURILOHIURP-DQXDU\WKURXJK)HEUXDU\7KHQDWXUDOJDVXVHLVVOLJKWO\GHSHQGHQWRQ WKHRXWVLGHDLUWHPSHUDWXUH7KLVFDQEHVHHQE\FRPSDULQJWKHLQFUHDVHLQFRQVXPSWLRQZLWKWKHLQFUHDVHLQKHDWLQJGHJUHHGD\VEDVH Σ) (OHFWULFLW\8VH N:K (OHFWULFLW\&RVW N:K\U 1DWXUDO*DV8VH WKHUPV 1DWXUDO*DV&RVW WKHUP\U &2H(PLVVLRQV PHWULFWRQV\U 7RWDO&RVW \U 7RWDO(QHUJ\8VH N%WX 6TXDUH)RRWDJH VI (OHFWULFLW\8VH,QWHQVLW\ N%WXVI\U (OHFWULFLW\&RVW,QWHQVLW\ VI\U 1DWXUDO*DV8VH,QWHQVLW\ N%WXVI\U 1DWXUDO*DV&RVW,QWHQVLW\ VI\U (QHUJ\8VH,QWHQVLW\ N%WXVI\U (QHUJ\&RVW,QWHQVLW\ VI\U 6WDUW'DWH (QG'DWH %DVHOLQH3HUIRUPDQFH 3HULRG (QHUJ\8VH0HWULFV (QHUJ\ &RVW N%WXVI\U N%WXVI\U N%WXVI\U N%WXVI\U 1DWLRQDO0HGLDQ %HWWHU7KDQ0HGLDQ %HWWHU7KDQ0HGLDQ ,QVLJKWV 7KHSURSHUW\W\SHRIWKH5HQWRQ&RPPXQLW\&HQWHULVQRW HOLJLEOHIRUDQ(1(5*<67$5VFRUH,QWKLVDQDO\VLVZHKDYH FRPSDUHGWKH&RPPXQLW\&HQWHU VHQHUJ\XVDJHWREXLOGLQJ V RIVLPLODUSURSHUW\W\SHDQGVL]HXVLQJ(1(5*<67$5 V GDWDEDVH,QWKLVFDVHWKH&RPPXQLW\&HQWHULVDSRRU SHUIRUPHUSHUIRUPLQJZRUVHWKDQWKHQDWLRQDOPHGLDQ 5HQWRQ&RPPXQLW\&HQWHU(1(5*<67$5'DWDEDVH%HQFKPDUN 5HQWRQ&RPPXQLW\&HQWHU Page 105 of 107 AGENDA ITEM #5. d) Utility Data Analysis &21),'(17,$/ 35235,(7$5< &LW\RI5HQWRQ&25&LW\&HQWHU3DUNLQJ*DUDJH $QDO\VLV $1$/<6,66800$5< 0F.LQVWU\KDVJDWKHUHGHQHUJ\XVHEHQFKPDUNGDWDLQRUGHUWRFRPSDUH&LW\RI5HQWRQ&LW\&HQWHU3DUNLQJ*DUDJH¶V HQHUJ\XVHZLWKVLPLODUIDFLOLWLHV(QHUJ\8VH,QWHQVLW\UHIHUVWRWKHWRWDODQQXDOHQHUJ\XVHIRUDIDFLOLW\GLYLGHGE\WKH IDFLOLW\ VVTXDUHIRRWDJH%\QRUPDOL]LQJHQHUJ\XVHE\VTXDUHIRRWDJHZHDUHDEOHWRFRPSDUH&LW\RI5HQWRQ&LW\ &HQWHU3DUNLQJ*DUDJH¶VHQHUJ\ZLWKVLPLODUIDFLOLWLHV 5HQWRQ&LW\&HQWHU3DUNLQJ*DUDJH0RQWKO\(OHFWULF3URILOH N:K -DQ )HE 0DU1$ $SU1$ 0D\1$ -XQ -XO $XJ 6HS 2FW 1RY 'HF 7RWDO1$ 0217+/<87,/,7<'$7$352),/(6 7KHILJXUHDERYHVKRZVWKHEXLOGLQJ¶VFKURQRORJLFDOHOHFWULFSURILOHIURP-DQXDU\WKURXJK)HEUXDU\7KHSULPDU\HOHFWULFORDG DWWKH5HQWRQ&LW\3DUNLQJ*DUDJHLVOLJKWLQJ7KHHOHFWULFXVHLQFUHDVHGXULQJWKHZLQWHUPRQWKVVOLJKWO\OLNHO\GXHWRLQFUHDVHGOLJKWLQJ UXQKRXUVDVGD\OLJKWGHFUHDVHV (OHFWULFLW\8VH N:K (OHFWULFLW\&RVW N:K\U &2H(PLVVLRQV PHWULFWRQV\U 7RWDO&RVW \U 7RWDO(QHUJ\8VH N%WX 6TXDUH)RRWDJH VI 6WDUW'DWH (QG'DWH %DVHOLQH3HUIRUPDQFH 3HULRG (QHUJ\ &RVW Page 106 of 107 AGENDA ITEM #5. d) Utility Data Analysis &21),'(17,$/ 35235,(7$5< &LW\RI5HQWRQ&255HQWRQ&LW\+DOO$QDO\VLV $1$/<6,66800$5< 0F.LQVWU\KDVJDWKHUHGHQHUJ\XVHEHQFKPDUNGDWDLQRUGHUWRFRPSDUH&LW\RI5HQWRQ&LW\+DOO¶VHQHUJ\XVHZLWK VLPLODUIDFLOLWLHV(QHUJ\8VH,QWHQVLW\UHIHUVWRWKHWRWDODQQXDOHQHUJ\XVHIRUDIDFLOLW\GLYLGHGE\WKHIDFLOLW\ VVTXDUH IRRWDJH%\QRUPDOL]LQJHQHUJ\XVHE\VTXDUHIRRWDJHZHDUHDEOHWRFRPSDUH&LW\RI5HQWRQ&LW\+DOO¶VHQHUJ\ZLWK VLPLODUIDFLOLWLHV 0217+/<87,/,7<'$7$352),/(6 7KHILJXUHDERYHVKRZVWKHEXLOGLQJ¶VFKURQRORJLFDOHOHFWULFSURILOHIURP-DQXDU\WKURXJK)HEUXDU\7KHHOHFWULFXVHDW 5HQWRQ&LW\+DOOLQFUHDVHGVLJQLILFDQWO\LQ-DQXDU\-XQHDQG-XO\7KLVFRXOGEHWRFKDQJHVLQEXLOGLQJRSHUDWLRQGXULQJ WKRVHPRQWKVRUIDLOHGHTXLSPHQW(OHFWULFFRQVXPSWLRQUHWXUQHGWRDYHUDJHYDOXHVIROORZLQJWKRVHPRQWKV 7KHILJXUHVEHORZVKRZWKHQDWXUDOJDVSURILOHIURP-DQXDU\WKURXJK)HEUXDU\7KHQDWXUDOJDVXVHLVGHSHQGHQWRQWKH RXWVLGHDLUWHPSHUDWXUH7KLVFDQEHVHHQE\FRPSDULQJWKHLQFUHDVHLQFRQVXPSWLRQZLWKWKHLQFUHDVHLQKHDWLQJGHJUHHGD\VEDVH Σ)6LPLODUWRWKHHOHFWULFFRQVXPSWLRQQDWXUDOJDVXVHLQFUHDVHGLQ-DQXDU\DQGWKHQUHWXUQHGEDFNWRDYHUDJHYDOXHV (OHFWULFLW\8VH N:K (OHFWULFLW\&RVW N:K\U 1DWXUDO*DV8VH WKHUPV 1DWXUDO*DV&RVW WKHUP\U &2H(PLVVLRQV PHWULFWRQV\U 7RWDO&RVW \U 7RWDO(QHUJ\8VH N%WX6TXDUH)RRWDJH VI (OHFWULFLW\8VH,QWHQVLW\ N%WXVI\U (OHFWULFLW\&RVW,QWHQVLW\ VI\U 1DWXUDO*DV8VH,QWHQVLW\ N%WXVI\U 1DWXUDO*DV&RVW,QWHQVLW\ VI\U (QHUJ\8VH,QWHQVLW\ N%WXVI\U (QHUJ\&RVW,QWHQVLW\ VI\U 6WDUW'DWH (QG'DWH (QHUJ\8VH0HWULFV %DVHOLQH3HUIRUPDQFH 3HULRG (QHUJ\ &RVW N%WXVI\U N%WXVI\U N%WXVI\U N%WXVI\U 1DWLRQDO0HGLDQ(66FRUH (1(5*<67$54XDOLILHG 6FRUH %HVWLQ&ODVV(66FRUH ,QVLJKWV $Q(1(5*<67$5VFRUHRILQGLFDWHVWKDWDIDFLOLW\SHUIRUPV EHWWHUWKDQRIVLPLODUIDFLOLWLHV,QWKLVFDVH5HQWRQ&LW\ +DOOLVDSRRUSHUIRUPHUDFKLHYLQJDQ(1(5*<67$5VFRUH ORZHUWKDQ 5HQWRQ&LW\+DOO(1(5*<67$5%HQFKPDUN 5HQWRQ&LW\+DOO Page 107 of 107 AGENDA ITEM #5. d) November 12, 2020 TO: Russ Woodruff, City of Renton FROM: Kim Obi, Contracts Specialist, (360) 407-8273 RE Agreement No. 2018-027 B (2), Amendment No. 2 M&V Agreement No. 2018-027 D (4) Contract No. 2018-027 H (2-1) Renton City Hall Phase 2 IAA No. K4137 McKinstry Essention, LLC SUBJECT: Funding Approval The Dept. of Enterprise Services (DES), Energy Program, requires funding approval for the above referenced contract documents. The amount required is as follows (see page 2 for funding detail): ESCO Audit $ 44,700.00* ESCO Professional Services Total $ 591,535.70 ESCO Measurement and Verification Total $ 14,846.70 ESCO Construction Total $ 1,931,223.60 DES Energy Program Project Management Services Total (IAA) $ 62,500.00 Total Funding $ 2,644,806.00 In accordance with the provisions of RCW 43.88, the signature affixed below certifies to the DES Energy Program that the above identified funds are appropriated, allotted or that funding will be obtained from other sources available to the using client/agency. The using/client agency bears the liability for any issues related to the funding for this project By Name / Title Date Please sign and return this form to E&AS. If you have any questions, please call me. ([KLELW&AGENDA ITEM #5. d) Agreement No. 2018-027 B (2), Amendment No. 2 M&V Agreement No. 2018-027 D (4) Contract No. 2018-027 H (2-1) Funding Approval Detail ESCO Professional Services Energy Audit and Energy Services Proposal $ 44,700.00 *Audit & Energy Services Proposal from Authorization 18-027 B (2) $ (44,700.00) Design and Implementation of Energy Conservation Measures $ 532,787.00 Apprenticeship Incentive $ 909.09 Sales Tax (10.0%) (Includes tax on Audit proposal) $ 57,839.61 Total $ 591,535.70 ESCO Measurement and Verification First Year Measurement & Verification $ 13,497.00 Sales Tax (10.0%) $ 1,349.70 Total $ 14,846.70 ESCO Construction ESCO Contract Amount $ 1,672,922.00 Sales Tax (10.0%) $ 167,292.20 Contingency Amount (with Tax) $ 91,009.40 Total $ 1,931,223.60 DES Energy Program Project Management Services Project Management Fee from IAA No. K4137, Amendment No. 5 $ 62,500.00 Total $ 62,500.00 Note: Items and dollar values shown in a lighter color shade have been approved via previous funding authorizations and are shown for informational purposes only. 2018027Hcontfundrevko AGENDA ITEM #5. d) AB - 2775 City Council Regular Meeting - 14 Dec 2020 SUBJECT/TITLE: Park Avenue North Extension Project Agreements Between the City of Renton and The Boeing Company: Permanent Easement, Temporary Construction Easement and The Boeing Company Compensation Agreement for Cost to Cure RECOMMENDED ACTION: Refer to Committee of the Whole DEPARTMENT: Public Works Transportation Systems Division STAFF CONTACT: Bob Hanson, Transportation Design Manager EXT.: 7223 FISCAL IMPACT SUMMARY: There are three elements of fiscal impacts associated with these Par k Avenue North Extension Project agreements with The Boeing Company: 1. The Permanent Easement establishes that the city will pay to Boeing a fixed base price of $640,000 based on appraised land value. 2. In addition, the Permanent Easement also establish es that the city will compensate Boeing for the cost to cure the following impacts of the Park Avenue North Extension: a. Relocation of a Boeing electrical distribution system. b. Relocation of Boeing’s protected site entrance. c. Closure of Boeing’s existing protected site entrance. The estimate for this cost to cure work is $1,355,481. “The Boeing Company Compensation Agreement for Cost to Cure for Park Avenue North Extension Project” details the invoicing and payment process for the cost to cure work. 3. The Temporary Construction Easement establishes that the city will pay to Boeing a fixed price of $188,546.95 to use the area needed for construction for 12 months. The total compensation to The Boeing Company is estimated at $2,184,027.95. The Park Avenue North Extension Project (317.122190) has a 2020 approved budget of $7,712,602. There is sufficient funding in the approved 2020 project budget for these three agreements. An adjustment to carry forward the 2020 project balance will be included in the upcoming 2021 carry forward budget ordinance. SUMMARY OF ACTION: The purpose of the Park Avenue North Extension Project is to construct improvements to extend Park Avenue North from the existing intersection with Logan Avenue North northward across both Boeing and BNSF property to connect through the Southport site now under construction and out to Lake Washington Boulevard North. AGENDA ITEM #5. e) The subject of the three agreements associated with this agenda item is for the city to acquire public easement rights through Boeing’s parcel number 0886600060, which is situated north of the current north terminus of Park Avenue North. As proposed, the city would acquire a permanent easement containing an area of 13,278 square feet at an appraised cost of $640,000 and, a temporary construction easement containing an area of 62,175 at an additional cost of $188,546.95. The third agreement (“The Boeing Company Compensation Agreement for Cost to Cure”) flows from obligations established in the Permanent Easement. In the Permanent Easement, the city would also compensate Boeing for the following cost to cure elements associated with the Park Avenue North Extension Project: 1. Reconstructing Boeing’s electrical distribution system that currently exists within the Easement Area. 2. Moving Boeing’s existing protected site entrance currently located at Lake Washington Boulevard North to a new location on Logan Avenue North at approximately North 7th Street. 3. Closing and removing the existing protected site entrance. Collectively, these three work items are estimated at a cost of $1,355,481. “The Boeing Company Compensation Agreement for Park Avenue North Extension” would establish the terms and conditions for reimbursing The Boeing Company for these costs. City staff and The Boeing Company representatives have been negotiating these three agr eements for some time now and have reached consensus on the principal terms. The three agreements are presented to the Council in “draft” form in association with this agenda item to avoid delaying the process on this priority project. Final versions of the three agreements will be presented to Council prior to Council action, with an explanation of any final edits made. EXHIBITS: A. Draft Permanent Easement B. Draft Temporary Construction Easement C. Draft The Boeing Company Compensation Agreement for Cost to Cure for Park Avenue North Extension STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to execute the following three agreements (when final) with The Boeing Company related to easement rights necessary for the Park Avenue North Extension Project: 1. Permanent Easement Agreement in the amount of $640,000. 2. Temporary Construction Easement Agreement in the amount of $188,546.95. 3. The Boeing Company Compensation Agreement for Park Avenue North Extension in the estimated amount of $1,355,481. AGENDA ITEM #5. e) Park Ave Permanent Easement Page 1 of 16 After recording return document to: City of Renton City Clerk Renton City Hall 1055 South Grady Way Renton, WA 98057‐3232 Document Title: Permanent Easement Reference Number of Related Document: N/A Grantor(s): The Boeing Company, a Delaware corporation (“Grantor”) Grantee: City of Renton, a noncharter code city under RCW 35A, and a municipal corporation under the laws of the State of Washington (“Grantee”) Abbreviated Legal Description: Ptn Lot 6, Boeing Lakeshore Landing, a Binding Site Plan, Recorded Dec. 23, 2004, King County Recording No. 20041223000856, King County Full Legal Description on page: Exhibit A‐1 Assessor's Tax Parcel Number: 0886600060 PERMANENT EASEMENT For and in consideration of good and valuable consideration, the receipt of which is hereby acknowledged, THE BOEING COMPANY, a Delaware corporation, ("Grantor" herein), hereby grants and conveys to THE CITY OF RENTON, a Washington municipal corporation, and its franchisees and permittees, ("Grantee" herein), for the purposes hereinafter set forth, a non‐exclusive permanent easement (hereinafter “Easement”), over, across, under, and through the real property (“Property”), in King County, Washington, as described in Exhibit A‐1 (Legal Description of the Property), such easement to take up the portion of such Property (“Easement Area”) as is described in Exhibit A‐2 (Legal Description of the Easement Area), depicted on Exhibit A‐3 (Map Exhibit of the Easement Area) and Exhibit B (Supplemental Environmental Terms and Conditions), which such exhibits are attached hereto and incorporated herein by this reference. Grantor represents and warrants that is the owner of the Property. This Easement is granted subject to and conditioned upon the following terms, conditions and covenants, which Grantor and Grantee hereby promise to faithfully and fully observe and perform. DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 2 of 16 1. Purpose. Subject to the limitations set forth in this instrument, this Easement is for public street purposes and constructing and maintaining street improvements over the Easement Area as a segment of an extension project of Park Avenue North, and public and private underground utilities as determined by the Grantee. Grantee, its successors and/or assigns, and their agents or contractors and employees shall have full right to enter at all times upon said premises to survey, construct, repair, remove, replace, reconstruct, inspect, improve and maintain said street improvements and underground utilities. Grantee shall not under any circumstances perform any of the following actions on the Easement Premises: fueling, refueling, maintenance, repair, washing, or other service of any vehicle, equipment, or other item. Nothing in this Easement grants any right to Grantee to perform any of the preceding actions on any other property owned, leased, or controlled by the Grantor. 2. Compensation. 2.1 Base Price, Amount. The base price compensation for this Easement is $640,000 (six hundred forty thousand dollars and zero cents) (“Base Price”). 2.2 Cost to Cure. 2.2.1 Elements. In addition to the Base Price, as a cost to cure, Grantee agrees to pay Grantor (1) the full cost of designing and reconstructing Grantor’s electrical distribution system that currently exists within the Easement Area, based upon final plans that are mutually acceptable to Grantor and Grantee, (2) the full cost of designing and moving Grantor’s existing protected site entrance currently located at Lake Washington Boulevard N. (“Existing Protected Site Entrance”), to a new location on Logan Avenue N. at approximately N. 7th Street (“New Protected Site Entrance”), based upon final plans that are mutually acceptable to Grantor and Grantee, and (3) the full cost of closing and removing the Existing Protected Site Entrance once the New Protected Site Entrance is complete. 2.2.2 Amount. Total compensation to Grantee for the cost to cure work described in Section 2.2.1 is estimated at $1,355,481. Compensation shall be paid based upon work performed and documented to Grantee’s satisfaction, which shall not be unreasonably withheld. 2.2.3 Method of Payment. On a monthly or no less than quarterly basis, Grantor will send Grantee invoices documenting progress completed on the cost to work in Section 2.2.1. Grantor shall also submit a final invoice within six (6) months of completion of all work. Payment shall be made by Grantee for work performed within thirty (30) calendar days after receipt and approval by the appropriate Grantee representative of the invoice. DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 3 of 16 2.2.4 Place of Payment. All payments from Grantee to Grantor shall be paid to: The Boeing Company Global Real Estate PO Box 842289 Dallas TX 75284‐2289 Reference: GG|6703000|GGPSSG11058|SSG11058|X|GG|PUCR|699 2.3 Timing and Effect of Payment of Base Price. This Easement shall not take effect unless and until Grantor receives one‐half of the Base Price. Grantee shall pay to Grantor the second half of the Base Price within thirty (30) days of Grantor issuing a Notice to Proceed to its contractor of the cost to cure work described in Section 2.2.1 for the reconstruction of Grantor’s electrical distribution system that currently exists within the Easement Area. 3. CONDITION; “AS IS”; DISCLAIMER. EXCEPT AS EXPRESSLY SET FORTH IN THIS EASEMENT, THE PROPERTY, AND ALL OTHER GOODS OR SERVICES PROVIDED OR TO BE PROVIDED IN CONNECTION WITH THIS EASEMENT ARE BEING PROVIDED TO GRANTEE “AS IS, WHERE IS” WITH ALL FAULTS AND WITHOUT WARRANTY OF ANY KIND. 4. Environmental Matters. This Section 4 shall govern environmental matters under this Easement. 4.1 “Environmental Laws and Requirements” Defined. As used herein the term “Environmental Laws and Requirements” means any and all federal, state, local laws, statutes, ordinances, rules, regulations and/or common law relating to environmental protection, contamination, the release, generation, production, transport, treatment, processing, use, disposal, or storage of Hazardous Substances, and the regulations promulgated by regulatory agencies pursuant to these laws, and any applicable federal, state, and/or local regulatory agency‐initiated orders, requirements, obligations, directives, notices, approvals, licenses, or permits, including but not limited to those for the reporting, investigation, cleaning, or remediation of Hazardous Substances on the Easement Area. 4.2 “Hazardous Substances” Defined. As used herein, the term “Hazardous Substances” means any hazardous, toxic, chemical, or dangerous substance, pollutant, contaminant, waste or material, including petroleum, which is regulated under any and all federal, state, or local statute, ordinance, rule, regulation, or common law relating to chemical management, environmental protection, contamination, or cleanup including, without limitation, the Comprehensive Environmental Response, Compensation, and DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 4 of 16 Liability Act of 1980 as amended (42 U.S.C. § 9601 et seq.), the Resource Conservation and Recovery Act as amended (42 U.S.C. § 6901 et seq.) or any other federal, state, county, or city law, or any other ordinance or regulation existing or which may exist. 4.3 Compliance with Environmental Laws and Requirements; Hazardous Conditions. 4.3.1 Compliance with Environmental Laws and Requirements. At all times Grantee shall comply with all Environmental Laws and Requirements in connection with its operations and business in, around, or impacting the Agreement and the Easement Area; and Grantee shall not cause, permit or allow the presence of and shall not generate, release, store, or deposit any Hazardous Substances on or about the Easement Area in violation of any Environmental Laws and Requirements, or in a manner which may give rise to liability for environmental cleanup, damage to property, or personal injury to Grantor, or any other person; and Grantee shall not release any Hazardous Substances into the soil, water (including groundwater) or air of the Easement Area or onto any other adjoining property in violation of Environmental Laws and Requirements, or in a manner which may give rise to liability for environmental cleanup, damage to property, or personal injury to Grantee or any other person. 4.3.2 Hazardous Conditions. In the event that in connection with any construction, maintenance or repair activity that Grantee undertakes or in connection with any other activity performed by Grantee in connection with the exercise of its rights under this Easement, Grantee encounters, or suspects that it has encountered any Hazardous Substances in the Easement Area, which could present a risk to persons in or around the area or which may result in a release to the environment, or which in Grantor’s good faith opinion will or may require a response by Grantor pursuant to the Order (defined in Section 4.4), Grantee shall immediately report the condition to Grantor and shall stop work in the area in which the suspected Hazardous Substances were encountered. It is contemplated by the parties that if remediation of the area is necessary, Grantee will take the lead on coordinating the remediation in consultation with Grantor and in compliance with the requirements of the Order, as may be further set forth in the Environmental Management Plans (defined in Section 4.5). 4.4 Permits, Licenses & Approvals; Ecology Order. Grantee shall obtain all permits, licenses, and approvals required under Environmental Laws for operation and maintenance of its use of the Easement Area for the duration of this Easement, and shall promptly provide copies to Grantor’s personnel identified in Section 4.7. For informational purposes, Grantor has provided to Grantee a copy of Agreed Order 8191 between The Boeing Company and The Washington Department of Ecology (the “Order”). Grantee acknowledges that the Order is the binding legal obligation of Grantor. Grantee DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 5 of 16 shall comply with the Environmental Management Plans’ (which are defined in Section 4.5) requirements for Project compliance with the Agreed Order. 4.5 Compliance with Environmental Management Documents. Inasmuch as this Easement allows Grantee to use Grantor’s private property permanently for a public use, while Grantor, as the owner of the property subject to this Easement remains potentially responsible for environmental liabilities related to the Property, the Parties agree that, for the duration of this Permanent Easement, the Grantee shall conduct its operations on the Easement Area in conformance with the Environmental Management Plans, provided for in this Section 4.5 and in Exhibit B. The following is a summary of the requirements of the respective Environmental Management Plans that will be put in place pursuant to this Section 4.5: Grantee will perform Grantee’s “Onsite Work” (defined below) pursuant and subject to the “Environmental Management Plans.” The Environmental Management Plans are: i. Soil Management Plan as detailed in subsection 1 below. ii. Construction Water Management Plan as detailed in subsection 2 below. iii. Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP) as detailed in subsection 3 below. iv. Spill Response Plan as detailed in subsection 4 below. The requirements for such Environmental Management Plans and an agreed process for developing the written Environmental Management Plans are set out in this Section 4.5 and in Exhibit B, which is attached to this Permanent Easement and is by this reference incorporated in this Permanent Easement. “Onsite Work” means any activity involving physical alteration of the Easement Area for the purposes of initiating or continuing construction. Onsite Work includes work done in preparation for the extension of Park Avenue North, work done to complete such extension, and work done for maintenance, repair, replacement, and/or renewal of such extension after the extension of Park Avenue North has been placed into service. Before commencing any Onsite Work, Grantee shall: (a) prepare the Environmental Management Plans; (b) obtain Grantor’s approval for the Environmental Management Plans; and (c) obtain all permits, licenses, and approvals required under Environmental Laws and Requirements, including, but not limited to a Construction Stormwater Permit for construction projects, and shall promptly provide copies to Grantor’s Environmental Project Manager in accordance with Section 4.7 of this Easement (Notice). DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 6 of 16 1. Soil Management Plan. Grantee shall implement the Soil Management Plan in the course of performing work in connection with the Easement. 2. Construction Water Management Plan. Grantee shall implement the Construction Water Management Plan in the course of performing work in connection with the Easement. 3. Stormwater Management Plan. Grantee shall implement the Stormwater Management Plan and/or SWPPP both in the course of performing work in connection with the Easement and at all times throughout the term of the Easement as it relates to the Easement Area. 4. Spill Response Plan. Grantee shall implement the Spill Response Plan in the course of performing work in connection with the Easement and at all times throughout the term of the Easement as it relates to the Easement Area. 4.6 Notices and Testing. In the event that Grantee is notified of any investigation or violation of any Environmental Laws and Requirements arising from Grantee’s activities at the Easement Area or under this Easement, Grantee shall immediately deliver to Grantor a copy of such notice. In such event or in the event Grantor reasonably believes that a violation of Environmental Laws and Requirements exists arising based upon Grantee’s activities, Grantor may, upon notice to Grantee, conduct such tests and studies relating to compliance by Grantee with Environmental Laws and Requirements or the alleged presence of Hazardous Substances upon the Easement Area or under this Easement as Grantor reasonably deems necessary or desirable, and to the extent any such tests and studies indicate non‐compliance by Grantee with Environmental Laws and Requirements or the presence of Hazardous Substances upon the Easement Area or under this Easement, based upon Grantee’s activities, then Grantor shall supply Grantee with all information Grantor obtained from such tests and studies. Grantor’s inspection and testing rights are for Grantor’s own protection only, and Grantor has not, and shall not be deemed to have, assumed any responsibility to Grantee or any other party for compliance with Environmental Laws and Requirements, as a result of the exercise, or non‐exercise of such rights. 4.7 Grantee shall make required notifications to the Grantor under this Environmental Matters Section to the contacts listed below. To: Johnathan Sherman DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 7 of 16 johnathan.w.sherman@boeing.com 253‐218‐5053 Grantor may update this list of contacts by providing written notice to Grantee. Grantor will maintain a single point of contact for purposes of this Section 4.7. However, Grantor may name other individuals to act as points of contact for purposes of specific issues that may arise under any of the Environmental Management Plans. 4.8 Environmental Indemnity. Grantee shall indemnify, hold harmless, and defend Grantor, and its directors, officers, employees, agents, assigns, and attorneys from any and all claims, losses, damages, response costs, and expenses arising out of or in any way relating to Grantee’s violation of any Environmental Laws and Requirements or any of the provisions of this Easement (including, but not limited to, the requirements of this Easement related to Grantee’s responsibility for spill response on the Easement Area), or to the generation, release, storage, deposit or disposal of Hazardous Substances, to the extent caused by Grantee, its agents, employees, contractors and invitees at any time during the term of this Easement, including but not limited to: (1) claims of third parties, including governmental agencies, for damages (including personal injury and/or property damage), response costs, fines, penalties, injunctive or other relief; (2) the cost, expense, or loss to Grantor of any injunctive relief, including preliminary or temporary injunctive relief, applicable to the Grantor or the Easement Area; and (3) the expense of reporting the existence of Hazardous Substances to any agency of any state government or the United States as required by applicable laws or regulations, before and after any trial or appeal therefrom whether or not taxable as costs; all of which shall be paid by Grantee when accrued. 4.9 Future Construction or Major Modification. In the event Grantee engages in future projects to replace, reconstruct, inspect, improve or maintain said street improvements and underground utilities, it shall provide notice to Grantor’s contact identified in Section 4.7 and follow the requirements set out in Exhibit B. 4.10 Remedies. Should Grantee at any time be in noncompliance of any of the terms of this Easement or under any and all applicable Environmental Laws and Requirements, Grantee shall at its own expense promptly remedy such noncompliance and shall remove or remediate any unsafe condition that Grantee has caused to occur and clean up or remediate any Hazardous Substance that Grantee has caused to be released at or from the Property. Notwithstanding the foregoing, Grantor may exercise its remedies without delivering a prior notice to Grantee (1) in case of emergency or (2) in situations where the Grantee is taking an action or permitting a condition to continue that constitutes a DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 8 of 16 violation of the Order or would contravene the requirements of a permit to which Grantor is subject. 5. Grantee’s Use of the Easement Area; Compliance with Laws. 5.1 Grantee’s Use of the Easement Area. Grantee shall use, or allow the use of, the Easement Area only for the purposes set forth in Section 1 of this Easement. Grantee shall exercise its rights under this Easement so as to minimize, and avoid if reasonably possible, interference with Grantor's retained rights to the Easement Area. 5.2 Compliance with Laws and Rules. Grantee shall at all times exercise its rights herein in compliance with all applicable laws and regulations. Grantee shall obtain all permits and approvals required by any governmental agencies that may be necessary to Grantee’s intended use of the Easement Area. 6. Grantor's Use of the Easement Area and Access by Grantor during Construction. Grantor’s activities will not interfere with the Grantee's full use and enjoyment of the rights acquired pursuant to this Easement. 7. Grantor’s Use of the Easement Area Following Construction. 7.1 Grantor shall have a permanent right to enter at all times upon the Easement Area to survey, construct, repair, remove, replace, reconstruct, inspect, improve and maintain its underground utilities. Except as provided in Section 7.3, Grantor shall exercise its rights under this Easement so as to minimize, and avoid if reasonably possible, interference with Grantee's use of the Easement Area as set forth in Section 5. Prior to any activity pursuant to this Section 7.1, that disturbs or interferes with Grantee’s use of the Easement Area, Grantor shall reach mutual written agreement with Grantee regarding time, duration, traffic control, and other aspects of such activity so as to minimize its impact on Grantee’s use; Grantee shall not unreasonably withhold its agreement. Grantor acknowledges and agrees that any closures of 24 hours or longer in duration require review and approval by the City of Renton City Council. Notwithstanding the foregoing, Grantor may take the actions provided for in Section 7.3 without first obtaining the agreement of Grantee. 7.2 Grantor shall upon completion of any work within the Easement Area, restore the surface of the Easement Area and any public or private improvements therein disturbed or destroyed during execution of the work as nearly as practicable to the condition they were in immediately before commencement of the work or entry by the Grantor. Provided, however, Grantor, its successors, assigns and/or subsequent Grantees, will not alter or improve the Easement Area or grant any easements over, under, upon, and/or DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 9 of 16 across said property without first obtaining the written consent of the Grantee. Such consent will not be unreasonably withheld by the Grantee. 7.3 Notwithstanding any provision in this Easement to the contrary, The Boeing Company shall have the right to cross upon the surface of the Easement Area with its vehicles, whether licensed or not, and may restrict, without permission from Grantee, public access across the Easement Area for periods of time not to exceed a five‐minute duration only for the purpose of moving airplane fuselages, and not to exceed four times per day. The Boeing Company shall provide flaggers and other devices as may be required to safely manage traffic during such periods of public access restriction. Grantee acknowledges that the foregoing restrictions apply to the activities of The Boeing Company and do not apply to the activity of Burlington Northern or any other railroad operating on tracks that the extension of Park Avenue will cross. Grantor and Grantee acknowledge and agree that neither of them has any power, right, or authority to control the movement of trains along such tracks, nor to prevent, regulate, or sanction any rail operator who blocks passage on the Easement Area in connection with its rail operations. Where the term “The Boeing Company” is used in this Section 7.3 it refers to the original grantor of this Easement and denotes rights and obligations that are personal to The Boeing Company, that do not run with the land, that are non‐assignable, and that expire at such time The Boeing Company no longer owns the Property. 8. Indemnity and Insurance. 8.1 Grantee will indemnify, defend, and hold harmless, Grantor and its officers, directors, employees, contractors, agents, and invitees (hereinafter “Indemnitees”) from and against all actions, causes of action, liabilities, claims, suits, penalties, fines, judgments, liens, awards and damages of any kind whatsoever (hereinafter “Claims”), for injury to or death of any person (including without limitation claims brought by employees or invitees of Grantee or employees or invitees of any contractor of Grantee (hereinafter “Contractor”)) or damage to or loss of any property, and expenses, costs of litigation, and reasonable attorneys’ fees related thereto, or incident to establishing the right to indemnification, to the extent such Claims arise out of or are in any way related to this Easement or the presence on the Easement Property of Grantee, any Contractor or their respective employees or invitees, PROVIDED that nothing in this Section 8.1 is intended to require the Grantee to indemnify Grantor or any of the Indemnitees for any Claim to the extent it is caused by the negligence or willful misconduct of Grantor or an Indemnitee and without limiting the generality of the foregoing, nothing in this Section 8.1 is intended to require the Grantee to indemnify Grantor or any Indemnitee for injuries arising out of the unauthorized entry of an employee or contractor of Grantor onto the area of the Easement Area being used by Grantee as a work area. Grantee expressly waives any immunity under industrial insurance whether arising from Title 51 DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 10 of 16 of the Revised Code of Washington or any other statute or source, to the extent of the indemnity set forth in this paragraph. In the event that Grantee is successful in proving that the foregoing indemnity is limited by RCW 4.24.115, Grantee shall defend, indemnify and hold harmless the Indemnitees to the full extent allowed by RCW 4.24.115. In no event shall Grantee’s obligations hereunder be limited to the extent of any insurance available to or provided by Grantee. Grantee shall require each Contractor who desires access to the Easement Property to provide an indemnity, enforceable by and for the benefit of the Indemnitees, to the same extent required of the Grantee. 8.2 Grantee shall ensure that its contractors carry and maintain, Commercial General Liability insurance with available limits of not less than One Million Dollars ($1,000,000) per occurrence for bodily injury, including death, and property damage combined, Two Million Dollars ($2,000,000) general aggregate. Any policy which provides the insurance required under this paragraph shall: (a) be endorsed to name "The Boeing Company and its subsidiaries and their respective directors, officers, employees, agents, attorneys and assigns" as additional insureds (hereinafter "Additional Insured") with respect to any liability arising out of Grantee's presence on the Easement Area (or such contractor's presence as the case may be), (b) be endorsed to be primary to any insurance maintained by The Boeing Company; (c) contain a severability of interest provision in favor of the Additional Insured and (d) contain a waiver of any rights of subrogation against the Additional Insured. If licensed vehicles will be used in connection with this permit, Grantee shall ensure that its contractors who use licensed vehicles in connection with this Easement carry and maintain, Automobile Liability insurance covering all vehicles, whether owned, hired, rented, borrowed or otherwise, with limits of liability of not less than One Million Dollars ($1,000,000) per occurrence combined single limit for bodily injury and property damage. Grantee shall ensure that its contractors cover or maintain, insurance in accordance with the applicable laws relating to workers' compensation, with respect to all of their respective employees working on or about the Easement Area, regardless of whether such coverage of insurance is mandatory or merely elective under the law. No contractor shall access the Easement Area unless such Contractor shall have first provided a certificate of insurance reflecting full compliance with the requirements set forth herein. Such certificate shall list The Boeing Company as certificate holder and shall be kept current and in compliance throughout the period of this permit and shall provide for thirty (30) days advance written notice to Grantee in the event of cancellation. The insurance provisions in this Section 8.2 can be substituted with self‐insurance. DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 11 of 16 9. Notices. All notices or other communications required or permitted hereunder shall be in writing, and shall be sent (a) by nationally recognized overnight courier service with all charges for next business day delivery prepaid or (b) by PDF or similar attachment to an email, provided that such email attachment shall be followed within three (3) business days by delivery of such notice pursuant to clause (a) above, and shall be effective upon receipt at the appropriate address below except for environmental matters covered by Section 4.7 (provided that if any notice or other communication to be delivered by email attachment as provided above cannot be transmitted because of a problem affecting the receiving party’s computer, the deadline for receiving such notice or other communication shall be extended through the next business day): To Grantor: The Boeing Company c/o MBG Consulting, Inc. 980 N. Michigan Avenue, Suite 1000 Chicago, IL 60611 With A Copy To: The Boeing Company Attn: Marc Poulin 153 James S. McDonnell Blvd. M/C S221‐1499 Hazelwood, MO 63042 And The Law Department Attn: Real Estate Counsel The Boeing Company P.O. Box 3707, M/C 11‐XT Seattle, WA 98124‐2207 Phone: 206‐662‐6588 To Grantee: Public Works Administrator City of Renton 1055 S. Grady Way Renton, WA 98057 Email: mpastucha@rentonwa.gov Phone: (425) 430‐7311 DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 12 of 16 With A Copy To: City Attorney City of Renton 1055 S. Grady Way Renton, WA 98057 Email: smoloney@rentonwa.gov Notice of change of address shall be given by written notice in the manner detailed in this Section 9. Rejection or other refusal to accept or the inability to deliver because of changed address of which no notice was given shall be deemed to constitute receipt of the notice, demand, request or communication sent. The attorneys for any party hereto shall be entitled to provide any notice that a party desires to provide or is required to provide hereunder. 10. Limited Warranties. The rights granted herein are subject to permits, leases, licenses, and easements, if any, heretofore granted by Grantor affecting the Easement Area. Grantor shall warrant its title to the Easement Area against any person claiming through Grantor, but not otherwise. Any plans, specifications, or drawings (collectively, "Submittal") provided by Grantee to Grantor pursuant to this Easement are for Grantor's informational purposes only. Any analysis, review or approval by Grantor, or Grantor's failure to analyze, review or approve such Submittal (including failure to discover any error or defect in such Submittal) shall not relieve Grantee of any of its obligations under this Easement. Grantor hereby expressly disclaims any and all warranties, express or implied, with respect to any such Submittal developed, reviewed or approved by Grantor as a condition of this Easement. 11. Covenants Running with the Land; Successors and Assigns. The terms and conditions of this Easement shall be covenants running with the land except as expressly stated otherwise in this instrument, and except as expressly stated otherwise in this instrument shall burden and benefit the Grantor, the Grantee, and their respective successors and assigns in interest as owners of the Property (in the case of the Grantor and its successors and assigns) or as grantees of the rights hereunder (in the case of the Grantee and its successors and assigns). Except as expressly stated otherwise in this instrument, upon transfer of title to the Property by Grantor or assignment of its rights hereunder as grantee by Grantee, the benefits and burdens of this Easement shall pass to the transferee, and the transferor shall be liable only for those matters that arose during the period of such transferor’s ownership of the Property or of the rights of the Grantee, as the case may be, and the rights and obligations of the parties shall inure to the benefit of and be binding upon their respective successors and assigns. 12. No Merger of Estates. The Easement granted herein shall not be extinguished or terminated by operation of the doctrine of merger or otherwise due to the existing or future common ownership of the real property described herein. DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 13 of 16 13. Complete Agreement. This Easement contains the entire agreement of the parties with respect to this subject matter and supersedes all prior or contemporaneous writings or discussions relating to the easement provided for herein. This Easement may not be amended except by a written document executed after the date hereof by the duly authorized representatives of Grantor and Grantee. This Easement includes Exhibits A‐1, A‐2, A‐3, and B, which by this reference are incorporated into this Easement. 14. Governing Law. This Easement shall be governed by the laws of the State of Washington, exclusive of its choice of law rules. DATED . Grantee: Grantor: The City of Renton The Boeing Company By: _______________________ By: _____________________ Its: _______________________ Its: ______________________ DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 14 of 16 ACKNOWLEDGMENT State of Washington ) ) ss. County of King ) I certify that I know or have satisfactory evidence that is the person who appeared before me, and said person acknowledged that he signed this instrument, on oath stated that he was authorized to execute the instrument and acknowledged it as the of The City of Renton, a Washington municipal corporation, to be the free and voluntary act and deed of such party for the uses and purposes mentioned in the instrument. Dated: ______________________________ Notary public in and for the State of Washington, residing at My appointment expires DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 15 of 16 ACKNOWLEDGMENT State of Washington ) ) ss. County of King ) I certify that I know or have satisfactory evidence that ____________ is the person who appeared before me, and said person acknowledged that he signed this instrument, on oath stated that he was authorized to execute the instrument and acknowledged it as the Authorized Signatory of The Boeing Company, a Delaware corporation, to be the free and voluntary act and deed of such party for the uses and purposes mentioned in the instrument. Dated: ______________________________ Notary public in and for the State of Washington, residing at My appointment expires DRAFTAGENDA ITEM #5. e) Park Ave Permanent Easement Page 16 of 16 EXHIBIT A‐1 (Legal Description of the Property) EXHIBIT A‐2 (Legal Description of the Permanent Easement Area) EXHIBIT A‐3 (Map Exhibit of the Easement Area) EXHIBIT B Basic Requirements for Environmental Management Plans DRAFTAGENDA ITEM #5. e) EXHIBIT A-1 LEGAL DESCRIPTION OF THE PROPERTY LOT 6, BOEING LAKESHORE LANDING, A BINDING SITE PLAN, RECORDED DECEMBER 23, 2004, UNDER RECORDING NO. 20041223000856, IN KING COUNTY, WASHINGTON; EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED DECEMBER 12, 2006, RECORDERS NO. 20061212000338; AND EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED NOVEMBER 2, 2009, RECORDERS NO. 20091102002105; AND EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED NOVEMBER 2, 2009, RECORDERS NO. 20091102002360; AND EXCEPT THAT PORTION CONVEYED TO CITY OF RENTON, A MUNICIPAL CORPORATION BY DEED OF DEDICATION RECORDED SEPTEMBER 10, 2015 UNDER RECORDING NOS. 20150910000182 AND 20150910000183 AND RE-RECORDED JULY 07, 2016 UNDER RECORDING NO. 20160707000538. ASSESSORS PARCEL NUMBER: 088660-0060-03 DRAFTAGENDA ITEM #5. e) EXHIBIT A-2 PERMANENT EASEMENT LEGAL DESCRIPTION THAT PORTION OF LOT 6 OF THE BINDING SITE PLAN FOR BOEING LAKESHORE LANDING, ACCORDING TO THE PLAT THEREOF RECORDED IN AUDITOR’S FILE NO. 20041223000586, RECORDS OF KING COUNTY, WASHINGTON, DESCRIBED AS FOLLOWS: COMMENCING AT THE EASTERNMOST POINT OF SAID LOT 6, SAID POINT BEING ON THE NORTH RIGHT OF WAY MARGIN OF LOGAN AVENUE NORTH; THENCE SOUTH 43°47’24” WEST, ALONG THE SOUTHEAST LINE OF SAID LOT AND SAID NORTH MARGIN, A DISTANCE OF 290.47 FEET TO THE BEGINNING OF A CURVE TO THE RIGHT HAVING A RADIUS OF 933.50 FEET; THENCE SOUTHWESTERLY ALONG SAID CURVE THROUGH A CENTRAL ANGLE OF 12°43’42” AND AN ARC LENGTH OF 207.38 FEET TO THE POINT OF BEGINNING, SAID POINT BEING THE BEGINNING OF A CURVE TO THE RIGHT HAVING A RADIUS OF 55.50 FEET, THE CENTER OF WHICH BEARS NORTH 5°01’42” WEST; THENCE NORTHWESTERLY ALONG SAID CURVE THROUGH A CENTRAL ANGLE OF 39°49’29” AND AN ARC LENGTH OF 38.58 FEET; THENCE NORTH 55°12’13” WEST A DISTANCE OF 41.41 FEET; THENCE NORTH 26°08’22” WEST A DISTANCE OF 70.82 FEET TO A POINT ON THE NORTHWEST LINE OF SAID LOT; THENCE SOUTH 50°42’51” WEST, ALONG SAID LINE, A DISTANCE OF 96.53 FEET; THENCE SOUTH 26°08’22” EAST A DISTANCE OF 117.23 FEET TO A POINT ON THE SOUTHEAST LINE OF SAID LOT AND SAID NORTH MARGIN, SAID POINT BEING THE BEGINNING OF A CURVE TO THE LEFT, HAVING A RADIUS OF 933.50 FEET, THE CENTER OF WHICH BEARS NORTH 24°42’24” WEST; THENCE NORTHEASTERLY ALONG SAID CURVE, LINE, AND MARGIN THROUGH A CENTRAL ANGLE OF 8°46’30” AND AN ARC LENGTH OF 142.97 FEET TO THE POINT OF BEGINNING. HAVING AN AREA OF 13,278 SQUARE FEET, MORE OR LESS. DRAFTAGENDA ITEM #5. e) PARK AVENUE N EXTENSION DRAWN BY:DATE: EXHIBIT A-3 SEC. 8, T. 23 N., R. 5 E., W.M. 1ALLIANCE GEOMATICS SURVEYING & MAPPING 1261A 120TH AVE NE Ph: (425) 598-2200 Bellevue, Washington 98005 Fax: (425) 502-8067 NORTH PERMANENT EASEMENT ASSESSOR'S PARCEL NO. 0886600060 THE BOEING COMPANY LOT 6, BINDING SITE PLAN AF# 20041223000856 L=3 8.58' R=55.50' =39°49'29" LOGA N AV E N U E N ASSESSOR'S PARCEL NO. 0823059027 BNSF RAILROAD ASSESSOR'S PARCEL NO. 0823059078 PUGET SOUND ENERGY PARK AVENUE N N 5 5 ° 1 2 ' 1 3 " W 41.41'N 26°08 '22 " W70.82 'S 50°42'51" W 96.53'S 26°08'22" E117.23' L=142. 9 7' R=9 33.50' =8°46 '3 0 "POB POB: POINT OF BEGINNING POC S 43°47'24" W290.47' L=2 07.38' R=933.50' =12°43'42" POB: POINT OF BEGINNING POC: POINT OF COMMENCEMENTDRAFT AGENDA ITEM #5. e) EXHIBIT B Basic Requirements for Environmental Management Plans The Boeing Company (“Boeing”) and the City of Renton (the “City”) will agree on a set of environmental plans to be referenced in the Permanent Easement and the Temporary Construction Easement (collectively, the “Easements”). The set of environmental plans will consist of the following four plans: (1) Soil Management Plan; (2) Construction Water Management Plan; (3) Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP); and (4) Spill Response Plan. These four plans are, collectively, the “Environmental Management Plans.” This document sets forth certain terms that will be included in the Environmental Management Plans and the process that will apply to finalizing the Environmental Management Plans. If, during the term of the Permanent Easement, the City proposes to conduct Onsite Work, as defined in the Easements, it will either adhere to the Environmental Management Plans or, in advance, it will propose a new set of Environmental Management Plans to govern such work following the same process described in Section B below. A. TERMS Below are terms that the Parties agree will be included in the Environmental Management Plans. 1. Soil Management Plan The City’s Soil Management Plan shall address methods for the following: i. Stockpiling and segregating soils during excavation, which methods shall exclude any comingling of Boeing‐property generated soils with non‐Boeing property generated soils. ii. Managing any containers brought on site for holding soils and wastewater during Onsite Work (defined as: any activity involving physical alteration of the Easement Area for the purposes of initiating or continuing construction) among other things to ensure that containers are and remain environmentally clean. iii. Methods to backfill excavations first with all site soils removed during excavation, unless suspected contamination is encountered, or soils are not suitable for City’s project use. iv. Procedures to ensure soils/rocks are appropriately covered during construction and any off‐site transportation. v. Procedures in the event suspected contamination is encountered during construction, including the following:  Notification of suspected contamination to Boeing’s point of contact. DRAFTAGENDA ITEM #5. e)  Determination and implementation by the City of characterization, excavation, profiling, and disposal requirements for excavated soil and other excavated material. vi. With respect to soils that have been excavated, or will/may be excavated, for project construction purposes that are not able to be replaced on‐site, and the soils were not removed because of suspected contamination:  City to ensure soils from Boeing properties are not comingled with soils brought in from other locations for disposal purposes.  City may only sample for environmental characterization/disposal purposes after excavation and after City determination that soils may not be replaced on‐site.  City notification of Boeing point of contact of soil analytical/waste profiling results prior to disposal of soils off‐site.  City notification of Boeing point of contact of selected disposal facility in advance of proper soil disposal at off‐site facility.  Methods to ensure disposal of property soils in the following order of preference: i. Landfill as alternate daily cover. ii. Direct landfill disposal as waste. iii. City is prohibited from disposing of Boeing property soils for any unrestricted or sensitive re‐use, or other non‐landfill disposal purposes. ix. City management and appropriate disposal of all investigative‐derived waste to an appropriate landfill, including any soil and wastewater not already addressed above. x. If City plans to import soil or structural fill with soil components for placement in the Easement Area, City to provide import fill profile data for environmental contaminants to Boeing point of contact for prior approval at least one week in advance. Boeing will respond within five days of receipt and will not unreasonably withhold approval.  Imported soil or structural fill with soil components must meet Washington Model Toxics Control Act Method A Unrestricted Land Use Criteria for the following analytes:  NWTPH (full range gas to heavy) + benzene  VOCs (EPA Method 8260B)  RCRA 8 metals + copper (Cu)  Advance approval not required for crushed rock or landscaping topsoil if these meet applicable Washington Model Toxics Control Act requirements. The Soil Management Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. 2. Construction Water Management Plan DRAFTAGENDA ITEM #5. e) The City’s Construction Water Management Plan shall address methods for the following: i. Management and disposition of all water streams generated by the City’s Onsite Work at the Property, including excavation dewatering, any wastewater discharge to sanitary or any construction dewatering water discharged to storm sewer [including as covered by any discharge permits that City will procure], and wastewater removed off‐site for disposal. ii. Providing for the City’s prompt provision of the City’s wastewater monitoring/sampling results to the Boeing point of contact. The Construction Water Management Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. 3. Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP) The City’s Stormwater Management Plan and/or SWPPP shall address methods for all legally‐ required and otherwise appropriate storm water management practices, including the following: i. City compliance with any other existing Construction Stormwater Permit (CSP) that covers the Easement Area, whether it belongs to Boeing or another party, if still in place during the City’s Easement‐related construction activities. ii. City application for and compliance with any now or later required stormwater permits of any kind. iii. City construction of stormwater collection and conveyance structures to ensure that City and Boeing stormwater flows shall remain segregated to the greatest extent possible as now provided for in the City’s stormwater infrastructure and drainage plan. iv. City maintenance of Easement Area stormwater drains or other infrastructure (including clean‐outs and response to any impacts from spills) for as long as the Easement is in effect. v. Provision to Boeing point of contact a copy of all stormwater monitoring and sampling results/reports. vi. City notification to Boeing point of contact of any permit violations within 24 hours of the violation’s inception or as soon as practicable. vii. City implementation of any corrective actions required by regulators related to stormwater violations. DRAFTAGENDA ITEM #5. e) The Stormwater Management Plan and/or SWPPP shall state that the City is responsible for all costs associated with complying with the plan(s), including any costs incurred by the City for stop‐ work events related to any unplanned or contingent events. 4. Spill Response Plan The City’s Spill Response Plan shall address methods for the following: i. City’s immediate (with “immediate” to be defined in plan) response to spills or releases of regulated or Hazardous Substances as required by law as a result of the Grantee’s use or authorized or unauthorized public use of the Easement Area and as long as the Easement is in effect. ii. City’s immediate (same note as above re “immediate”) notification to Boeing point of contact of any spills or releases of regulated or Hazardous Substance and associated response actions taken. iii. City’s handling, removal, and disposal of all such spills and releases, including City sampling to verify completed remediation of spill impacts to soils, groundwater, surface water, stormwater, or other environmental media as applicable. iv. City’s determination of waste characterization for disposal purposes, including the following: a. For regulated waste, prior to disposal, City shall provide City’s waste characterization/profile and selected disposal location to Boeing point of contact. City shall provide Boeing point of contact verification of final disposal after completion. b. For non‐regulated waste, City shall provide advance notification to Boeing point of contact of waste disposal characterization and selected disposal facility. v. City shall comply with applicable laws and regulations for spill response and clean‐up. The Spill Response Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. B. PROCESS Below is the agreed process for development and finalizing of the Environmental Management Plans. 1. The City will deliver to Boeing’s point of contact proposed written plans for each of the four Environmental Management Plans. DRAFTAGENDA ITEM #5. e) 2. Boeing will review each submission and will either approve or reject each submission within 14 calendar days of receipt. If Boeing does not respond within 14 calendar days, the plan will be deemed accepted by Boeing. This section applies both to original and revised submissions. 3. If Boeing determines it will reject all or portions of any of the Environmental Management Plans, it will provide detailed comments explaining the basis for its objections. For each plan so rejected, the City then will provide a revised plan addressing Boeing’s comments. The EHS Project Managers of the parties will meet as necessary to engage in prompt and good faith dialog in an effort to resolve Boeing’s comments. This paragraph applies both to original and revised submissions. 4. In the event the EHS Project Managers are unable to resolve issues of dispute, the issues will be referred to the Boeing Renton Site EHS Director and the City’s Environmental Manager for resolution. The On Site Work will not proceed absent a resolution of the dispute. DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 1 of 16 Temporary Construction Easement PARK AVENUE NORTH EXTENSION PROJECT THIS Temporary Construction Easement agreement (“Agreement,” “Easement,” or “Temporary Construction Easement”) is made between The Boeing Company, a Delaware corporation (“Grantor”), and the City of Renton, a Washington municipal corporation (“Grantee”) (collectively “the Parties”). RECITALS WHEREAS, Grantor is the owner of real property known as King County Parcel No. 0886600060 (the “Property”), legally described in Exhibit A‐1 (Legal Description of the Property), attached hereto and incorporated herein by this reference; and WHEREAS, Grantee is proceeding with the Park Avenue North Extension Project (the “Project”), and requires a Temporary Construction Easement over a portion of the Property; NOW, THEREFORE, for and in consideration of mutual benefits, the Parties agree as follows: 1.Grant of Easement: Grantor, for good and valuable consideration does by these presents, grant to Grantee, franchisees and permittees (collectively "Grantee" herein), a Temporary Construction Easement over, under, through, across, and upon the real estate described in Exhibit A‐2 and shown in Exhibit A‐3 (the “Easement Premises,” “Easement Area,” or “Temporary Construction Easement Area”) for the purpose of (1) making improvements to the Property set out in the statement of work and estimated non‐binding schedule attached as Exhibit B; (2) restoring Grantor’s access and facilities disturbed by Grantee’s construction activities; and (3) temporary storage and mobilization of construction equipment and construction materials associated with the Project. Grantee shall, upon expiration of this Temporary Construction Easement, remove debris, and restore the surface of the Easement Premises disturbed or destroyed during the execution of the work, as nearly as practicable to the pre‐project conditions. Grantee shall not under any circumstances perform any of the following actions on the Easement Premises: fueling or refueling, maintenance, repair, washing, or other service of any vehicle, equipment, or other item. Nothing in this Easement grants any right to Grantee to perform any of the preceding actions on any other property owned, leased, or controlled by the Grantor.DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 2 of 16 2. Access: Grantee and/or its assigns, shall have the right and privilege to enter the Easement Premises and for ingress and egress over, under, through, across and upon the Easement Premises to enable Grantee, and its assigns, without undo interruption and during reasonable times, to exercise its rights hereunder and for Grantee’s use to do all things reasonably necessary to construct and install the Project including, but not limited to, the transport, stockpiling and storage of construction materials, equipment and vehicles. 3. Environmental Matters: This Section 3 shall govern environmental matters under this Easement. 3.1 “Environmental Laws and Requirements” Defined. As used herein the term “Environmental Laws and Requirements” means any and all federal, state, local laws, statutes, ordinances, rules, regulations and/or common law relating to environmental protection, contamination, the release, generation, production, transport, treatment, processing, use, disposal, or storage of Hazardous Substances, and the regulations promulgated by regulatory agencies pursuant to these laws, and any applicable federal, state, and/or local regulatory agency‐initiated orders, requirements, obligations, directives, notices, approvals, licenses, or permits, including but not limited to those for the reporting, investigation, cleaning, or remediation of Hazardous Substances on the Easement Area. 3.2 “Hazardous Substances” Defined. As used herein, the term “Hazardous Substances” means any hazardous, toxic, chemical, or dangerous substance, pollutant, contaminant, waste or material, including petroleum, which is regulated under any and all federal, state, or local statute, ordinance, rule, regulation, or common law relating to chemical management, environmental protection, contamination, or cleanup including, without limitation, the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 as amended (42 U.S.C. § 9601 et seq.), the Resource Conservation and Recovery Act as amended (42 U.S.C. § 6901 et seq.) or any other federal, state, county, or city law, or any other ordinance or regulation existing or which may exist 3.3 Compliance with Environmental Laws and Requirements; Hazardous Conditions. 3.3.1 Compliance with Environmental Laws and Requirements. At all times Grantee shall comply with all Environmental Laws and Requirements in connection with its operations and business in, around, or impacting the Agreement and the Easement Area; and Grantee shall not cause, permit or allow the presence of and DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 3 of 16 shall not generate, release, store, or deposit any Hazardous Substances on or about the Easement Area in violation of any Environmental Laws and Requirements, or in a manner which may give rise to liability for environmental cleanup, damage to property, or personal injury to Grantor, or any other person; and Grantee shall not release any Hazardous Substances into the soil, water (including groundwater) or air of the Easement Area or onto any other adjoining property in violation of Environmental Laws and Requirements, or in a manner which may give rise to liability for environmental cleanup, damage to property, or personal injury to Grantee or any other person. 3.3.2 Hazardous Conditions. In the event that Grantee encounters, or suspects that it has encountered any Hazardous Substances in the Easement Premises, which could present a risk to persons in or around the area or which may result in a release to the environment, or which in Grantor’s good faith opinion will or may require a response by Grantor pursuant to the Order (defined in Section 3.4), Grantee shall immediately report the condition to Grantor and shall stop work in the area in which the suspected Hazardous Substances were encountered. It is contemplated by the parties that if remediation of the area is necessary, Grantee will take the lead on coordinating the remediation in consultation with Grantor and in compliance with the requirements of the Order, as may be further set forth in the Environmental Management Plans (defined in Section 3.5). 3.4 Permits, Licenses & Approvals; Ecology Order. Grantee shall obtain all permits, licenses, and approvals required under Environmental Laws for operation and maintenance of its use of the Easement Area for the duration of this Easement, and shall promptly provide copies to Grantor’s personnel identified in Section 3.7. For informational purposes, Grantor has provided to Grantee a copy of Agreed Order 8191 between The Boeing Company and The Washington Department of Ecology (the “Order”). Grantee acknowledges that the Order is the binding legal obligation of Grantor. Grantee shall comply with the Environmental Management Plans’ (which are defined in Section 3.5) requirements for Project compliance with the Agreed Order. 3.5 Responsibility for Storm Drains and Spills; Environmental Management Plans. Because Grantor, as the owner of the property subject to this Easement, remains potentially responsible for environmental liabilities related to the Property, the Parties agree that, for the duration of this Temporary Construction Easement, the Grantee shall conduct its operations on the Easement Area in conformance with the Environmental Management Plans. Without limiting the foregoing, Grantee shall comply with the following provisions: DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 4 of 16 (a) Grantee shall repair the storm water drain systems impacted by the Project on the Easement Area; (b) Grantee shall conduct its operations on the Easement Area in conformance with the Soil Management Plan, the Construction Water Management Plan, the Stormwater Management Plan, the Stormwater Pollution Protection Plan, and the Spill Response Plan as set out below and as more fully provided in Exhibit C. (c) The following is a summary of the requirements of the respective Environmental Management Plans that will be put in place pursuant to this Section 3.5: Grantee will perform Grantee’s “Onsite Work” (defined below) pursuant and subject to the “Environmental Management Plans.” The Environmental Management Plans are: i. Soil Management Plan as detailed in subsection 1 below. ii. Construction Water Management Plan as detailed in subsection 2 below. iii. Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP) as detailed in subsection 3 below. iv. Spill Response Plan as detailed in subsection 4 below. The requirements for such Environmental Management Plans and an agreed process for developing the written Environmental Management Plans are set out in this Section 3.5 and in Exhibit C, which is attached to this Temporary Construction Easement and is by this reference incorporated in this Temporary Construction Easement. “Onsite Work” means any activity involving physical alteration of the Easement Area for the purposes of initiating or continuing construction. Onsite Work includes work done in preparation for the extension of Park Avenue North, work done to complete such extension, and work done for maintenance, repair, replacement, and/or renewal of such extension after the extension of Park Avenue North has been placed into service. Before commencing any Onsite Work, Grantee shall: (a) prepare the Environmental Management Plans; (b) obtain Grantor’s approval for the Environmental Management Plans; and (c) obtain all permits, licenses, and approvals required under Environmental Laws and Requirements, including, but not limited to a Construction Stormwater Permit for construction projects, and shall promptly provide copies to Grantor’s Environmental Project Manager in accordance with Section 3.7 of this Easement (Notice). DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 5 of 16 1. Soil Management Plan. Grantee shall implement the Soil Management Plan in the course of performing work in connection with the Easement. 2. Construction Water Management Plan. Grantee shall implement the Construction Water Management Plan in the course of performing work in connection with the Easement. 3. Stormwater Management Plan. Grantee shall implement the Stormwater Management Plan and/or SWPPP both in the course of performing work in connection with the Easement and at all times throughout the term of the Easement as it relates to the Easement Area. 4. Spill Response Plan. Grantee shall implement the Spill Response Plan in the course of performing work in connection with the Easement and at all times throughout the term of the Easement as it relates to the Easement Area. In addition, Grantor and Grantee acknowledge that they are parties to a License Agreement dated December 18, 2018, bearing Grantee’s reference number CAG‐18‐ 277 (the “License Agreement”). The “Licensed Property” under the License Agreement corresponds to the Easement Area under this Temporary Construction Easement. Pursuant to the License Agreement, Grantee has performed certain geotechnical testing. Grantee agrees that pursuant to the License Agreement Grantee is obligated to perform certain restoration work on the Easement Area. Grantee agrees that the work that Grantee will perform in the Easement Area pursuant to this Temporary Construction Easement will include all work that Grantee is required to perform as Licensee under the License Agreement. 3.6 Notices and Testing. In the event that Grantee is notified of any investigation or violation of any Environmental Laws and Requirements arising from Grantee’s activities at the Easement Area or under this Easement, Grantee shall immediately deliver to Grantor a copy of such notice. In such event or in the event Grantor reasonably believes that a violation of Environmental Laws and Requirements exists arising based upon Grantee’s activities, Grantor may, upon notice to Grantee, conduct such tests and studies relating to compliance by Grantee with Environmental Laws and Requirements or the alleged presence of Hazardous Substances upon the Easement Area or under this Easement as Grantor reasonably deems necessary or desirable, and to the extent any such tests and studies indicate non‐compliance by Grantee with Environmental Laws and Requirements or the DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 6 of 16 presence of Hazardous Substances upon the Easement Area or under this Easement, based upon Grantee’s activities, then Grantor shall supply Grantee with all information Grantor obtained from such tests and studies, and such tests and studies shall be completed at Grantee’s expense. Grantor’s inspection and testing rights are for Grantor’s own protection only, and Grantor has not, and shall not be deemed to have, assumed any responsibility to Grantee or any other party for compliance with Environmental Laws and Requirements, as a result of the exercise, or non‐exercise of such rights. 3.7 Notices Regarding Environmental Matters. Grantee shall make required notifications regarding environmental matters to the Boeing Environmental Manager to the contact listed below. Johnathan Sherman johnathan.w.sherman@boeing.com 253‐218‐5053 Grantor may update this list by providing written notice to Grantee. Grantor will maintain a single point of contact for purposes of this Section 3.7. However, Grantor may name other individuals to act as points of contact for purposes of specific issues that may arise under any of the Environmental Management Plans. 3.8 Environmental Indemnity. Grantee shall indemnify, hold harmless, and defend Grantor, and its directors, officers, employees, agents, assigns, and attorneys from any and all claims, losses, damages, response costs, and expenses arising out of or in any way relating to the violation of any Environmental Laws and Requirements or any of the provisions of this Easement (including, but not limited to, the requirements of this Easement related to Grantee’s responsibility for spill response on the Easement Area), or to the generation, release, storage, deposit or disposal of Hazardous Substances, to the extent caused by Grantee, its agents, employees, contractors and invitees at any time during the term of this Easement, including but not limited to: (1) claims of third parties, including governmental agencies, for damages (including personal injury and/or property damage), response costs, fines, penalties, injunctive or other relief; (2) the cost, expense, or loss to Grantor of any injunctive relief, including preliminary or temporary injunctive relief, applicable to the Grantor or the Easement Area; and (3) the expense of reporting the existence of Hazardous Substances to any agency of any state government or the United States as required by applicable laws or regulations, before and after any trial or appeal DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 7 of 16 therefrom whether or not taxable as costs; all of which shall be paid by Grantee when accrued. 3.9 Construction Meetings; Changes in Scope. During the construction of the Project, Grantor may send a representative to attend Grantee construction meetings regarding Project status and progress, including regularly scheduled weekly construction meetings and any unscheduled meetings. Grantee will keep Grantor advised as far in advance as is reasonably practical of the dates, times, and locations of all scheduled and unscheduled meetings. Whether or not Grantor is present at a construction meeting, Grantee will not implement any substantial change to the Project’s scope or schedule without prior consultation with and approval in writing from Grantor. 3.10 Remedies. Should Grantee at any time be in noncompliance with any of the terms of this Temporary Construction Easement or under any and all Environmental Laws and Requirements, Grantee shall at its own expense remedy such noncompliance and shall remove or remediate any unsafe condition that Grantee has caused to occur and clean up or remediate any Hazardous Substance that Grantee has caused to be released at or from the Property. Should Grantee fail so to do after receiving written notice from Grantor, then after giving further notice to Grantee Grantor shall have the right, but not the duty, to enter the Property including the Temporary Construction Easement Area itself or through its agents, consultants, or contractors to perform the same. Notwithstanding the foregoing, Grantor may exercise its remedies without delivering a prior notice to Grantee (1) in case of emergency or (2) in situations where the Grantee is taking an action or permitting a condition to continue that constitutes a violation of the Order or would contravene the requirements of a permit to which Grantor is subject. 4. CONDITION; “AS IS”; DISCLAIMER: EXCEPT AS EXPRESSLY SET FORTH IN THIS EASEMENT, THE PROPERTY, AND ALL OTHER GOODS OR SERVICES PROVIDED OR TO BE PROVIDED IN CONNECTION WITH THIS EASEMENT ARE BEING PROVIDED TO GRANTEE “AS IS, WHERE IS” WITH ALL FAULTS AND WITHOUT WARRANTY OF ANY KIND. 5. Indemnity and Insurance: 5.1 Grantee will indemnify, defend, and hold harmless, Grantor and its officers, directors, employees, contractors, agents, and invitees (hereinafter “Indemnitees”) from and against all actions, causes of action, liabilities, claims, DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 8 of 16 suits, penalties, fines, judgments, liens, awards and damages of any kind whatsoever (hereinafter “Claims”), for injury to or death of any person (including without limitation claims brought by employees or invitees of Grantee or employees or invitees of any contractor of Grantee (hereinafter “Contractor”)) or damage to or loss of any property, and expenses, costs of litigation, and reasonable attorneys’ fees related thereto, or incident to establishing the right to indemnification, to the extent such Claims arise out of or are in any way related to this Easement or the presence on the Easement Property of Grantee, any Contractor or their respective employees or invitees, PROVIDED that nothing in this Section 5.1 is intended to require the Grantee to indemnify Grantor or any of the Indemnitees for any Claim to the extent it is caused by the negligence or willful misconduct of Grantor or an Indemnitee and without limiting the generality of the foregoing, nothing in this Section 5.1 is intended to require the Grantee to indemnify Grantor or any Indemnitee for injuries arising out of the unauthorized entry of an employee or contractor of Grantor onto the area of the Easement Area being used by Grantee as a work area. Grantee expressly waives any immunity under industrial insurance whether arising from Title 51 of the Revised Code of Washington or any other statute or source, to the extent of the indemnity set forth in this paragraph. In the event that Grantee is successful in proving that the foregoing indemnity is limited by RCW 4.24.115, Grantee shall defend, indemnify and hold harmless the Indemnitees to the full extent allowed by RCW 4.24.115. In no event shall Grantee’s obligations hereunder be limited to the extent of any insurance available to or provided by Grantee. Grantee shall require each Contractor who desires access to the Easement Property to provide an indemnity, enforceable by and for the benefit of the Indemnitees, to the same extent required of the Grantee. 5.2 Grantee shall ensure that any contractor carries and maintains, Commercial General Liability insurance with available limits of not less than One Million Dollars ($1,000,000) per occurrence for bodily injury, including death, and property damage combined, Two Million Dollars ($2,000,000) general aggregate. Any policy which provides the insurance required under this paragraph shall: (a) be endorsed to name "The Boeing Company and its subsidiaries and their respective directors, officers, employees, agents, attorneys and assigns" as additional insureds (hereinafter "Additional Insured") with respect to any liability arising out of Grantee's presence on the Property (or such contractor's presence as the case may be); (b) be endorsed to be primary to any insurance maintained by The Boeing Company; (c) contain a DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 9 of 16 severability of interest provision in favor of the Additional Insured; and (d) contain a waiver of any rights of subrogation against the Additional Insured. If licensed vehicles will be used in connection with this Temporary Construction Easement, Grantee shall ensure that any contractor who uses licensed vehicles in connection with this Temporary Construction Easement carries and maintains, Automobile Liability insurance covering all vehicles, whether owned, hired, rented, borrowed or otherwise, with limits of liability of not less than One Million Dollars ($1,000,000) per occurrence combined single limit for bodily injury and property damage. Grantee shall ensure that any contractor covers or maintains, insurance in accordance with the applicable laws relating to workers' compensation, with respect to all of their respective employees working on or about the Easement Premises, regardless of whether such coverage of insurance is mandatory or merely elective under the law. No contractor shall access the Easement Premises unless such contractor shall have first provided a certificate of insurance reflecting full compliance with the requirements set forth herein. Such certificate shall list The Boeing Company as certificate holder and shall be kept current and in compliance throughout the period of this permit and shall provide for thirty (30) days advance written notice to Grantee in the event of cancellation. The insurance provisions in this Section 5.2 can be substituted with self‐insurance. 6. Easement to Run with Land: All right, title and privileges herein granted, including all benefits and burdens, shall run with the land and shall be binding upon and inure to the benefit of the Parties, their respective heirs, executors, administrators, successors, assigns and legal representatives. 7. Grantor’s Use of the Easement Area During Construction: 7.1 Grantor reserves the right to use the Easement Area so long as such use does not interfere with the temporary construction activities or exclusive rights granted to the Grantee under this Agreement, except as necessary for repair of its underground utilities in case of an emergency. In that connection, Grantor shall have a permanent right to enter upon the Easement Area, in coordination with Grantee, to survey, construct, repair, remove, replace, reconstruct, inspect, improve and maintain its underground utilities. Grantor shall exercise its rights under this DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 10 of 16 Easement so as to minimize in scope and duration, and subject to Section 7.3 avoid if reasonably possible, all interference with Grantee's use of the Easement Area, including in case of emergency. Grantor shall provide advanced notice to Grantee of interference, and shall not proceed with any interference enduring more than twenty‐four (24) hours unless and until Grantee consents, which consent shall not be unreasonably withheld and may be accompanied by conditions. 7.2 Grantee shall upon completion of any of its work within the Easement Area, immediately restore the surface of the Easement Area and any public or private improvements therein disturbed or destroyed during execution of the work as nearly as practicable to the condition they were in immediately before commencement of the work or entry by the Grantee; provided, however, that no such restoration is necessary for the portion of the Easement Area that is intended to be permanently occupied by improvements associated with the Project. Grantor, its successors, assigns and/or subsequent Grantors, will not alter or improve the Easement Area or grant any easements over, under, upon, and/or across said property without first obtaining the written consent of the Grantee. Such consent will not be unreasonably withheld by the Grantee. 7.3 Notwithstanding any provision in this Easement to the contrary, Grantor shall have the right to cross upon the surface of the Easement Area with its vehicles, whether licensed or not; provided that Grantee’s construction activities may result in intermittent suspensions of Grantor’s crossing right, which shall be coordinated between Grantee and Grantor. Grantee acknowledges that the foregoing restrictions apply only to the activities of Grantor and do not apply to the activity of Burlington Northern or any other railroad operating on tracks that the extension of Park Avenue will cross. Grantor and Grantee acknowledge and agree that neither of them has any power, right, or authority to control the movement of trains along such tracks, nor to prevent, regulate, or sanction any rail operator who blocks passage on the Easement Area in connection with its rail operations. 8. Duration of Easement; Compensation: This Agreement shall become effective on the “Effective Date.” The Effective Date is the later of the date by which this Agreement has been executed by both Parties and the date on which Grantee pays to Grantor the “Initial Payment.” The “Initial Payment” is the amount of $188,546.95 (one hundred eighty‐eight thousand five hundred forty‐six dollars and ninety‐five cents). DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 11 of 16 The Easement granted by this Agreement shall expire twelve (12) months after the construction start date stated in a Notice to Proceed that Grantee will issue to Grantee’s contractor with a copy to Grantor. This 12‐month expiration date is hereinafter the “Scheduled Completion Date.” If prior to the Scheduled Completion Date Grantee delivers a notice to Grantor stating that the Project will not be completed by the Scheduled Completion Date, the term of this Agreement will be extended six (6) months (the “Extended Completion Date”) upon the payment by Grantee to Grantor of an extension fee equal to $94,273.48. If prior to the Extended Completion Date Grantee delivers a notice to Grantor stating that the Project will not be completed by the Extended Completion Date, the term of this Agreement will be extended by a further six (6) months (the “Second Extended Completion Date”) upon the payment by Grantee to Grantor of an extension fee equal to $94,273.48. All payments from Grantee to Grantor shall be paid as follows: The Boeing Company Global Real Estate PO Box 842289 Dallas TX 75284‐2289 Reference: GG|6703000|GGPSSG11058|SSG11058|X|GG|PUCR|699 If the Project is not fully completed by the Second Extended Completion Date, the Grantee shall cease work on the Project. Grantor and Grantee shall consult with each other and shall negotiate such financial arrangements and other arrangements as may be necessary to resolve the issues that have led to the situation as it then exists. 9. Warranty of Authority: Grantor hereby represents, warrants, and covenants to Grantee that it has sufficient property interests and the legal authority to execute this Agreement; and that there are no easements, covenants, restrictions, encumbrances or defects on or to the title of the Easement Premises that will in any way affect or impair Grantee’s or Grantor’s ability to perform their respective obligations under this agreement. 10. Notices: All notices or other communications required or permitted hereunder shall be in writing, and shall be sent (a) by nationally recognized overnight courier service with all charges for next business day delivery prepaid or (b) by PDF or similar attachment to an email, provided that such email attachment shall be followed within one (1) business day by delivery of such notice pursuant to clause (a) above, and shall be effective upon receipt at DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 12 of 16 the appropriate address below except for environmental matters covered by Section 3 (provided that if any notice or other communication to be delivered by email attachment as provided above cannot be transmitted because of a problem affecting the receiving party’s computer, the deadline for receiving such notice or other communication shall be extended through the next business day). To Grantee: City of Renton Public Works Department 1055 South Grady Way Renton, WA 98057 Attention: Public Works Administrator Telephone: 425‐430‐7311 Email: mpastucha@rentonwa.gov With a copy to: Renton City Attorney 1055 South Grady Way Renton, WA 98057 Attention: Shane Moloney Telephone: 425‐430‐6487 Email: smoloney@rentonwa.gov To Grantor: The Boeing Company c/o MBG Consulting, Inc. 980 N. Michigan Avenue, Suite 1000 Chicago, IL 60611 With a copy to: Boeing Planning & Real Estate 153 James S. McDonnell Blvd. MC S221‐1400 Hazelwood, MO 63042 Attention: Marc A. Poulin Telephone: 314‐409‐3576 Email: marc.a.poulin@boeing.com DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 13 of 16 With a copy to: Boeing Law Department 7755 E. Marginal Way S, MC 11‐XT Seattle, WA 98108 Attention: G. Bresslour Telephone: (206) 662‐6588 Email: gerald.l.bresslour@boeing.com Notice of change of address shall be given by written notice in the manner detailed in this Section 10. Rejection or other refusal to accept or the inability to deliver because of changed address of which no notice was given shall be deemed to constitute receipt of the notice, demand, request or communication sent. The attorneys for any party hereto shall be entitled to provide any notice that a party desires to provide or is required to provide hereunder. 11. Miscellaneous Provisions: 11.1 This Agreement will be effective upon the Effective Date. 11.2 This Agreement may be executed in multiple counterparts, each of which shall be deemed an original, but all of which, together, shall constitute but one and the same instrument. 11.3 This Agreement shall be governed by the law of the State of Washington, without reference to its choice of law rules. 11.4 This Agreement supersedes any prior agreements, negotiations and communications, oral or written, with respect to this subject matter) and contains the entire agreement between and the final expression of the parties with respect to the subject matter hereof. No subsequent agreement, representation, or promise made by either party, or by or to an employee, officer, agent or representative of either party shall be of any effect unless it is in writing and executed by the party to be bound thereby. IN WITNESS WHEREOF, each Party has executed this Agreement as of the dates written below. DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 14 of 16 Grantee: Grantor: The City of Renton The Boeing Company By: _______________________ By: _____________________ Its: _______________________ Its: ______________________ Date: ______________________ Date: _____________________ DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 15 of 16 Notary Seal must be within box STATE OF WASHINGTON ) SS COUNTY OF KING ) On this _______ day of _____________, 20____, before me personally appeared _______________________, to me known to be the _______________________ of The Boeing Company, and acknowledged the foregoing instrument to be the free and voluntary act and deed of said corporation, for the uses and purposes therein mentioned, and on oath stated that s/he was authorized to execute said instrument and that the seal affixed (if any) is the corporate seal of said corporation.. Notary Public in and for the State of Washington Notary (Print)_____________________________________ My appointment expires:____________________________ Dated: DRAFTAGENDA ITEM #5. e) Park Ave Temporary Construction Easement Page 16 of 16 EXHIBIT A‐1 EXHIBIT A‐2 EXHIBIT A‐3 EXHIBIT B EXHIBIT C Basic Requirements for Environmental Management Plans DRAFTAGENDA ITEM #5. e) EXHIBIT A-1 LEGAL DESCRIPTION OF THE PROPERTY LOT 6, BOEING LAKESHORE LANDING, A BINDING SITE PLAN, RECORDED DECEMBER 23, 2004, UNDER RECORDING NO. 20041223000856, IN KING COUNTY, WASHINGTON; EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED DECEMBER 12, 2006, RECORDERS NO. 20061212000338; AND EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED NOVEMBER 2, 2009, RECORDERS NO. 20091102002105; AND EXCEPT THAT PORTION DESCRIBED IN DEED OF DEDICATION TO THE CITY OF RENTON, RECORDED NOVEMBER 2, 2009, RECORDERS NO. 20091102002360; AND EXCEPT THAT PORTION CONVEYED TO CITY OF RENTON, A MUNICIPAL CORPORATION BY DEED OF DEDICATION RECORDED SEPTEMBER 10, 2015 UNDER RECORDING NOS. 20150910000182 AND 20150910000183 AND RE-RECORDED JULY 07, 2016 UNDER RECORDING NO. 20160707000538. ASSESSORS PARCEL NUMBER: 088660-0060-03 DRAFTAGENDA ITEM #5. e) EXHIBIT A-2 TEMPORARY CONSTRUCTION EASEMENT LEGAL DESCRIPTION A PORTION OF LOT 6 OF THE BINDING SITE PLAN FOR BOEING LAKESHORE LANDING, ACCORDING TO THE PLAT THEREOF RECORDED IN AUDITOR’S FILE NO. 20041223000586, RECORDS OF KING COUNTY, WASHINGTON, DESCRIBED AS FOLLOWS: COMMENCING AT THE EASTERNMOST POINT OF SAID LOT 6, SAID POINT BEING ON THE NORTH RIGHT OF WAY MARGIN OF SOUTHPORT DRIVE NORTH; THENCE SOUTH 43°47’24” WEST, ALONG THE SOUTHEAST LINE OF SAID LOT AND SAID NORTH MARGIN, A DISTANCE OF 290.47 FEET TO THE BEGINNING OF A CURVE TO THE RIGHT HAVING A RADIUS OF 933.50 FEET AND A BEARING OF NORTH 46°12’36” WEST TO THE CENTER, SAID POINT HEREINAFTER REFERRED TO AS POINT A AND THE POINT OF BEGINNING; THENCE SOUTHWESTERLY ALONG SAID CURVE AND LINE THROUGH A CENTRAL ANGLE OF 30°27’44” AND AN ARC LENGTH OF 496.31 FEET; THENCE SOUTH 15°44’55” EAST, ALONG SAID LINE, A DISTANCE OF 63.13 FEET; THENCE SOUTH 70°07’05” WEST, ALONG SAID LINE, A DISTANCE OF 88.33 FEET; THENCE NORTH 39°39’15” WEST, A DISTANCE OF 107.79 FEET TO A POINT ON THE NORTHWEST LINE OF SAID LOT; THENCE NORTH 53°24’44” EAST, ALONG SAID LINE, A DISTANCE OF 270.09 FEET; THENCE NORTH 50°42’51” EAST, ALONG SAID LINE, A DISTANCE OF 324.76 FEET; THENCE SOUTH 39°17’09” EAST, A DISTANCE OF 137.41 FEET TO THE POINT OF BEGINNING. EXCEPTING FROM THE TEMPORARY CONSTRUCTION EASEMENT THE AREA DESCRIBED BY THE FOLLOWING: COMMENCING AT THE HEREINBEFORE DESCRIBED POINT A; THENCE SOUTH 71°00’19” WEST A DISTANCE OF 85.81 FEET TO A POINT HEREINAFTER REFERRED TO AS POINT B; THENCE SOUTH 10°35’19” WEST A DISTANCE OF 29.85 FEET; THENCE SOUTH 50°44’41” WEST A DISTANCE OF 41.38 FEET; THENCE NORTH 39°15’19” WEST A DISTANCE OF 5.00 FEET; THENCE SOUTH 50°44’41” WEST A DISTANCE OF 30.00 FEET; THENCE SOUTH 39°15’19” EAST A DISTANCE OF 5.00 FEET; THENCE SOUTH 50°44’41” WEST A DISTANCE OF 35.86 FEET; DRAFTAGENDA ITEM #5. e) THENCE NORTH 39°23’37” WEST A DISTANCE OF 53.07 FEET; THENCE NORTH 50°36’23” EAST A DISTANCE OF 5.00 FEET; THENCE NORTH 39°23’37” WEST A DISTANCE OF 39.15 FEET; THENCE NORTH 50°41’06” EAST A DISTANCE OF 111.80 FEET; THENCE SOUTH 89°06’31” EAST A DISTANCE OF 5.88 FEET; THENCE NORTH 49°55’58” EAST A DISTANCE OF 8.00 FEET; THENCE SOUTH 40°04’02” EAST A DISTANCE OF 69.44 FEET TO THE HEREINBEFORE DESCRIBED POINT B AND THE POINT OF BEGINNING. HAVING AN AREA OF 62,175 SQUARE FEET, OR 1.43 ACRES, MORE OR LESS. DRAFTAGENDA ITEM #5. e) PLPLPLPLPARK AVENUE N EXTENSION DRAWN BY:DATE: EXHIBIT A-3 SEC. 8, T. 23 N., R. 5 E., W.M. 1ALLIANCE GEOMATICS SURVEYING & MAPPING 1261A 120TH AVE NE Ph: (425) 598-2200 Bellevue, Washington 98005 Fax: (425) 502-8067NORTHASSESSOR'S PARCEL NO. 0886600060 THE BOEING COMPANY LOT 6, BINDING SITE PLAN AF# 20041223000856 LOGAN AVENUE NASSESSOR'S PARCEL NO. 0823059027 BNSF RAILROADLINE TABLE PARK AVE N U E N NORTH EXCEPTION TO TEMPORARY CONSTRUCTION EASEMENT POC S 43°47'24" W290.47'L=496.31' R=933.50' =30°27'44" S 15°44'55" E63.13' N 39°39'15" W 107.79' S 70°07'05" W88.33' POINT A POINT B POINT B N 50°41'06" E111.80'S 4 0 ° 0 4 '0 2 " E 6 9 . 4 4 ' N 3 9 ° 2 3 ' 3 7 " W 5 3 . 0 7 'L1L 2 L3L4L 5 L6 L7L7 N 49°55'58" E 8.00' L6 S 89°06'31" E 5.88' L5 N 39°23'37" W 39.15' L4 N 50°36'23" E 5.00' L3 S 50°44'41" W 35.86' L2 S 39°15'19" E 5.00' L1 S 10°35'19" W 29.85' POB= POINT OF BEGINNING POC= POINT OF COMMENCEMENT SOUTHPORT DRIVE NTOTAL AREA OF EASEMENT 62,175 SQ. FT. N 50°42'51" E324.76'N 53°24'44" E270.09'L10L9 S 39°17'09" E 137.41'L9 S 50°44'41" W S 50°44'41" W 30.00'41.38'L 8 N 39°15'19" W 5.00'L8 L=496.31' R=933.50' =30°27'44" POB AND N 50°42'51" E324.76'S 71°00'19" W 85.81'L10DRAFT AGENDA ITEM #5. e) Task Name Key Project Dates Boeing Concurrence on General Project Configuration Fri 09/07/18 Boeing Ad & Award Thu 03/11/2021 Boeing construct conduit and vault system Thu 04/29/2021 Boeing pull new wires Thu 06/24/2021 Boeing Easements (TCE & PE) executed Fri 01/29/2021 BNSF Construction & Maintenance Agreement Fri 2/26/2020 BNSF Track Reconstruction/Gate Intallation Wed 04/21/2021 Final Design - Ad Ready (Perteet/Chudgar)Fri 12/18/2021 City Advertise for Construction Thu 03/11/2021 Bid Period Mon 3/22/2021 Open Bids Wed 3/24/2021 Award Contract Wed 3/31/2021 Mayor Execute Contract Wed 04/28/2021 NTP City Contractor Thu 05/06/2021 Construction Period (City Improvements)Wed 10/20/2021 Exhibit B Statement of Work and Project Schedule The purpose of the Park Avenue North Extension Project is to construct improvements to extend North Park Avenue from the existing intersection with Logan Avenue North northward across both Boeing and BNSF Property to connect to the Southport site, and includes the following elements: • Paving of roadway, sidewalk, curbs and gutters • Utility installation • Signalization and signage installation • Construction of a railroad crossing •Illumination installation • Landscaping • Slope protection The work includes but is not limited to: excavation; grading; sawcutting; removal of pavement; removal of concrete curb, gutter and sidewalk; water main installation; storm drainage installation; illumination system installation; traffic signal system installation; forming and placement of concrete curb, gutter, sidewalk and ADA curb ramps; paving with asphalt; paving with cement concrete; adjustments to utility frames, grates and covers; installation of street channelization; property restoration and all other work necessary to complete the Work as specified and shown in the Contract Provisions. Schedule DRAFTAGENDA ITEM #5. e) EXHIBIT C Basic Requirements for Environmental Management Plans The Boeing Company (“Boeing”) and the City of Renton (the “City”) will agree on a set of environmental plans to be referenced in the Permanent Easement and the Temporary Construction Easement (collectively, the “Easements”). The set of environmental plans will consist of the following four plans: (1) Soil Management Plan; (2) Construction Water Management Plan; (3) Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP); and (4) Spill Response Plan. These four plans are, collectively, the “Environmental Management Plans.” This document sets forth certain terms that will be included in the Environmental Management Plans and the process that will apply to finalizing the Environmental Management Plans. If, during the term of the Permanent Easement, the City proposes to conduct Onsite Work, as defined in the Easements, it will either adhere to the Environmental Management Plans or, in advance, it will propose a new set of Environmental Management Plans to govern such work following the same process described in Section B below. A. TERMS Below are terms that the Parties agree will be included in the Environmental Management Plans. 1. Soil Management Plan The City’s Soil Management Plan shall address methods for the following: i. Stockpiling and segregating soils during excavation, which methods shall exclude any comingling of Boeing‐property generated soils with non‐Boeing property generated soils. ii. Managing any containers brought on site for holding soils and wastewater during Onsite Work (defined as: any activity involving physical alteration of the Easement Area for the purposes of initiating or continuing construction) among other things to ensure that containers are and remain environmentally clean. iii. Methods to backfill excavations first with all site soils removed during excavation, unless suspected contamination is encountered, or soils are not suitable for City’s project use. iv. Procedures to ensure soils/rocks are appropriately covered during construction and any off‐site transportation. v. Procedures in the event suspected contamination is encountered during construction, including the following:  Notification of suspected contamination to Boeing’s point of contact. DRAFTAGENDA ITEM #5. e)  Determination and implementation by the City of characterization, excavation, profiling, and disposal requirements for excavated soil and other excavated material. vi. With respect to soils that have been excavated, or will/may be excavated, for project construction purposes that are not able to be replaced on‐site, and the soils were not removed because of suspected contamination:  City to ensure soils from Boeing properties are not comingled with soils brought in from other locations for disposal purposes.  City may only sample for environmental characterization/disposal purposes after excavation and after City determination that soils may not be replaced on‐site.  City notification of Boeing point of contact of soil analytical/waste profiling results prior to disposal of soils off‐site.  City notification of Boeing point of contact of selected disposal facility in advance of proper soil disposal at off‐site facility.  Methods to ensure disposal of property soils in the following order of preference: i. Landfill as alternate daily cover. ii. Direct landfill disposal as waste. iii. City is prohibited from disposing of Boeing property soils for any unrestricted or sensitive re‐use, or other non‐landfill disposal purposes. ix. City management and appropriate disposal of all investigative‐derived waste to an appropriate landfill, including any soil and wastewater not already addressed above. x. If City plans to import soil or structural fill with soil components for placement in the Easement Area, City to provide import fill profile data for environmental contaminants to Boeing point of contact for prior approval at least one week in advance. Boeing will respond within five days of receipt and will not unreasonably withhold approval.  Imported soil or structural fill with soil components must meet Washington Model Toxics Control Act Method A Unrestricted Land Use Criteria for the following analytes:  NWTPH (full range gas to heavy) + benzene  VOCs (EPA Method 8260B)  RCRA 8 metals + copper (Cu)  Advance approval not required for crushed rock or landscaping topsoil if these meet applicable Washington Model Toxics Control Act requirements. The Soil Management Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. 2. Construction Water Management Plan DRAFTAGENDA ITEM #5. e) The City’s Construction Water Management Plan shall address methods for the following: i. Management and disposition of all water streams generated by the City’s Onsite Work at the Property, including excavation dewatering, any wastewater discharge to sanitary or any construction dewatering water discharged to storm sewer [including as covered by any discharge permits that City will procure], and wastewater removed off‐site for disposal. ii. Providing for the City’s prompt provision of the City’s wastewater monitoring/sampling results to the Boeing point of contact. The Construction Water Management Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. 3. Stormwater Management and/or Stormwater Pollution Prevention Plan (SWPPP) The City’s Stormwater Management Plan and/or SWPPP shall address methods for all legally‐ required and otherwise appropriate storm water management practices, including the following: i. City compliance with any other existing Construction Stormwater Permit (CSP) that covers the Easement Area, whether it belongs to Boeing or another party, if still in place during the City’s Easement‐related construction activities. ii. City application for and compliance with any now or later required stormwater permits of any kind. iii. City construction of stormwater collection and conveyance structures to ensure that City and Boeing stormwater flows shall remain segregated to the greatest extent possible as now provided for in the City’s stormwater infrastructure and drainage plan. iv. City maintenance of Easement Area stormwater drains or other infrastructure (including clean‐outs and response to any impacts from spills) for as long as the Easement is in effect. v. Provision to Boeing point of contact a copy of all stormwater monitoring and sampling results/reports. vi. City notification to Boeing point of contact of any permit violations within 24 hours of the violation’s inception or as soon as practicable. vii. City implementation of any corrective actions required by regulators related to stormwater violations. DRAFTAGENDA ITEM #5. e) The Stormwater Management Plan and/or SWPPP shall state that the City is responsible for all costs associated with complying with the plan(s), including any costs incurred by the City for stop‐ work events related to any unplanned or contingent events. 4. Spill Response Plan The City’s Spill Response Plan shall address methods for the following: i. City’s immediate (with “immediate” to be defined in plan) response to spills or releases of regulated or Hazardous Substances as required by law as a result of the Grantee’s use or authorized or unauthorized public use of the Easement Area and as long as the Easement is in effect. ii. City’s immediate (same note as above re “immediate”) notification to Boeing point of contact of any spills or releases of regulated or Hazardous Substance and associated response actions taken. iii. City’s handling, removal, and disposal of all such spills and releases, including City sampling to verify completed remediation of spill impacts to soils, groundwater, surface water, stormwater, or other environmental media as applicable. iv. City’s determination of waste characterization for disposal purposes, including the following: a. For regulated waste, prior to disposal, City shall provide City’s waste characterization/profile and selected disposal location to Boeing point of contact. City shall provide Boeing point of contact verification of final disposal after completion. b. For non‐regulated waste, City shall provide advance notification to Boeing point of contact of waste disposal characterization and selected disposal facility. v. City shall comply with applicable laws and regulations for spill response and clean‐up. The Spill Response Plan shall state that the City is responsible for all costs associated with complying with the plan, including any costs incurred by the City for stop‐work events related to any unplanned or contingent events. B. PROCESS Below is the agreed process for development and finalizing of the Environmental Management Plans. 1. The City will deliver to Boeing’s point of contact proposed written plans for each of the four Environmental Management Plans. DRAFTAGENDA ITEM #5. e) 2. Boeing will review each submission and will either approve or reject each submission within 14 calendar days of receipt. If Boeing does not respond within 14 calendar days, the plan will be deemed accepted by Boeing. This section applies both to original and revised submissions. 3. If Boeing determines it will reject all or portions of any of the Environmental Management Plans, it will provide detailed comments explaining the basis for its objections. For each plan so rejected, the City then will provide a revised plan addressing Boeing’s comments. The EHS Project Managers of the parties will meet as necessary to engage in prompt and good faith dialog in an effort to resolve Boeing’s comments. This paragraph applies both to original and revised submissions. 4. In the event the EHS Project Managers are unable to resolve issues of dispute, the issues will be referred to the Boeing Renton Site EHS Director and the City’s Environmental Manager for resolution. The On Site Work will not proceed absent a resolution of the dispute. DRAFTAGENDA ITEM #5. e) THE BOEING COMPANY COMPENSATION AGREEMENT FOR COST TO CURE FOR PARK AVENUE NORTH EXTENSION THIS AGREEMENT, dated for reference purposes only as Month XX, XXXX, is by and between the City of Renton (the “City”), a Washington municipal corporation, and The Boeing Company (“Boeing”), a Delaware corporation. The City and Boeing are referred to collectively in this Agreement as the “Parties.” Once fully executed by the Parties, this Agreement is effective as of the last date signed by both Parties. 1. Purpose: As set forth in the Permanent Easement for the Park Avenue North extension project granted by Boeing and granted to the City (the “Permanent Easement”), as a cost to cure, the City agreed to compensate Boeing for (1) the full cost of reconstructing Boeing’s electrical distribution system that currently exists within the Easement Area, as that term is defined in the Permanent Easement, based upon final plans that are mutually acceptable to Boeing and the City, (2) the full cost of moving Boeing’s existing protected site entrance currently located at Lake Washington Boulevard N. (“Existing Protected Site Entrance”), to a new location on Logan Avenue N. at approximately N. 7th Street (“New Protected Site Entrance”), based upon final plans that are mutually acceptable to Boeing and the City, and (3) the full cost of closing and removing the Existing Protected Site Entrance once the New Protected Site Entrance is complete. Collectively, these three work items are hereinafter the “Work.” In the Permanent Easement, the City also agreed to compensate Boeing for design associated with the Work and for the value of property acquisition, but the Parties have separately addressed these issues. The purpose of this Agreement is to establish criteria for Boeing’s performance of the Work and for the City’s compensation to Boeing for the Work. 2. Scope of Work: A. Boeing shall perform that portion of the Work associated with relocating Boeing’s electrical distribution system in accordance with the Park Ave N Extension / Renton Site Plans dated March 25, 2020, except as and to the extent that such plans are updated as agreed by the Parties. B. Boeing shall perform that portion of the Work associated with moving the Existing Protected Site Entrance to the New Protected Site Entrance and associated with closing the Existing Protected Site Entrance in accordance with the N. 7th Street Plans dated XXX, except as and to the extent that such plans are updated as agreed by the Parties. AGENDA ITEM #5. e) PAGE 2 OF 3 C. Boeing shall have no responsibility for obtaining any permits for the Work. 3. Time of Performance: Boeing shall commence performance of the Work upon execution of this Agreement or the Permanent Easement, whichever occurs last. 4. Compensation: A. Amount. Total compensation to Boeing for the Work provided pursuant to this Agreement is estimated at $1,355,481. Compensation shall be paid based upon the cost of Work actually performed. B. Method of Payment: On a monthly or no less than quarterly basis, Boeing will send to the City detailed invoices documenting progress completed on the Work. Payment shall be made by the City within thirty (30) calendar days after receipt and approval by the City of the invoice. Boeing shall submit a final invoice within six (6) months of completion of all Work. The City shall make payments to Boeing at the following place: The Boeing Company Global Real Estate PO Box 842289 Dallas TX 75284‐2289 Reference: GG|6703000|GGPSSG11058|SSG11058|X|GG|PUCR|699 5. No Termination: This Agreement is non‐terminable unless the Parties terminate the Permanent Easement. 6. Notices: All notices and other communications (including the transmittal of invoices from Boeing to the City) required or permitted hereunder shall be in writing, and shall be sent (a) by US Mail or (b) by PDF or similar attachment to an email, provided that such email attachment shall be followed within three (3) business days by delivery by US Mail. CITY OF RENTON Hebé C. Bernardo 1055 South Grady Way Renton, WA 98057 Phone: (425) 430‐7232 hbernardo@rentonwa.gov THE BOEING COMPANY _______________________ _______________________ _______________________ _______________________ AGENDA ITEM #5. e) PAGE 3 OF 3 7. Other Provisions: A. Approval Authority. Each individual executing this Agreement on behalf of the City and Boeing represents and warrants that such individuals are duly authorized to execute and deliver this Agreement on behalf of the City or Boeing. B. Amendment and Modification. This Agreement may be amended only by an instrument in writing, duly executed by both Parties. C. Counterparts. The Parties may execute this Agreement in any number of counterparts, each of which shall constitute an original, and all of which will together constitute this one Agreement. IN WITNESS WHEREOF, the Parties have voluntarily entered into this Agreement as of the date last signed by the Parties below. Shane Moloney City Attorney CITY OF RENTON By:_____________________________ THE BOEING COMPANY By:____________________________ Armondo Pavone Mayor Enter Signer’s Name Enter Signer’s Title _____________________________ Date _____________________________ Date Attest _____________________________ Jason A. Seth City Clerk Approved as to Legal Form __________________________ AGENDA ITEM #5. e) AB - 2774 City Council Regular Meeting - 14 Dec 2020 SUBJECT/TITLE: Project Acceptance for the SW Grady Way Overlay Project, CAG-14- 151 with Lakeside Industries, Inc. RECOMMENDED ACTION: Council Concur DEPARTMENT: Transportation Systems Division STAFF CONTACT: Hebé Bernardo, Project Manager EXT.: 7232 FISCAL IMPACT SUMMARY: The original contract amount was $847,338.50 and the final contract amount is $924,613.95. This is an increase of $77,275.45 due to additional work (curb ramp reconstruction and traffic signal modifications) required by the Washington State Department of Transportation (WSDOT) via a letter dated July 31, 2019 requesting the city bring the project into compliance with Public Right -of-Way Accessibility Guidelines (PROWAG), which is a condition of the Federal Highway Administration (FHWA) grant. Failure to bring the project into compliance with PROWAG would have resulted in the loss of FHWA grant funding. SUMMARY OF ACTION: The SW Grady Way Overlay Project contract was awarded to Lakeside Industries, Inc. on January 12, 2015. Construction began June 15, 2015. The project was physically completed November 25, 2019. The Department of Labor and Industries approved the Affidavit of Wages Paid (number 970548) for Miles Sand and Gravel Company on October 7, 2020. Therefore, project closure and archiving has been delayed a year since process cannot begin until all of the Affidavits of Wages Paid are approved. The project consisted of a hot mix asphalt (HMA) overlay of SW Grady Way between Rainier Avenue South and Longacres Drive SW. The project included of a full width pavement grind, 2-3 inch HMA overlay, utility adjustments, striping, curb ramp and pedestrian signal upgrades. EXHIBITS: A. Notice of Completion of Public Works Contract B. Final Contract Voucher STAFF RECOMMENDATION: Accept the SW Grady Way Overlay Project with Lakeside Industries, Inc. and authorize the release of the contract bond upon approval received from the Washington State Department of Labor and Industries, Employment Security Department and Department of Revenue. AGENDA ITEM #5. f) Revised # Assigned to: UBI Number: Yes No Yes Contractor's Name Date:Contractor's UBI Number: Date Work Accepted Federally funded transportation project? Name & Mailing Address of Public Agency E-mail Address Contract Number Notice is hereby given relative to the completion of contract or project described below Description of Work Done/Include Jobsite Address(es) Affidavit ID* No (if yes, provide Contract Bond Statement below) NOTICE OF COMPLETION OF PUBLIC WORKS CONTRACT Project Name Date Assigned: Job Order Contracting Date Contract Awarded Telephone # Bond Number: Retainage Bond Contract/Payment bond (valid for federally funded transportation projects) Name: Department Use Only Original If Retainage is not withheld, please select one of the following and List Surety's Name & Bond Number. Date Work Commenced Date Work Completed Contractor Address Were Subcontracters used on this project? If so, please complete Addendum A. Yes No $ $$ $$ $$ $ $$ Contact Name:Title: F215-038-000 04-2014 Email Address:Phone Number: p Additions ( + ) Amount Retained REV 31 0020e (4/28/14) Amount of Sales Tax Contract Amount Sub-Total Reductions ( - ) Amount Disbursed TOTAL Note: The Disbursing Officer must submit this completed notice immediately after acceptance of the work done under this contract. NO PAYMENT SHALL BE MADE FROM RETAINED FUNDS until receipt of all release certificates. Submitting Form: Please submit the completed form by email to all three agencies below. TOTAL Liquidated Damages Comments: (If various rates apply, please send a breakdown) NOTE: These two totals must be equal p Affidavit ID* - No L&I release will be granted until all affidavits are listed. Contract Release (855) 545-8163, option # 4 ContractRelease@LNI.WA.GOV Employment Security Department Registration, Inquiry, Standards & Coordination Unit (360) 902-9450 publicworks@esd.wa.gov Department of Revenue Public Works Section (360) 704-5650 PWC@dor.wa.gov V e(//) AGENDA ITEM #5. f) Subcontractor's Name:UBI Number: (Required)Affidavid ID* Provide known affidavits at this time. No L&I release will be granted until all affidavits are listed. Addendum A: Please List all Subcontractors and Sub-tiers Below This addendum can be submitted in other formats. For tax assistance or to request this document in an alternate format, please call 1-800-647-7706. Teletype (TTY) users may use the Washington Relay Service by calling 711. REV 31 0020e Addendum (04/28/14)F215-038-000 04-2014 AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) AGENDA ITEM #5. f) FINALCONTRACTVOUCHERCERTIFICATE Contractor Lakeside Industries,Inc. Street Address 18808 SE 256th St. City State Zip DateCovingtonWA980422/‘I1/2020 my Contact Number City ProiectNumber Federal-AidNumber (ifappncable) CAG-14-151 NA STPUL-12BB(O04) Contract Title SW Grady Way Overlay Project Date Work PhysicallyComplete FinalAmount 11/25/2019 $924,613.45 CO NTRACTOPJSCERTIFICATION i,The undersigned,havinxiirstbeen duly sworn,oertifythat I am authorized to sign for the claimant;that in connection with the workperformedandtothebestofmyknowledgenoloan,gratuity or gift in any form whatsoever has been extended to any employee oftheCityofRentonnorhaveIrentedorpurchasedanyequipmentormaterialsfromanyemployeeoftheCityofRamon;I furthercertifythattheattached?nal estimate is a true and correct statement showing all the monies due me from the City of Renmn forworkperformedandmaterialfumlshedunderthiscontract;that I have ref nal estimate and understand thesameandthatIreleasetheCityofKentonfromanyandallclaimsof'h I may have,arising out of theperformanceofsaidcontract,whichare not setforth in said estimate.‘ti‘'.$3'9~5fa= Contractor Authorized Signature (Required)E Es0g£1zu‘.«Mou<v ofeumm.-5 Iwmaaez 3,4% Printed Signature Name '1 @’<3 ’6”lo,,47EO?s\‘'''ISubscribedandswomtobeforemethis/2 -?‘'da‘\"”“‘)\}E8RVARY 20 -70 Naew Public In and forthe State of Q,1555.4/44¢ray residing at 7'7 CITY OF RENTON CERTIFICATION i,oertify7at!ached?nal esti te he hased upon actual measurements,and no true and correct. .4 /"' /‘I //-/§/J g /ZZZ” ‘-Pr ect Manager ggnaiuré bllc‘WantsDept,ion Manager ApfprovédDate CITV OF RENTON ACCEPTANCE The City of Renton hereby accepts the completed contract,pursuant m Section 1-05.12 ofthe Contract Provisions. _.._..__.j._____.j._PublicWorks Administrator Date of Council Acceptance Conmrctal‘claims an must be included and the Canbucto/s Certi cation must be I beled inn?catin a claim ls attodled. AGENDA ITEM #5. f) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, ADOPTING THE FOLLOWING INTERIM ZONING CONTROLS IN RESPONSE TO THE RENTON RED LION COVID‐19 DEINTENSIFICATION SHELTER OPERATING IN THE CITY OF RENTON SINCE APRIL 2020: (1) CLARIFYING AND MODIFYING PRINCIPAL, ACCESSORY, AND UNCLASSIFIED USE REGULATIONS BY AMENDING SUBSECTIONS 4‐2‐050.A, 4‐2‐050.C.4, 4‐2‐050.C.5, AND 4‐2‐050.C.6 OF THE RENTON MUNICIPAL CODE; (2) CLARIFYING AND MODIFYING CERTAIN LAND USE DEFINITIONS IN THE RENTON MUNICIPAL CODE BY AMENDING SUBSECTION 4‐ 2‐060.K OF THE RENTON MUNICIPAL CODE, AMENDING THE DEFINITION OF “DIVERSION FACILITY” AND REMOVING THE DEFINITION OF “DIVERSION INTERIM SERVICE FACILITY” IN SECTION 4‐11‐040 OF THE RENTON MUNICIPAL CODE, AMENDING THE DEFINITION OF “HOTEL” AND ADDING A DEFINITION OF “HOTEL, EXTENDED‐STAY” IN SECTION 4‐11‐080 OF THE RENTON MUNICIPAL CODE, AND AMENDING THE DEFINITION OF “SOCIAL SERVICE ORGANIZATIONS” IN SECTION 4‐11‐190 OF THE RENTON MUNICIPAL CODE; (3) ALLOWING FOR ONE COVID‐19 DEINTENSIFICATION SHELTER TO TEMPORARILY OPERATE IN THE CITY OF RENTON BY ADDING A DEFINITION OF “COVID‐19 DEINTENSIFICATION SHELTER” IN SECTION 4‐11‐030 OF THE RENTON MUNICIPAL CODE AND AMENDING SUBSECTIONS 4‐2‐060.G, 4‐2‐080.A.71, AND 4‐2‐080.A.101 OF THE RENTON MUNICIPAL CODE; AND (4) ALLOWING FOR AND REGULATING LAND USES SERVING THOSE EXPERIENCING HOMELESSNESS BY ADDING A NEW SECTION 4‐4‐045, HOMELESS SERVICES USE, TO THE RENTON MUNICIPAL CODE AND ADDING A DEFINITION OF “HOMELESS SERVICES USE” TO SECTION 4‐11‐080 OF THE RENTON MUNICIPAL CODE; MAKING A LEGISLATIVE DETERMINATION THAT THE ORDINANCE IS EXEMPT FROM FULL COMPLIANCE WITH THE STATE ENVIRONMENTAL POLICY ACT (CHAPTER 43.21.C RCW); PROVIDING FOR SEVERABILITY; DECLARING AN EMERGENCY; AND ESTABLISHING AN IMMEDIATE EFFECTIVE DATE. WHEREAS, in response to the global novel coronavirus (COVID‐19) pandemic and to the regional challenge of homelessness that predated the COVID‐19 pandemic, the Renton City Council wishes to adopt interim zoning and land use legislation that supports those experiencing homelessness and the service providers who are dedicated to serving those experiencing homelessness; AGENDA ITEM # 7. a) ORDINANCE NO. ________ 2 NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The statements set forth in Attachment B are adopted as findings of fact in support of this interim zoning control ordinance adopted herein pursuant to RCW 35A.63.220 and RCW 36.70A.390 and interpretative and applicable judicial decisions, and are found to be true and correct in all respects. SECTION II. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION III. Subsections 4‐2‐050.A, 4‐2‐050.C.4, 4‐2‐050.C.5, and 4‐2‐050.C.6 of the Renton Municipal Code are amended as shown below. All other provisions in 4‐2‐050 remain in effect and unchanged. 4‐2‐050 PERMITTED LAND USES ESTABLISHED: A. CATEGORIES OF USES ESTABLISHED: This Section establishes permitted, conditional, accessory and prohibited uses, by zone, for all properties within the Renton City Limits. All uses in a given zone are one of six (6) types: PERMITTED USES: Land uses allowed outright within a zone as a principal use. Permitted uses are distinct from other uses listed separately in RMC 4‐2‐060, Zoning Use Table – Uses Allowed in Zoning Designations and/or as defined. CONDITIONAL USES (ADMINISTRATIVE): Land uses which may be permitted as a principal use within a zoning district following review by the Development AGENDA ITEM # 7. a) ORDINANCE NO. ________ 3 Services Division Director Administrator to establish conditions mitigating impacts of the use and to assure compatibility with other uses in the district. CONDITIONAL USES (HEARING EXAMINER): Land uUses with special characteristics that may not generally be appropriate within a zoning district, but may be permitted as a principal use subject to review by the Hearing Examiner to establish conditions to protect public health, safety and welfare. ACCESSORY USES: Uses customarily incidental and subordinate to the a principal use and located within the same structure as the principal use or otherwise upon the same lot site occupied by the a principal use or on an abutting/adjacent lot that is under the same ownership as the principal lot. Some accessory uses are specifically listed, particularly where a use is only allowed in an accessory form, whereas other accessory uses are determined by the Development Services Division Administrator on a case‐by‐case basis per RMC 4‐ 2‐050C4 and C6, Accessory Use Interpretations and Unclassified Uses. PROHIBITED USES: Any use which is not specifically enumerated or interpreted by the City as allowable in that district. Any use not specifically listed as a permitted, conditional, or accessory use is prohibited, except those uses determined to be unclassified and permitted by the Development Services Division Director Administrator pursuant to RMC 4‐2‐0404‐2‐050C6. Any prohibited use is illegal and is a misdemeanor punishable under RMC 1‐3‐1, Penalties. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 4 UNCLASSIFIED USE: A use which does not appear in a list of permitted, conditionally permitted, or accessory uses, but which is interpreted by the Development Services Division Director Administrator as similar to a listed permitted, conditionally permitted or accessory use, and not otherwise prohibited, pursuant to RMC 4‐2‐050C6, Unclassified Uses. B. ZONING USE TABLES ESTABLISHED: The following tables establish whether a specific use is permitted in a zoning district and whether the use is allowed as “permitted,” “conditional,” or “accessory” use. The zone is located on the horizontal row and the specific use is located on the vertical column of these tables. C. INTERPRETATION OF ZONING USE TABLES: 1. Legend: The following letters have the following meanings when they appear in the box at the intersection of the column and the row: P Permitted Use AD Conditional Use – Administrative H Conditional Use – Hearing Examiner AC Accessory Use 2. Other Requirements Applicable: The above uses are subject to the review procedures specified in chapter 4‐9 RMC, Permits – Specific, the development standards of chapters 4‐3, Environmental Regulations and Overlay Districts, 4‐4, City‐Wide Property Development Standards, and 4‐6, Street and Utility Standards, and may be subject to additional conditions as noted in AGENDA ITEM # 7. a) ORDINANCE NO. ________ 5 subsection C3 of this Section. The Aquifer Protection Regulations of RMC 4‐3‐050, Critical Areas Regulations, further restrict usage of those properties located within the Aquifer Protection Area Boundary shown in RMC 4‐3‐050Q, Maps. 3. Additional Use‐Related Conditions: If a number also appears at the intersection of the column and the row, the use is also subject to the additional requirements as listed immediately following the use table in RMC 4‐2‐080, Conditions Associated with Zoning Use Tables. All applicable requirements shall govern a use whether specifically identified in this Chapter or not. 4. Accessory Use Interpretations: The Development Services Division Director Administrator mayshall determine if an unclassified use or a classified use, even if not specifically listed as accessory (AC), is permitted as an accessory use in a zone. Upon inquiry written application by an applicant, an administrative interpretation shall be made by the Development Services Division Director Administrator to determine if a proposed use is allowed as an accessory use utilizing the rules of interpretation in subsection C4a of this Section. If the applicant does not concur with the interpretation of whether a use is accessory or with the permit type applied to a use, appeal may be made pursuant to RMC 4‐8‐ 110, Appeals. Interpretations made by the Development Services Division Director Administrator shall be documented, and updates to Title 4, when consistent with the title format and level of detail, shall incorporate “accessory use” interpretations upon approval by the legislative authority. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 6 a. Rules of Interpretation for Accessory Uses: To determine whether a use is permitted as accessory, the Development Services Division Director Administrator shall utilize the following rules of interpretation: i. If a use is allowed or conditionally allowed in a zone as a “permitted” use, accessory uses associated with the primary use that are determined to be incidental, necessary and commonly found with the permitted use may be allowed with the same permit type as the primary use, unless specifically stated otherwise. ii. If a use is permitted or conditionally permitted as a primary use, subject to location restrictions, the listed use, even as an accessory use, is also subject to the same location restrictions as the primary use, unless specifically stated otherwise. For example, if a use is restricted to a location within the Employment Area (EA) land use designation, then the accessory form of the use is only permitted in the EA, unless specifically stated otherwise. iii. Required parking, required site utilities/facilities, and other development standards required in order to establish or operate a use on a site according to the RMC are considered accessory. 5. Prohibited Uses: If no symbol appears in the box at the intersection of the column and the row, the use is prohibited in that district unless otherwise determined by the Development Services Division Director Administrator, pursuant to this subsection C6 of this Section, Unclassified Uses, or subsection C4, Accessory Use Interpretations. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 7 6. Unclassified Uses: Upon inquirywritten application by an applicant, an administrative interpretation shall be made by the Development Services Division Director Administrator to determine if a proposed use, not specifically listed, is allowed utilizing the criteria in subsection C6a of this Section. Should interpretation be made that a proposed, unlisted use not be allowed in a specific zoning district, the Director Administrator shall indicate which zones, if any, do permit the use subject to locational restrictions and development standards. If the Development Services Division Director’s Administrator’s interpretation indicates that an unlisted use is not consistent with the permitted, conditional or accessory uses in any district, or if a party does not concur with the permit type applied to a use, appeal may be made to the City’s Hearing Examiner pursuant to RMC 4‐8‐ 110, Appeals. Interpretations made by the Development Services Division Director Administrator shall be documented, and updates to Title 4 shall be updated , when consistent with the title format and level of detail, shallto incorporate respond to “unclassified use” interpretations upon approval by the legislative authoritymade by the Administrator. a. Criteria for Unclassified Uses: In order to make a determination that an unclassified use is permitted, conditionally permitted or accessory, the Development Services Division Director Administrator must find that the use is: i. In keeping with the purpose and intent of the zone, and consistent with the Renton Comprehensive Plan policies and other adopted plans as may be applicable; and AGENDA ITEM # 7. a) ORDINANCE NO. ________ 8 ii. Similar in nature to, and no more intense than, a specifically listed permitted, conditional or accessory use; and iii. Consistent with subsection C4 of this Section, if determined to be permissible as an accessory use. 7. Use Table Conflicts: In the event of a conflict between RMC 4‐2‐060, the Master Zoning Use Table and any other individual zoning use tables, RMC 4‐2‐ 070A through 4‐2‐070S, the provisions of RMC 4‐2‐060 shall have priority. 8. Existing Legal Nonconforming Uses: Where the term “existing” follows a listed use type within the table(s) (e.g., horticulture nurseries, existing), then those who can document that their nonconforming uses were legal at the time the nonconforming uses were established will be permitted to continue those nonconforming uses and given all the rights of other permitted uses within the district. In addition, these uses may be rebuilt “as is, where is” should they suffer damage. These uses may be remodeled without limitation on value and may be enlarged subject to current code requirements (e.g., height limits, lot coverage, density limits, setbacks, parking, etc.), unless otherwise specifically conditioned in RMC 4‐2‐080. SECTION IV. Subsection 4‐2‐060.G of the Renton Municipal Code is amended by modifying one row and adding two rows, and 4‐2‐060.K of the Renton Municipal Code is amended by adding one row, all as shown in Attachment A. All other provisions in 4‐2‐060 remain in effect and unchanged. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 9 SECTION V. Subsections 4‐2‐080.A.71 and 4‐2‐080.A.101 of the Renton Municipal Code are amended as shown below. All other provisions in 4‐2‐080.A remain in effect and unchanged. 71. Specified use(s) are only allowed south of I‐405. Diversion facilities shall be limited to serving no more than one hundred (100) individuals at any time. 101. Reserved.As many as one (1) COVID‐19 deintensification shelter may operate within the City of Renton without obtaining a conditional use permit to operate as a Homeless Services Use. The following applies to a COVID‐19 deintensification shelter operating pursuant to this exemption from the conditional use permit requirements that would otherwise apply to a Homeless Services Use: a. After June 1, 2021, the COVID‐19 deintensification shelter shall not serve more than one hundred twenty‐five (125) persons at any time; and b. The COVID‐19 deintensification shelter shall cease operations no later than January 1, 2022, after which date the COVID‐19 deintensification shelter will be unlawfully operating if it does not hold a valid conditional use permit for a Homeless Services Use and is not operating in a location in which Homeless Services Uses are allowed. SECTION VI. Chapter 4‐4 RMC of the Renton Municipal Code is amended to add Section 4‐4‐045, Homeless Services Use, to read as shown below. 4‐4‐045 HOMELESS SERVICES USE: A. PURPOSE: The purpose of this Section is to provide zoning and land use regulations for homeless services uses that are proposed to or that do primarily provide shelter AGENDA ITEM # 7. a) ORDINANCE NO. ________ 10 to one or more populations of people experiencing or transitioning from homelessness. B. APPLICABILITY: This Section applies to all homeless services uses, except as expressly set forth in this Section. This Section does not apply to: 1. Uses allowed under a Temporary Use Permit issued pursuant to the terms of RMC 4‐9‐240, Temporary Use Permits; and uses temporarily allowed pursuant to RMC 4‐2‐060.G and 4‐2‐080.A.101 (including a COVID‐19 deintensification shelter); 2. Religious organizations hosting the homeless within buildings on their property under the terms of RCW 35A.21.360 (Hosting the homeless by religious organizations – When authorized – Requirements – Prohibitions on local actions); 3. Social service organizations; 4. Unrelated individuals living together as a “family” pursuant to the definition contained in RMC 4‐11‐060; and 5. Housing for which the tenants fall under the protections of Chapter 59.18 RCW. C. DEFINITIONS: 1. Definitions Applicable to Terminology Used in This Section: See also Definitions in RMC chapter 4‐11. a. “Code of conduct” is an agreement on rules of behavior between occupants of a homeless services use and operators and providers offering a AGENDA ITEM # 7. a) ORDINANCE NO. ________ 11 homeless services use at a specific location. The code of conduct is intended to protect the health, safety, and welfare of the occupants and employees of the homeless services use, and the surrounding residents and businesses. b. “Funder” means any person, partnership, corporation, or other organization of any kind that provides funding to establish, construct, or operate a homeless services use. c. “Good neighbor agreement (GNA).” Reserved. d. “Homeless services use.” See definition in RMC 4‐11‐080. e. “Homelessness” refers to the state of a person or group of persons who lacks a fixed, regular, and adequate nighttime residence, meaning: (i) Has a primary nighttime residence that is a public or private place not meant for human habitation; (ii) Is living in a publicly or privately operated shelter designated to provide temporary living arrangements (including congregate shelters, transitional housing, and hotels and motels paid for by charitable organizations or by federal, state, and local government programs); or (iii) Is exiting an institution where (s)he/it has resided for ninety (90) days or less and who resided in an emergency shelter or place not meant for human habitation immediately before entering that institution. f. “Operator” means any person, partnership, business, corporation, or other organization of any kind that proposes to site and operate or does operate a homeless services use in the City. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 12 g. “Provider” means any person, partnership, business, corporation, or other organization of any kind that provides supportive services to a homeless population accessing a homeless services use. h. “Safety and security plan” refers to a plan developed by the operator and updated to reflect input provided by the Renton Police Department to address security concerns regarding a homeless services use that is proposed at a specific location. i. “Standard operating procedures” refer to a plan developed by the operator that addresses the elements required by subsection F.2.e of this Section. j. “Supportive services” are those provided to occupants of a homeless services use for the purpose of facilitating their independence and include, but are not limited to, services such as case management, food or meals, medical treatment, psychological counseling, childcare, transportation, and job training. D. APPROVAL PROCESS REQUIRED: A homeless services use requires a conditional use permit, approved by a Hearing Examiner and processed pursuant to the provisions of RMC 4‐9‐030 and the provisions of this Section. E. PREAPPLICATION PROCESS: 1. Preapplication Materials: A neighborhood meeting is recommended but not required pursuant to RMC 4‐8‐100.A prior to submittal of an application for a conditional use permit for a homeless services use. 2. Preapplication Neighborhood Meeting: Reserved. 3. Preapplication Site Inspection by the City: Reserved. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 13 F. SUBMITTAL REQUIREMENTS: 1. An applicant seeking to establish a homeless services use is required to submit application materials that meet the submittal requirements for a conditional use permit as required by RMC 4‐8‐120. 2. In addition to the applicable conditional use permit submittal requirements identified in subsection F.1 of this Section, information identified in this subsection shall also be included with the permit application. An application that does not contain the information listed in this subsection shall not be considered complete. All applications for homeless services use shall include the following: a. A description of the homeless population to be served by the proposed homeless services use, dates and times of operation, and associated occupancy targets. b. A statement of the operator’s experience at providing homeless services, including examples of similar facilities managed by the operator. c. Reserved. d. Reserved. e. A standard operating procedures plan including, but not limited to: i. A description of how the proposed homeless services use will serve the homeless population that will be accommodated by the use; AGENDA ITEM # 7. a) ORDINANCE NO. ________ 14 ii. A description of staffing for the proposed homeless services use based on anticipated population size and needs and the training provided to staff hired to fulfill the identified staffing demand; iii. A description of the anticipated providers that will serve the population that will be accommodated by the homeless services use; iv. A description of the known funders for the homeless services use; v. A description of the procedures used to manage intake of the homeless population that is proposed to be served; vi. A plan for encouraging prospective occupants to provide personal identification for inclusion in the Homeless Management Information System (HMIS) to help increase opportunities to provide access to housing and services and to secure public funding for the proposed homeless services use; vii. Reserved; viii. Where applicable, a plan to ensure that school‐aged residents of the use are enrolled in school during their stay; ix. Identification of a primary point of operator contact for assistance and referrals to send homeless individuals seeking services; x. Reserved; xi. A description of how the operator will inform and educate occupants of the homeless services use regarding the code of conduct (described in subsection F.2.f of this Section); and AGENDA ITEM # 7. a) ORDINANCE NO. ________ 15 xii. A description of consequences to be imposed for violating the code of conduct. f. A code of conduct that applies within the homeless services use site to all individuals granted access to the proposed homeless services use and that includes, but is not limited to, the following terms: i. Respect the rights of property owners to restrict access to areas of their property that are not open to the public; ii. Maintain the site in a safe and habitable condition; iii. Do not possess or use illegal substances; iv. Respect state law restrictions on smoking and use designated smoking areas where provided; and v. Comply with City of Renton regulations governing public conduct. g. A safety and security plan describing measures that the operator will employ to promote the safety of shelter occupants and surrounding residents and businesses, including but not limited to: i. Criteria for rejection or removal of an individual seeking access to the proposed homeless services use; ii. A plan for deployment (including time, place and manner) of security patrols; iii. A plan to address any behavior exhibited by clients of the homeless services use provider within a homeless services use and its site that AGENDA ITEM # 7. a) ORDINANCE NO. ________ 16 threatens the safety of occupants or employees of the use, and a description of the consequences for engaging in such behavior; iv. Reserved; v. Reserved; vi. A plan for managing individuals excluded from accessing the proposed homeless services use; vii. A plan for coordination between the operator, public safety officers (e.g., police, fire, etc.), and any private security forces employed by surrounding property and business owners to ensure timely information sharing; viii. Provision of a phone number, email address, and point of contact at the site of the proposed homeless services use for the community to report concerns; ix. A plan for addressing reported concerns and documenting resolution, and sharing this information with relevant neighbors, as applicable to the concern; and x. Identification of performance metrics that will be used to track compliance with the safety and security plan. h. Reserved. G. GOOD NEIGHBOR AGREEMENT PROCESS REQUIRED: Reserved. H. CITY APPROVAL REQUIREMENTS FOR HOMELESS SERVICES USES: 1. Applicability of City Review Process: A homeless services use requires approval of a conditional use permit by a Hearing Examiner. The conditional use AGENDA ITEM # 7. a) ORDINANCE NO. ________ 17 permit shall be reviewed pursuant to RMC 4‐9‐030 as enhanced by the provisions of this Section. 2. Decision Criteria Applicable to Conditional Use Permits for a Homeless Services Use: The City may deny, approve, or approve with conditions a conditional use permit application for a homeless services use. A permit application shall not be approved or approved with conditions unless the applicant demonstrates that: a. The proposal complies with the conditional use permit decision criteria of RMC 4‐9‐030.D; b. The proposal complies with the applicable requirements of the RMC; c. The proposal includes a standard operating procedures plan meeting the requirements of subsection F.2.e of this Section; d. The proposal includes a code of conduct meeting the requirements of subsection F.2.f of this Section; e. The proposal includes a safety and security plan meeting the requirements of subsection F.2.g of this Section and incorporating the feedback provided by the Renton Police Department; and f. The proposal addresses all applicable design guidelines and development standards of this Section and any applicable land use district overlay in a manner which fulfills their purpose and intent. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 18 3. Minimum required notice and public engagement procedures for homeless services uses shall include the following: a. Reserved. b. Reserved. c. Notice of an application to establish any homeless services use shall be provided pursuant to RMC 4‐8‐090. 4. Administrator’s Recommendation: a. A written report of the Administrator shall be prepared in response to the approval criteria and public comment. b. Notice of Availability of the Administrator’s Recommendation: Notice of the availability of the Administrator’s recommendation shall be provided pursuant to RMC 4‐8‐090. 5. Modifications to a Homeless Services Use: Conditions of approval for a homeless services use apply for the life of the project. Changes to an approved conditional use permit for a homeless services use shall be subject to the revision criteria for conditional use permits in RMC 4‐9‐030.J, Conditional Use Permits: Major and Minor Revisions. I. DEVELOPMENT STANDARDS/USE REQUIREMENTS: 1. General Development Requirements: Applicable general development requirements (including, but not limited to, zoning and land use standards, street and utility standards, and the uniform codes for building, mechanical, plumbing, electrical, fire protection, and property management) shall be met unless AGENDA ITEM # 7. a) ORDINANCE NO. ________ 19 specifically modified by the terms of this Section or by State law when applied to a homeless services use. 2. Parking Requirements: In addition to the terms of RMC 4‐4‐080, the following requirements apply to all homeless services uses: a. Number of Parking Stalls: Homeless services uses are unspecified under the terms of RMC 4‐4‐080.F.10.d, and required parking stalls shall be established by the Administrator and approved by the Hearing Examiner. b. Overnight Camping is Prohibited: Camping is prohibited in areas that provide accessory parking for the homeless services use. 3. Occupancy Limits and Size‐Related Development Standards: a. All homeless services uses shall comply with occupancy limitations contained in applicable building and fire codes and ordinances adopted by the City. b. In addition to compliance with subsection I.3.a of this Section, overnight shelter uses shall not provide sleeping accommodations for more than one hundred (100) residents, and shall comply with the following additional requirements: i. The City shall impose a condition on any approved overnight shelter use limiting the number of beds to those requested by the applicant or one hundred (100), whichever is less. ii. Shelters shall locate greater than one‐half (0.5) mile from any other homeless services use, unless they are co‐located as part of a single AGENDA ITEM # 7. a) ORDINANCE NO. ________ 20 development and do not serve more than a combined one hundred (100) residents. iii. Shelters with more than fifty (50) beds should locate within one (1) mile of a public transit stop. 4. Minimum Requirements: a. Homeless Services Uses in General: i. Toilet, bathing, sleeping, laundry, and storage facilities to meet the demands anticipated by the homeless services use provider. ii. Designated smoking areas located a minimum of twenty‐five feet (25’) from perimeter property lines with appropriate cigarette disposal facilities. iii. Staffing provided during operating hours for each homeless services use. iv. Designated and dignified privacy areas to meet the needs of the anticipated homeless population that is proposed to be served (e.g., lactation rooms, medical/counseling rooms, caseworker consultation spaces, etc.). v. A permanent address to meet the needs anticipated by the homeless services use provider. vi. A final safety and security plan updated after any comments have been received on the plan from the Renton Police Department. b. For Overnight Shelters: Overnight sleeping accommodations that do not exceed one hundred (100) beds. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 21 J. ADDITIONAL DESIGN REQUIREMENTS: 1. Crime Deterrence: Reserved. 2. Common Areas: Common areas shall be provided to enhance resident enjoyment through inclusion of features such as libraries, roof decks, patios, and gardens. K. MITIGATION MEASURES: The City may impose conditions relating to the development, design, use, or operation of a homeless services use to mitigate environmental, public life, safety, or welfare, or other identifiable impacts. L. INDEPENDENT TECHNICAL REVIEW: The applicant shall pay for independent technical review by a consultant retained by the City for review of materials submitted by the applicant to demonstrate compliance with the requirements of this Section. SECTION VII. The definition of “COVID‐19 Deintensification Shelter” is added in alphabetical order to Section 4‐11‐030 of the Renton Municipal Code as shown below. All other definitions in Section 4‐11‐030 remain in effect and unchanged. COVID‐19 DEINTENSIFICATION SHELTER: A facility (whether a separate structure, or situated inside or outside a building or a portion of a building) used for the relocation of homelessness shelters and encampments for the purposes of de‐ intensifying or reducing density in response to the novel coronavirus (COVID‐19) pandemic. A COVID‐19 Deintensification Shelter that meets the definition of a AGENDA ITEM # 7. a) ORDINANCE NO. ________ 22 Homeless Services Use – Overnight Shelter is both a COVID‐19 Deintensification Shelter and a Homeless Services Use – Overnight Shelter. SECTION VIII. The definition of “Diversion Facility” in Section 4‐11‐040 of the Renton Municipal Code is amended and the definition of “Diversion Interim Service Facility” in Section 4‐ 11‐040 of the Renton Municipal Code is removed, as shown below. All other definitions in Section 4‐11‐040 remain in effect and unchanged. DIVERSION FACILITY: A facility which that provides community crisis services, whereby inpatient healthcare for individuals that are self‐admitted or ordered, diverted, or referred from jails, hospitals, doctors or other similar treatment facilities or professionals, or by first responders, including law enforcement, hospital emergency department social workers, and similar professionals. options due to mental illness or chemical dependency. Services may include an array of inpatient healthcare treatment and support services including but not limited to screening and assessment, psychological counseling, case management, crisis management, detox services, substance use and trauma‐related treatment services, behavioral/mental health care, medical isolation, care, or treatment, counseling, respite services, and various levels of accommodations for sleeping purposes. Some outpatient healthcare services may be provided. Not included in this definition are congregate residences, assisted living facilities, adult family homes, group homes, convalescent centers, social service organizations, or homeless services uses. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 23 DIVERSION INTERIM SERVICE FACILITY: A facility which provides interim or respite services, such as temporary shelter, medical/mental health treatment, case management or other support options such as transportation arrangements for patients referred to such a facility from a diversion facility. SECTION IX. The definition of “Hotel” in Section 4‐11‐080 of the Renton Municipal Code is amended as shown below. The definitions of “Homeless Services Use” and “Hotel, Extended‐ Stay” are added in alphabetical order to Section 4‐11‐080 of the Renton Municipal Code as shown below. All other definitions in Section 4‐11‐080 remain in effect and unchanged. HOMELESS SERVICES USE: A day shelter or overnight shelter as defined below: 1. Day Shelter: A facility that offers a haven to people experiencing homelessness by providing a safe place to rest during the day or evening, but with no overnight stays. Support services for homeless populations is an integral part of a day shelter use and includes but is not limited to access to food, seating, showers, laundry, restrooms, storage, a computer lab, phones, fax, and a critical mailing address. Spaces for meetings and examinations are generally provided to accommodate counseling and access to medical/dental and legal assistance. 2. Overnight Shelter: Any facility that is operated for a long‐term and indefinite period (and not in response to a single sudden event such as a natural disaster) for the primary purpose of providing temporary shelter for people experiencing homelessness in general or for specific populations of people experiencing homelessness. Supportive services may or may not be provided in addition to the AGENDA ITEM # 7. a) ORDINANCE NO. ________ 24 provision of shelter. A COVID‐19 deintensification shelter meeting this definition is a Homeless Services Use – Overnight Shelter. HOTEL: A building or portion thereof designed or used wherein a majority of the net floor area is dedicated for the rental of rooms for transient occupancy rental for sleeping purposes in exchange for payment, and typically based on a per night and per room basis for no more than thirty (30) continuous days and not meeting the definition of Homeless Services Use. For the purposes of this definition, “transient” means less than one (1) month, or less than thirty (30) continuous days if the rental period does not begin on the first day of the month. Hotel structures are at least two (2) stories in height, with lodging space generally above the first floor. Lodging space may also be located on the first floor. Individual rooms are typically accessed from a common hallway and include permanent provisions for sanitation but do not provide kitchen facilities. A central commercial kitchen and dining room catering to the hotel patrons may be provided, event space, eating and drinking establishments, and accessory shops and services typically located in or provided by hotels and catering to the general public may be provided. Not included in this definition are facilities providing crisis intervention or case management or both, multi‐family attached dwellings, bed and breakfasts, or motels. HOTEL, EXTENDED‐STAY: A building or portion thereof for rental of rooms with permanent provisions for living, eating, sanitation, and cooking for temporary occupancy without limits on duration. Extended‐stay hotel structures are at least AGENDA ITEM # 7. a) ORDINANCE NO. ________ 25 two (2) stories in height, with lodging space generally above the first floor, and not meeting the definition of a Homeless Services Use. Lodging space may also be located on the first floor. Individual rooms accessed from a common hallway. A commercial kitchen and dining room catering to the extended‐stay patrons may be provided; event space, eating and drinking establishments, and accessory shops and services typically located in or provided by hotels or extended‐stay hotels and catering to the general public may be provided. Not included in this definition are facilities providing crisis intervention or case management or both, attached dwellings, bed and breakfasts, hotels, or motels. SECTION X. The definition of “Social Service Organizations” in Section 4‐11‐190 of the Renton Municipal Code is amended as shown below. All other definitions in Section 4‐11‐190 remain in effect and unchanged. SOCIAL SERVICE ORGANIZATIONS: Public or nonprofit agencies that provide counseling, therapy, job training, educational classes, food banks, clothing banks, or other social or human services to persons needing such services due to physical, mental, emotional, or other disabilities, but do not provide crisis intervention, day or night shelter, or case management. Also, public or nonprofit agencies that provide public services such as food banks, clothing banks, day shelters, and job training centers. This does not include religious institutions, offices, government facilities, schools, hospitals, clinics, day care, homeless services uses, medical institutions, diversion facilities, lodging in any form, or residential uses. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 26 SECTION XI. The interim zoning controls imposed herein shall be in effect for six (6) months from the passage of this ordinance, unless ended earlier by subsequent City Council action, or unless subsequently extended by the City Council pursuant to state law. SECTION XII. During the interim period in which these interim zoning controls are in effect, City staff are directed to further investigate the issues. City staff are directed to bring further proposed legislation through the public process that applies to proposed amendments to the Renton Municipal Code’s development regulations, including the public hearing process before the City’s Planning Commission, and then to present such further legislation to the City Council for its consideration. City staff’s investigation and development of proposed further legislation is to include the following: a.Regarding COVID‐19 Deintensification Shelters: Regulations applicable to the operations of a COVID‐19 deintensification shelter within the City of Renton, including (1) the duration that such use may be allowed to operate in the City without obtaining a conditional use permit and (2) the zoning designations in which such use may lawfully operate. Siting considerations and availability of properties within the City potentially suitable for a COVID‐19 deintensification shelter. Develop recommendations for whether the list of allowed zoning designations (CO, CV, IL, IM, and IH) under this interim ordinance should be expanded in the further legislation. b.Regarding Homeless Services Uses: AGENDA ITEM # 7. a) ORDINANCE NO. ________ 27 Regulations applicable to homeless services uses within the City of Renton, including (1) reasonable regulations and permitting requirements for such uses and (2) the zoning designations in which such uses may lawfully operate. Siting considerations and availability of properties within the City potentially suitable for homeless services uses. Develop recommendations for whether the list of allowed zoning designations (CO, CV, IL, IM, and IH) under this interim ordinance should be expanded in the further legislation. Regulations of uses serving those experiencing homelessness that are not addressed in this interim zoning ordinance. Such uses include emergency shelters responding to single sudden events and transitional housing. SECTION XIII. If any Section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other Section, subsection, sentence, clause, phrase or word of this ordinance. SECTION XIV. The City Council declares an emergency for the protection of the public welfare and to enable the purpose and intent of this ordinance to be accomplished. This ordinance shall take effect immediately when passed by the City Council. The City Clerk shall cause to be published a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 28 PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2120:12/10/2020 AGENDA ITEM # 7. a) ORDINANCE NO. ________ 29 ATTACHMENT A USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC G. OTHER COMMUNITY AND PUBLIC FACILITIES Diversion facility and diversion interim service facility H71 H71 Homeless services use H H H H H COVID‐19 deintensification shelter P101 P101 P101 P101 P101 P101 K. SERVICES Hotel, extended‐stay P29 P29 P29 P29 P AGENDA ITEM # 7. a) ORDINANCE NO. ________ 30 ATTACHMENT B STATEMENT Establishment of COVID‐19 Shelter Operations at the Renton Red Lion 1. In early 2020, the World Health Organization announced that the novel coronavirus (COVID‐19) was a global pandemic, the United States Department of Health and Human Services Secretary Alex Azar declared a public health emergency because of the COVID‐19 pandemic, and Washington Governor Inslee declared a State of Emergency due to COVID‐19. 2. On March 6, 2020, the Mayor proclaimed a local emergency due to COVID‐19. 3. On March 31, 2020, King County’s Local Health Officer, Dr. Jeff Duchin, issued a Local Health Officer Order (which Dr. Duchin amended on May 20, 2020) (collectively, the “County Health Order”) authorizing King County to use only “legally available” resources to “de‐intensify or reduce the density of existing homelessness shelters and encampments” in response to the COVID‐19 pandemic, and further emphasized that the County Health Order did not “authorize illegal means or behavior.” 4. On April 2, 2020, King County leased the Red Lion Hotel & Conference Center located at 1 South Grady Way, Renton (the “Red Lion Site”), from the property owner Renton Hotel Investors, LLC (“RHI”). 5. The Red Lion Site is located within the City’s Commercial Arterial (CA) zoning designation, and is subject to City of Renton Municipal Code, including City zoning, land use, and business use and licensing regulations. 6. On or about April 9, 2020, in coordination with King County and under King County’s lease with RHI, the Downtown Emergency Service Center (“DESC”) began using the Red Lion Site AGENDA ITEM # 7. a) ORDINANCE NO. ________ 31 as a COVID‐19 deintensification shelter for persons experiencing homelessness (the “COVID‐19 Shelter”). DESC began using the COVID‐19 Shelter to temporarily house individuals previously housed at its downtown Seattle Main Shelter, located at The Morrison Hotel. DESC and King County decided to house these individuals in private rooms, rather than congregate housing, where COVID‐19 could spread more rapidly. DESC did so without coordinating with City officials or City staff, and without obtaining City permits or obtaining a City business license. Operations of the COVID‐19 Shelter and City Land Use, Zoning, and Business Licensing Laws 7. As described by DESC, the COVID‐19 Shelter operates as a 24‐hour shelter for DESC’s clients experiencing homelessness, with a wide range of services including the provision of meals, case management, and crisis intervention. 8. King County has represented that the maximum number of residents of the COVID‐19 Shelter has been 235 individuals. 9. DESC has been continuously operating the COVID‐19 Shelter since on or about April 9, 2020, in concert with King County, in contravention of City zoning and without City land use or building permits or a City business license. 10. Since the COVID‐19 Shelter began operating at the Red Lion Site, first responders from the Renton Police Department and the Renton Regional Fire Authority (RRFA) have experienced a marked increase in the numbers of calls for service to the Red Lion Site and its vicinity, causing adverse impacts in the City of Renton. 11. City staff immediately made the following land use and zoning determinations regarding DESC’s use of the Red Lion Site to deintensify congregate homeless shelters: (1) the only land use lawfully established on the Red Lion Site is a “Hotel” land use; (2) the COVID‐19 AGENDA ITEM # 7. a) ORDINANCE NO. ________ 32 Shelter does not meet the Renton Municipal Code’s (RMC’s) definition of a “Hotel” land use (RMC 4‐11‐080); (3) a “deintensification shelter” is not among the list of land use types that is recognized in the Renton Municipal Code (RMC 4‐2‐060 (Zoning Use Table)); and (4) the potentially comparable land uses that are recognized in the Renton Municipal Code are “diversion facility / diversion interim service facility” or “congregate residence,” and that neither of those land uses is allowed within the Red Lion Site’s Commercial Arterial (“CA”) zoning designation. These determinations caused City staff to determine that the continued use of the Red Lion Site to house a homeless shelter operation is not an allowed land use on the Red Lion Site. 12. City staff also immediately determined that the COVID‐19 Shelter had opened without King County, DESC, or RHI having first applied for a City business license for the COVID‐ 19 Shelter operations, in violation of RMC 5‐5‐3. 13. Despite City staff’s determinations that the COVID‐19 Shelter is not an allowed land use on the Red Lion Site and was operating without a required City business license, the City was willing to temporarily forbear on taking code enforcement action against the COVID‐19 Shelter if King County would enter into a Memorandum of Understanding (“MOU”) with the City regarding the operations of the COVID‐19 Shelter and the duration of the COVID‐19 Shelter’s operations at the Red Lion Site. Accordingly, the City provided a draft MOU to King County in April 2020, and proceeded to negotiate in good faith with King County regarding an MOU, but King County would not agree to any MOU that committed King County or DESC to a timeframe for relocating the COVID‐19 Shelter’s operations from the Red Lion Site to another location within or beyond City of Renton limits that would allow for such a use under the Renton Municipal Code. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 33 Enforcement Proceedings and Hearing Examiner Decision 14. On June 30, 2020, when the MOU negotiations had dissolved with no commitment on the part of King County or DESC to relocating the COVID‐19 Shelter to a location allowed by the Renton Municipal Code, the City had run out of alternatives to engaging in code enforcement proceedings regarding the COVID‐19 Shelter. Thus, on that date, the City issued a two‐count Finding of Violation to King County, DESC, and RHI under code enforcement case number CODE20‐000321 finding that (1) the COVID‐19 Shelter is a “land use not allowed in zoning designation” (Violation 1), and (2) the COVID‐19 Shelter was “operating without a City of Renton business license” (Violation 2). Hereinafter, the Finding of Violation is the “FOV.” 15. King County and RHI both timely requested a hearing to challenge the FOV, and the requested hearing regarding the FOV was held before the City’s Hearing Examiner on August 14, 2020, with DESC also participating in the hearing. 16. In front of the Hearing Examiner, King County, RHI, and DESC took the position that the temporary use of the Red Lion Site for shelter deintensification meets the RMC definition of a “Hotel” land use. They also took the position that even if the shelter deintensification use of the Red Lion Site did not meet the definition of a “Hotel” land use, the Local Health Officer’s authority under Washington law to protect the public from contagious diseases takes legal precedence over and preempts Renton’s zoning and permitting laws. 17. For its part, in front of the Hearing Examiner, the City took the positions that (1) the deintensification use of the Red Lion Site does not meet the RMC definition of a “Hotel” land use, (2) the use appeared to most closely align with the RMC definitions for the “diversion facility / diversion interim service facility” land use or the “congregate residence” land use, (3) neither the AGENDA ITEM # 7. a) ORDINANCE NO. ________ 34 “diversion facility / diversion interim service facility” land use nor the “congregate residence” land use is allowed within the CA zoning designation (which is the Red Lion Site’s zoning designation), and (4) the pandemic and County Health Order did not preempt the City’s zoning and land use laws; indeed, the County Health Order expressly restricted King County to using “legally available” resources and forbade using “illegal means or behavior,” which would include the City of Renton’s legally adopted and enforced zoning, land use, and business licensing laws. 18. By written decisions dated August 31, 2020 and October 2, 2020, the Hearing Examiner ruled on the FOV (collectively, the “Hearing Examiner’s FOV Decision”). 19. The Hearing Examiner’s FOV Decision directed King County and DESC to choose either to vacate the Red Lion Site within 60 days or to apply to the City for an “unclassified use” interpretation in which the Department of Community & Economic Development (“CED”) would determine if the COVID‐19 Shelter is allowed utilizing the criteria in RMC 4‐2‐050.C.6.a. 20. Although the October 2, 2020 portion of the Hearing Examiner’s FOV Decision confirms that the “unclassified use analysis . . . decision is left to City staff as governed by City code,” the Hearing Examiner’s FOV Decision nevertheless projects that the outcome of CED’s unclassified use interpretation will be to deem the COVID‐19 Shelter a “Hotel” land use, a “Social Service Organizations” land use, or a combination of the two. 21. The Hearing Examiner’s FOV Decision’s projections that an unclassified use interpretation would result in a “Hotel” and/or “Social Service Organizations” land use determination were based, in part, on the following assumptions regarding the intent of the City Council: AGENDA ITEM # 7. a) ORDINANCE NO. ________ 35  Regarding the “Hotel” land use, the Hearing Examiner’s FOV Decision states: “The City has taken the strong position that the requirement in the hotel definition that guest stays be “transient” means that stays must be 30 days or less. Although the vast majority of hotel use may very well be 30 days or less, there is no basis to conclude that hotels stays will not sometimes be longer due to exceptional circumstances such as natural disasters and pandemics. The most compelling reason to disagree with the City’s 30‐day interpretation is simply that the Renton City Council didn’t expressly adopt a 30‐day limit for hotel stays. If the Council wanted a hard and fast rule on the length of time that someone could stay in a hotel room, it would have been exceptionally easy and clear to throw that into the definition of hotel or transient.” Cite: Hearing Examiner’s August 31, 2020 decision, page 11, lines 22‐29 (emphasis added).  Regarding the “Social Services Organizations” land use, the Hearing Examiner’s FOV Decision states: “There is the argument to be made that added night shelter use [to a “Social Services Organizations” use which only expressly allows “day shelter” use] could reduce the impacts of a day shelter and thereby make a conditional use permit unnecessary. A day shelter causes displacement of a homeless population every evening it shuts down whereas a 24‐hour shelter does not. However, it is too implausible to conclude that’s why the social services organization expressly authorizes just day shelters and doesn’t mention night shelters. If the Council considered a night shelter a more benign use than a day shelter, it would have expressly authorized it as a permitted use elsewhere in the use table.” Cite: Hearing Examiner’s August 31, 2020 decision, page 11, lines 11‐18 (emphasis added). 22. The Hearing Examiner’s FOV Decision’s projections that an unclassified use interpretation would result in a “Hotel” and/or “Social Service Organizations” land use caused, in part, the Hearing Examiner to conclude that the COVID‐19 Shelter was not most similar to a “Diversion Facility / Diversion Interim Service Facility” land use. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 36 Unclassified Use Application and Commencement of Litigation in King County Superior Court 23. On or about October 15, 2020, King County, DESC, and RHI jointly applied for an unclassified use interpretation for the COVID‐19 Shelter, as provided for in the Hearing Examiner’s FOV Decision (the “Unclassified Use Request”). 24. An unclassified use interpretation application is not a permit application type that vests upon submittal of a complete application (See RMC 4‐1‐045 “Vesting”). 25. On or about October 23, 2020, King County, DESC, and RHI jointly commenced a lawsuit in King County Superior Court, under Cause No. 20‐2‐15681‐7 KNT, challenging the Hearing Examiner’s FOV Decision (hereinafter, the “Renton Shelter Lawsuit”). 26. Pursuant to a stipulation of all parties to the Renton Shelter Lawsuit, the Renton Shelter Lawsuit’s case schedule was extended by 90 days with the first deadline in the action now postponed until January 28, 2021. Compatibility and Compliance Concerns 27. Impacts from the COVID‐19 Shelter at the Red Lion Site have created concerns and identified impacts from neighboring property owners, business owners, residents, tenants, and visitors regarding the compatibility between the COVID‐19 Shelter and land uses within its vicinity. 28. This incompatibility became immediately apparent upon the COVID‐19 Shelter’s opening when its operators enclosed the building in security fencing as a measure it asserted was necessary, making a hotel building located at a primary entrance to the City’s core to appear to be a vacant and/or cordoned off building. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 37 29. The COVID‐19 Shelter has created and continues to create significant public safety and welfare concerns for the residents of the COVID‐19 Shelter and its vicinity. These public safety and welfare concerns include, but are not limited to, documented significant increases in criminal activity, violations of building and fire codes, documented significant increases in 9‐1‐1 calls for emergency services, and instances of threats to first responders who respond to 9‐1‐1 calls to the COVID‐19 Shelter. Instances of threats to RRFA personnel resulted in the RRFA requesting police safety escorts to all calls for service to the COVID‐19 Shelter. 30. By memorandum dated December 9, 2020, the RRFA Fire Chief and Fire Marshal issued a notice to the COVID‐19 Shelter operators that several safety concerns regarding the COVID‐19 Shelter’s operations had caused the RRFA to deem the COVID‐19 Shelter an assisted living facility and/or institutional occupancy for fire code purposes. 31. The COVID‐19 Shelter operates as a low‐barrier shelter for residents with high needs, including persons struggling with histories of interpersonal conflict, rule violations, and/or illegal substance use that have caused other shelters to deny them services. 32. The COVID‐19 Shelter operators assert that the incidence of such conflicts has reduced as a result of deintensifying the distance from which the residents live and interact with each other, but the number of 9‐1‐1 calls for service to the COVID‐19 Shelter has not trended down since the COVID‐19 Shelter began its operations. 33. Incidents of interpersonal conflict, arson, and threats of arson at the COVID‐19 Shelter have continued to occur at the COVID‐19 Shelter. 34. Numbers of incidents of interpersonal conflict and arson or threatened arson are likely to be reduced by reducing the number of the COVID‐19 Shelter’s residents. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 38 35. Reducing the number of the COVID‐19 Shelter’s residents is likely to improve the safety and welfare of shelter residents, staff, visitors, first responders, and those working, living, and visiting the surrounding vicinity. Clarification and Confirmation of Land Use Definitions and Processes 36. In response to the Hearing Examiner’s FOV Decision, the City Council wishes to legislatively clarify and confirm its policy and interpretation regarding “Hotel,” “Social Service Organizations,” and “Division Facility / Diversion Interim Service Facility” land uses, to apply city‐ wide. 37. The City Council finds that the amended and clarified definition of “Hotel,” as set forth in this ordinance, clarifies and codifies City Council intent, including adding the WAC 458‐20‐ 166(3) definition of “transient” to the definition of “Hotel” to mean “for less than one month, or less than thirty continuous days if the rental period does not begin on the first day of the month.” 38. The City Council further finds that adding a definition for “Hotel, Extended Stay,” as set forth this ordinance, further clarifies and codifies the intent of the City Council. 39. The City Council further finds that the amended definition of “Social Services Organizations,” as set forth in this ordinance, clarifies and codifies City Council intent, including confirming that “night shelter” operations are not an allowed component of a Social Service Organizations land use. 40. The City Council further finds that the amended definition of “Diversion Facility” and the removal of the definition of “Diversion Interim Service Facility,” as set forth in in this ordinance, clarifies and codifies City Council intent. AGENDA ITEM # 7. a) ORDINANCE NO. ________ 39 41. The City Council also finds that there is a need to adopt certain related clarifications to the Renton Municipal Code regarding the unclassified use interpretation process, the distinctions between “principal” and “accessory” uses, and the title of positions within CED. Conversion of COVID‐19 Deintensification Shelter Use from an Illegal Use to a Legal Use 42. The Renton Municipal Code does not currently allow the COVID‐19 Shelter to operate within the City’s Commercial Arterial (CA) zoning district. 43. The City Council has legislatively determined that it will amend the Renton Municipal Code to add a definition for a “COVID‐19 deintensification shelter” land use and to allow a single such land use within specified zoning designations in the City without need for a conditional use permit, on a temporary basis and subject to additional standards and regulations established in this ordinance. 44. City staff has concluded that there are available properties in the City of Renton in the following zoning designations upon which a COVID‐19 deintensification shelter could be located after the completion of tenant improvements to the shelter operator’s satisfaction: Commercial Office (CO), Center Village (CV), Light Industrial (IL), Medium Industrial (IM), and Heavy Industrial (IH). 45. City staff has not been advised and is unaware that King County, DESC, or RHI has inquired into or otherwise determined whether a COVID‐19 deintensification shelter could be located on any property within the City that is zoned CO, CV, IL, IM, or IH (either with or without tenant improvements). King County’s identification and acquisition of one or more such properties could allow the COVID‐19 deintensification shelter to relocate and operate lawfully in an appropriate zone with appropriate conditions and thus resolve the issues in the pending AGENDA ITEM # 7. a) ORDINANCE NO. ________ 40 Renton Shelter Lawsuit and issues over use of the Red Lion Site as a COVID‐19 deintensification shelter. Intent to Expressly Allow Homeless Services Uses in the City of Renton 46. The City Council recognizes that the homelessness crisis in King County is a serious regional challenge but that it is a regional challenge that predates the COVID‐19 pandemic. 47. The City Council finds that one of the ways that the City can help combat the homelessness crisis that predated the COVID‐19 pandemic is to expressly allow for homeless services land uses for short‐term‐stay shelters (day shelters and overnight shelters) within the City and to provide for reasonable regulation of such uses. 48. In response, the City Council has determined to, on an emergency and interim basis, define “homeless services use” land uses, state the zoning designations in which such land uses are allowed, and establish regulations to be applied to such uses. This Ordinance Responds to an “Emergency” as that Term is Used under State Law 49. The City Council finds that there is a need to adopt this ordinance as an interim zoning control ordinance on an emergency basis. 50. Pursuant to WAC 197‐11‐880, the adoption of this interim zoning ordinance is exempt from the requirements of a threshold determination under the State Environmental Policy Act (SEPA), and future permanent zoning regulations shall be reviewed in accordance with SEPA requirements. Procedural and Substantive Issues 51. The City Council expressly intends that this ordinance be a legislative policy action which is not a site‐specific or quasi‐judicial action, and the City Council further recognizes and AGENDA ITEM # 7. a) ORDINANCE NO. ________ 41 intends that such legislative action has the effect of mooting the Unclassified Use Request by King County, RHI, and DESC and mooting the Renton Shelter Lawsuit by creating an allowed use for the COVID‐19 Shelter that moots the Hearing Examiner’s FOV Decision. 52. The City Council expressly intends that procedural and substantive due process rights be met in the substance and contents of and process of adopting this ordinance. 53. The City Council held a public hearing on November 23, 2020, regarding the subject matter of this ordinance, and heard oral testimony on the matter and considered written comments received prior to the public hearing. 54. The City Council encouraged further public input on the subject matter of this ordinance by, among other things, keeping the public hearing open until December 1, 2020 at 5:00 PM for the purpose of receiving additional written comment. 55. In addition to oral public comment and testimony, the City Council received and considered numerous written comments and testimony submitted by members of the public before the hearing, during the hearing, and following the hearing. 56. In response to public comment and testimony, the City Council wishes to clarify that, as described in the written presentation materials included in the City Council’s November 23, 2020 agenda packet, the City’s intention regarding the timing of this ordinance has been as follows:  November 23, 2020: Public hearing;  December 7, 2020: First reading of the ordinance with revisions that incorporate feedback from public comments; and AGENDA ITEM # 7. a) ORDINANCE NO. ________ 42  December 14, 2020: Second reading of the ordinance (with revisions that incorporate further feedback from public comments), City Council action on the ordinance, and effective date of the ordinance. AGENDA ITEM # 7. a) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING SELF‐ STORAGE STANDARDS IN SUBSECTIONS 4‐2‐060.M, 4‐2‐080.A.17, 4‐2‐080.A.22, AND 4‐2‐080.A.59 OF THE RENTON MUNICIPAL CODE, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. Subsection 4‐2‐060.M of the Renton Municipal Code is amended as shown on Attachment A. All other provisions in 4‐2‐060 remain in effect and unchanged. SECTION III. Subsections 4‐2‐080.A.17, 4‐2‐080.A.22, and 4‐2‐080.A.59 of the Renton Municipal Code are amended as shown below. All other provisions in 4‐2‐080.A remain in effect and unchanged. 17. Reserved. Self‐service storage shall be prohibited on corner properties or within the City Center Community Planning Area. For the purposes of this AGENDA ITEM # 7. b) ORDINANCE NO. ________ 2 condition, corner properties are defined as all private properties within one hundred feet (100’) of a public roadway intersection as measured along property lines. Additionally, self‐service storage facilities shall be subject to the following: a. Self‐service storage facilities shall be located within a multistory structure, limited to fifty percent (50%) of the gross floor area of the building, and prohibited on the ground floor along any street frontage. b. At a minimum, leasable commercial space, entrances/lobbies, or management offices for the self‐service storage shall be provided on the ground floor at a depth of thirty feet (30') along any street frontage. Averaging the minimum depth may be permitted through the site plan review process, provided no portion of the depth is reduced to less than twenty feet (20'). c. All commercial space on the ground floor shall have a minimum floor‐to‐ceiling height of eighteen feet (18'), and a minimum clear height of fifteen feet (15') unless a lesser clear height is approved by the Administrator. d. Exterior colors, including any internal corridors or doors visible through windows, shall be muted tones. 22. Self‐service storage shall be part of a mixed use development. Retail sales uses in the CN Zone are limited to: flowers/plants and floral supplies; mini‐ marts; crafts, including supplies and finished products; gift shops; specialty markets; and other similar small scale, low‐intensity commercial uses that serve nearby residents, as determined by the Community and Economic Development Administrator. AGENDA ITEM # 7. b) ORDINANCE NO. ________ 3 59. The specified uses shall be prohibited within the area south of I‐405 and north of SW 16th Street and within the City Center Community Planning Area. SECTION IV. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION V. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2127:10/7/2020 AGENDA ITEM # 7. b) ORDINANCE NO. ________ 4 ATTACHMENT A 4‐2‐060 Zoning Use Table – Uses Allowed in Zoning Designations: USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC M. STORAGE Bulk storage P29 P29 P29 Hazardous material storage, on site or off site, including treatment H24 H24 H24 Indoor storage P P P AC11 AC11 AC11 AC11 AC11 AC11 Outdoor storage, existing P29 P29 P29 P64 Outdoor storage, new P29 P29 P29 P64 Self‐service storage AD29 P59 P H22 H17 22 Vehicle storage AD29 AD29 AD29 Warehousing P P P AGENDA ITEM # 7. b) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, ADDING REGULATIONS FOR STANDALONE SOLAR ENERGY STRUCTURES BY AMENDING SUBSECTION 4- 2-060.O OF THE RENTON MUNICIPAL CODE, AMENDING CHAPTER 4-4 OF THE RENTON MUNICIPAL CODE BY ADDING A NEW SECTION 4-4-105 “SOLAR ENERGY SYSTEMS,” AND ADDING NEW DEFINITIONS OF “SOLAR ENERGY SYSTEM” AND “SOLAR ENERGY SYSTEM, GROUND MOUNTED, SMALL SCALE” TO SECTION 4-11- 190 OF THE RENTON MUNICIPAL CODE, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. Subsection 4-2-060.O of the Renton Municipal Code is amended as shown on Attachment A. All other provisions in 4-2-060 remain in effect and unchanged. SECTION III. Chapter 4-4 of the Renton Municipal Code is amended to add a new section 4-4-105 “Solar Energy Systems” to read as shown below. All other provisions in 4-4 remain in effect and unchanged. AGENDA ITEM # 7. c) ORDINANCE NO. ________ 2 4-4-105 SOLAR ENERGY SYSTEMS: A. PURPOSE: The purpose of this Section is to provide standards for certain Solar Energy Systems to reduce impacts related to visibility while promoting the use of alternative energy sources for users. B. APPLICABILITY: The Section shall apply to: 1. New or Replacement Equipment/Activity: All proposals for new or replacement Solar Energy Systems. 2. Enlargement or Exterior Modifications of Existing Structures: Solar Energy Systems that are not in conformance with this Section shall be required to conform to the requirements of this Section if enlarged or altered when the cost of the alterations exceeds fifty percent (50%) of the value of the existing Solar Energy System. C. AUTHORITY: The Administrator shall determine compliance with these standards concurrently with any development permit review, or in association with any code compliance issue. D. SOLAR ENERGY SYSTEM, GROUND MOUNTED EQUIPMENT, SMALL-SCALE: 1. Height: No portion of the structure shall exceed the maximum allowed wall-plate height for detached accessory buildings in the subject zone as AGENDA ITEM # 7. c) ORDINANCE NO. ________ 3 established in RMC 4-2-110B, Development Standards for Residential Development (Detached Accessory Buildings). 2. Setbacks: The structure shall be subject to setback requirements for detached accessory buildings in the subject zone as established in RMC 4-2-110B, Development Standards for Residential Development (Detached Accessory Buildings). 3. Location: The structure shall not be sited closer than six feet (6’) from a residential structure and shall not be located between the primary structure and a street. 4. Impervious Surface/Building Coverage: Structures with grass or an alternative pervious surface under the associated panels are excluded from maximum building coverage or maximum impervious surface area requirements established in RMC 4-2-110A, Development Standards for Residential Zoning Designations (Primary Structures). If pavement or other impervious surfaces are utilized around the base of the structure or under the solar panels, the structure would be not be eligible for the exemption. E. VARIANCES: A variance to standards may be sought pursuant to RMC 4-9-250. SECTION IV. Section 4-11-190 of the Renton Municipal Code is amended to add new definitions in alphabetical order of “Solar Energy System” and “Solar Energy System, Ground Mounted, Small Scale” to read as shown below. All other definitions in 4-11-190 remain in effect and unchanged. AGENDA ITEM # 7. c) ORDINANCE NO. ________ 4 SOLAR ENERGY SYSTEM: A device or structural design feature, a substantial purpose of which is to provide for interior lighting or provide for the collection, storage, and distribution of solar energy for space heating or cooling, electricity generation, or water heating. SOLAR ENERGY SYSTEM, GROUND MOUNTED, SMALL-SCALE: A Solar Energy System that is structurally mounted to the ground and typically a size that would service a house, small businesses, or small municipal building. SECTION V. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION VI. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. c) ORDINANCE NO. ________ 5 Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2138:11/20/2020 AGENDA ITEM # 7. c) ORDINANCE NO. ________ 6 ATTACHMENT A 4-2-060.O USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R-1 R-4 R-6 R-8 RMH R-10 R-14 RMF IL IM IH CN CV CA CD CO COR UC O. Utilities Communication broadcast and relay towers H H H H H H H H H H29 H29 H29 H H H H H H Electrical power generation and cogeneration H H66 H66 H66 H66 H66 H66 H66 H66 H66 Utilities, small P5 P5 P5 P5 P5 P5 P5 P5 P5 P P P P P P P P P P Utilities, medium AD5 AD5 AD5 AD5 AD5 AD5 AD5 AD5 AD5 AD AD AD AD AD AD AD AD AD AD Utilities, large H5 H5 H5 H5 H5 H5 H5 H5 H5 H H H H H H H H H H Solar Energy System, Ground Mounted, Small- Scale AC AC AC AC AC AC AC AC AC AGENDA ITEM # 7. c) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, UPDATING REGULATIONS FOR THE CENTER DOWNTOWN (CD) ZONE BY AMENDING SUBSECTIONS 4‐2‐060.L, 4‐2‐080.A.3, 4‐2‐080.A.6, AND 4‐2‐120.B; AND THE DEFINITION OF “DWELLING, ATTACHED” IN SECTION 4‐11‐040 OF THE RENTON MUNICIPAL CODE; PROVIDING FOR SEVERABILITY; AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. Subsection 4‐2‐060.L of the Renton Municipal Code is amended as shown in Attachment A. All other provisions in 4‐2‐060 remain in effect and unchanged. SECTION III. Subsections 4‐2‐080.A.3 and 4‐2‐080.A.6 of the Renton Municipal Code are amended as shown below. All other provisions in 4‐2‐080.A remain in effect and unchanged. 3. These uses shall not be located on the ground floor of buildings in the Downtown Business District depicted in RMC 4‐2‐080D, except structured parking AGENDA ITEM # 7. d) ORDINANCE NO. ________ 2 facilities, which may be located on the ground floor provided that where adjacent to public sidewalk structured parking facilities shall be setback a minimum of ten feet (10’) from the right‐of‐way, unless adequately screened to the satisfaction of the Administrator. 6. Specified residential use(s) are not allowed within one thousand feet (1,000') of the centerline of Renton Municipal Airport runway. Attached dwellings are not permitted in the CA or CN Zone within the Benson, Cedar River, Talbot, or Valley Community Planning Areas. Where not prohibited, attached dwelling units are permitted subject to the following conditions and standards in addition to RMC 4‐4‐150, Residential Mixed Use Development Standards: a. Standalone Residential – Where Allowed: Standalone residential buildings are permitted: i. In the CD Zone outside of the Downtown Business District, provided residential amenity space and/or lobby space is provided on the ground floor along the street frontage, which shall be at least twenty feet (20’) wide and at least fifty percent (50%) of the façade width for facades less than sixty feet (60’) wide, or a minimum of thirty feet (30’) wide for facades greater than sixty feet (60’) wide. (Widths shall be measured along the building façade.) The ground floor shall have a floor‐to‐ceiling height of twelve feet (12’). Where located on the ground floor and within ten feet (10’) of public sidewalk, the floors of attached dwellings shall be at least two feet (2’) elevated above the grade of the sidewalk. AGENDA ITEM # 7. d) ORDINANCE NO. ________ 3 ii. In the CV Zone where not abutting NE Sunset Blvd. east of Harrington Avenue NE; iii. In the CA Zone where abutting a residential zone if at least one vertical mixed building is constructed along the street frontage(s) with a minimum of two (2) residential stories above commercial, the standalone residential building(s) are sited closest to the abutting residential zone and, if townhouses, limited to three (3) stories; iv. In the UC Zone along streets not designated as pedestrian‐ oriented streets through the Master Site Plan process; and v. In the COR Zone as determined through the Master Site Plan process. Where standalone residential buildings are not allowed, dwelling units shall be integrated into a vertically mixed use building with ground floor commercial. b. Commercial Uses: Commercial uses in residential mixed‐use developments are limited to retail sales, on‐site services, eating and drinking establishments, taverns, daycares, preschools, indoor recreational facilities, pet daycares, craft distilleries/small wineries/micro‐breweries with tasting rooms, general offices not located on the ground floor, and similar uses as determined by the Administrator. Uses normal and incidental to a building including, but not limited to, interior entrance areas, elevators, waiting/lobby areas, mechanical rooms, mail AGENDA ITEM # 7. d) ORDINANCE NO. ________ 4 areas, garbage/recycling/compost storage areas, vehicle parking areas, and areas/facilities for the exclusive use of the residents are not considered commercial uses. c. Timing of Development: A building permit shall not be issued for any standalone residential building(s) prior to the issuance of a building permit for any required standalone commercial or vertically mixed use building(s) and no certificate of occupancy shall be issued for any standalone residential building(s) prior to the issuance of a certificate of occupancy for any required standalone commercial or vertically mixed use building(s). SECTION IV. Subsection 4‐2‐120.B of the Renton Municipal Code is amended as shown on Attachment B. All other provisions in 4‐2‐120 remain in effect and unchanged. SECTION V. The definition of “Dwelling, Attached” in section 4‐11‐040 of the Renton Municipal Code is amended as shown below. All other definitions in 4‐11‐040 remain in effect and unchanged. DWELLING, ATTACHED: A dwelling unit connected to one or more dwellings by common roofs, walls, or floors or a dwelling unit or units attached to garages or other nonresidential uses. This definition includes assisted living facilities but excludes boarding and lodging houses, accessory dwelling units, adult family homes, group home I or group home II as defined herein. Attached dwellings include the following types: A. Flat: A dwelling unit attached to one or multiple dwelling units by one or more common roof(s), wall(s), or floor(s) within a building. Typically, the unit’s habitable AGENDA ITEM # 7. d) ORDINANCE NO. ________ 5 area is provided on a single level. Unit entrances are may or may not be provided from a common internal corridor. B. Townhouse: A ground‐related dwelling attached to one or more such units in which each unit has its own exterior, ground‐level access to the outside, no unit is located over another unit, and each unit is separated from any other unit by one or more vertical common walls. Townhouse units may be multi‐story. C. Carriage House: One or more dwelling units built above one or more private garage(s). The attached garage(s) typically contains vehicles and/or storage for people living in another building as well as occupants of the carriage house. This definition does not include accessory dwelling unit. D. Garden Style Apartment(s): A dwelling unit that is one of several stacked vertically, with exterior stairways and/or exterior corridors and surface parking. Parking is not structured and may include detached carports or garages. Buildings and building entries are oriented toward internal drive aisles and/or parking lots and not street frontage. There is typically no formal building entry area connected to a public sidewalk and a public street. Site planning may incorporate structures developed at low landscaped setbacks. SECTION VI. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. AGENDA ITEM # 7. d) ORDINANCE NO. ________ 6 SECTION VII. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2130:11/4/2020 AGENDA ITEM # 7. d) ORDINANCE NO. ________ 7 ATTACHMENT A 4‐2‐060 Zoning Use Table – Uses Allowed in Zoning Designations: USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC L. VEHICLE RELATED ACTIVITIES Car washes P P P AD2 P2 Express transportation services AD P AD20 Fuel dealers H59 P Industrial engine or transmission rebuild P28 P28 P28 Parking garage, structured, commercial or public P P P P P20 P3 P P P92 Parking, surface, commercial or public, existing P29 P29 P29 P20 P3 AD Parking, surface, commercial or public, new P29 P29 P29 P20 AD AGENDA ITEM # 7. d) ORDINANCE NO. ________ 8 USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC Park and ride, dedicated P107 P107 P107 P107 P107 P107 P107 P107 Park and ride, shared‐use P P P P P P P P P P P107 P109 P107 P P107 Railroad yards P Taxi stand P AD AD Tow truck operation/auto impoundment yard P36 H59 P AD36 Transit centers H29 H29 H29 P H20 P H29 P Truck terminals P Vehicle fueling stations P P P P P P29 Vehicle fueling stations, existing legal P P P AD P P P29 Vehicle service and repair, large AD2 P P Vehicle service and repair, small P2 P2 P2 AD2 AD2 AD2 Wrecking yard, auto H59 H Air Transportation Uses Airplane manufacturing H59 P78 AGENDA ITEM # 7. d) ORDINANCE NO. ________ 9 USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC Airplane manufacturing, accessory functions AC P78 Airplane sales and repair P Airport, municipal P Airport‐related or aviation‐related uses AC Helipads P111 H29 H29 H29 H H H78 Helipads, commercial H H78 AGENDA ITEM # 7. d) ORDINANCE NO. ________ 10 ATTACHMENT B 4‐2‐120B DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR LOT DIMENSIONS Minimum Lot Size for lots created after July 11, 19939 None 25,000 sq. ft. None Minimum Lot Width/Depth for lots created after July 11, 1993 None LOT COVERAGE Maximum Lot Coverage for Buildings None 65%19 of total lot area or 75%19 if parking is provided within the building or within a parking garage. DENSITY (Dwelling Units per Net Acre) Minimum Net Residential Density9 7525 dwelling units per net acre. The minimum density requirements shall not apply to the subdivision and/or development of a legal lot 1/2 acre or less in size as of March 1, 1995. 75 dwelling units per net acre.22 Where a development involves residential, the minimum density shall be 30 dwelling units per net acre. The same area used for commercial and office development can also be used to calculate residential density. Where commercial and/or office areas are utilized in the calculation of density, the City AGENDA ITEM # 7. d) ORDINANCE NO. ________ 11 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR may require restrictive covenants to ensure the maximum density is not exceeded should the property be subdivided or in another manner made available for separate lease or conveyance. Maximum Net Residential Density9 150100 dwelling units per net acre. Density may be increased to 200150 dwelling units per net acre subject to conditional use permit approval.1, 21 150 dwelling units per net acre. Density may be increased up to 250 dwelling units per net acre subject to conditional use permit approval.1, 21 50 dwelling units per net acre.1, 21 The same area used for commercial and office development can also be used to calculate residential density. Where commercial and/or office areas are utilized in the calculation of density, the City may require restrictive covenants to ensure the maximum density is not exceeded should the property be subdivided or in another manner made available for separate lease or conveyance. SETBACKS AGENDA ITEM # 7. d) ORDINANCE NO. ________ 12 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR Minimum Front Yard14,18 None Residential Mixed Use Buildings: 0 ft. Buildings less than 25 ft. in height: 15 ft.19 Buildings 25 ft. to 80 ft. in height: 20 ft.13,19 Buildings over 80 ft. in height: 30 ft.13,19 Determined through site plan review. Maximum Front Yard18 15 ft. – for buildings, or for portions thereof, 25 ft. or less in height. None – for that portion of a building over 25 ft. in height. Residential Mixed Use Buildings: 15 ft. All Other Buildings: None Determined through site plan review. Minimum Secondary Front Yard14,18 None 0 ft.19 for Residential Mixed use Buildings 15 ft.19 – for buildings less than 25 ft. in height. 20 ft.13,19 – for buildings 25 ft. to 80 ft. in height. 30 ft.13,19 – for buildings over 80 ft. in height. Determined through site plan review. Maximum Secondary Front Yard18 15 ft. – for buildings, or portions thereof, 25 ft. or less in height. None – for that portion of a building over 25 ft. in height. Residential Mixed Use Buildings: 15 ft.15 All Other Buildings: None Determined through site plan review. AGENDA ITEM # 7. d) ORDINANCE NO. ________ 13 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR Minimum Freeway Frontage Setback 10 ft. landscaped setback from the property line. Minimum Rear Yard14,18 None, unless the ground floor façade provides windows for living rooms of attached dwellings – then 10 ft. – unless adjacent to an alley, then none. Additionally, if the CD lot abuts a lot zoned residential, then there shall be a 15 ft. wide landscaped strip or a 5 ft. wide sight‐obscuring landscaped strip and a solid 6 ft. high barrier used along the common boundary with an additional 5 ft. setback from the barrier. None required, except, 15 ft. if abutting a lot zoned residential. Determined through site plan review. Minimum Side Yard18 None, unless the ground floor façade provides living room windows of attached dwellings – then 10 ft. – unless adjacent to an alley, then none. Additionally, if the CD lot abuts a lot zoned residential, then there shall be a 15 ft. wide landscaped strip or a 5 ft. wide sight‐obscuring landscaped strip and a solid 6 ft. None required, except 15 ft. if abutting or adjacent to a residential zone. Determined through site plan review. AGENDA ITEM # 7. d) ORDINANCE NO. ________ 14 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR high barrier along the common boundary with an additional 5 ft. setback from the barrier. Clear Vision Area n/a In no case shall a structure over 42 in. in height intrude into the 20 ft. clear vision area defined in RMC 4‐11‐030. LANDSCAPING General See RMC 4‐4‐070 HEIGHT Maximum Building Height 95 ft. Heights may exceed the Zone’s maximum height with a conditional use permit.6 250 ft.6 10 stories and/or 125 ft.6 Maximum Building Height When a Lot Is Abutting a Lot Designated as Residential 20 ft. more than the maximum height allowed in the abutting residential zone. Heights may exceed the maximum height with a Hearing Examiner conditional use permit.6 20 ft. more than the maximum height allowed in the abutting residential zone.6 Determined through site plan review. Maximum Height for Wireless Communication Facilities6, 9 See RMC 4‐4‐140 SCREENING Minimum Required for Outdoor Loading, Repair, See RMC 4‐4‐095 AGENDA ITEM # 7. d) ORDINANCE NO. ________ 15 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR Maintenance, Storage or Work Areas; Surface‐Mounted Utility and Mechanical Equipment; Roof Top Equipment (Except for Telecommunication Equipment) Refuse or Recycling See RMC 4‐4‐090 PARKING AND LOADING General See RMC 4‐4‐080 and RMC 10‐10‐13 See RMC 4‐4‐080 and RMC 10‐10‐13. Direct arterial access to individual structures shall occur only when alternative access to local or collector streets or consolidated access with adjacent uses is not feasible. Required Location for Parking All parking shall be provided in the rear portion of the site yard, with access taken from an alley, when where available. Surface parking Parking shall not be located between a building and a street. in the front yard, nor in a side yard facing the street nor rear yard facing the street. n/a AGENDA ITEM # 7. d) ORDINANCE NO. ________ 16 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR Parking may be located off‐site or subject to a joint parking requirement. PEDESTRIAN ACCESS General n/a A pedestrian connection shall be provided from a public entrance to the street, unless the Reviewing Official determines that the requirement would unduly endanger the pedestrian. Determined through site plan review. SIGNS General See RMC 4‐4‐100 LOADING DOCKS Location For permitted manufacturing and fabrication uses, parking, docking and loading areas for truck traffic shall be off‐street and screened from view of abutting public streets. Not permitted on the side of the lot adjacent or abutting to a lot zoned residential.3 Determined through site plan review. DUMPSTER/RECYCLING COLLECTION AREA Size and Location of Refuse or Recycling Areas See RMC 4‐4‐090 AGENDA ITEM # 7. d) ORDINANCE NO. ________ 17 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR CRITICAL AREAS General See RMC 4‐3‐050 and 4‐3‐090 SPECIAL DEVELOPMENT STANDARDS Design Regulations See RMC 4‐3‐100, Urban Design Regulations Design District D of RMC 4‐3‐100, Urban Design Regulations, shall apply to all residential mixed use buildings. Urban Design Regulations are not applicable to other buildings. See RMC 4‐3‐100, Urban Design Regulations. Upper Story Setbacks None, unless adjacent to and facing a residentially zoned lot or if the façade contains living rooms windows – then 10 ft. for the second story and 15 ft. for all other upper stories. Also, see See RMC 4‐3‐100, Urban Design Regulations Residential mixed use buildings: buildings or portions of buildings that exceed one hundred feet (100') in height shall include upper story setbacks as follows: The minimum setback for a seventh (7th) story and succeeding stories shall be ten feet (10') minimum from the preceding story, applicable to each story, or an equivalent standard that adds interest and quality to the building. Buildings or portions of buildings that exceed fifty feet (50') in height shall include upper story setbacks as follows: The minimum setback for a fifth story and succeeding stories shall be ten feet (10') minimum from the preceding story, applicable to each story or an equivalent standard that adds interest and quality to the building. AGENDA ITEM # 7. d) ORDINANCE NO. ________ 18 DEVELOPMENT STANDARDS FOR COMMERCIAL ZONING DESIGNATIONS (CD, CO, & COR) CD CO COR Roofline and Facade Modulation See RMC 4‐3‐100, Urban Design Regulations Residential mixed use buildings: buildings shall provide vertical and horizontal modulation of roof lines and facades of not less than two feet (2') at a minimum interval of forty feet (40') per building face, or an equivalent standard that adds interest and quality to the building. Buildings shall provide vertical and horizontal modulation of roof lines and facades of not less than two feet (2') at a minimum interval of forty feet (40') per building face, or an equivalent standard that adds interest and quality to the building. AGENDA ITEM # 7. d) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING SECTION 4‐1‐045 OF THE RENTON MUNICIPAL CODE BY RENAMING THE SECTION FROM “VESTING” TO “VESTING REGULATIONS,” ELIMINATING SHORELINE DEVELOPMENT PERMITS AND CONDITIONAL USE PERMITS FROM THE LIST OF APPLICATIONS THAT VEST AT COMPLETE APPLICATION, CLARIFYING DURATION OF VESTING, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, with this Ordinance, the City primarily seeks to narrow and clarify the scope of the City’s vesting laws by eliminating Shoreline Development Permits and Conditional Use Permits from the list of applications that vest upon complete application; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. Subsection 4‐1‐045 of the Renton Municipal Code is renamed from “Vesting” to “Vesting and Duration of Approvals Regulations.” AGENDA ITEM # 7. e) ORDINANCE NO. ________ 2 SECTION III. Subsection 4‐1‐045.C.1, of the Renton Municipal Code is amended as shown below. All other provisions in 4‐1‐045.C remain in effect and unchanged. C. VESTING APPLICABILITY: 1. This Section applies to, and vesting occurs with, the filing of a complete application and permit approvals required by the City of Renton pursuant to Title IV, including and limited to of the following: a. Building permits (including but not limited to combo permits, grading licenses, and sign permits); b. Preliminary plats, final plats, short plats; and c. Shoreline development permits; d. Conditional use permits; and ec. Any other land use permit application that is specifically identified by the Washington State legislature as being covered by the vested rights doctrine. 2. Vesting does not apply to the following: a. Incomplete, invalid, inaccurate or defective building permit applications; b. Fees or taxes, including, but not limited to, impact fees; c. Pre‐application plans; d. Any other application or permit not specifically identified in this subsection C, as it exists or may be amended; e. Uses not specifically disclosed in the application; or AGENDA ITEM # 7. e) ORDINANCE NO. ________ 3 f. Any application or permit that may reasonably result in a threat to the public health, safety, or welfare of the community. The City’s exercise of police power to protect the public health and safety, and/or general welfare immediately extinguishes any “vested right.” SECTION IV. Subsection 4‐1‐045.F, of the Renton Municipal Code is amended as follows: F. DURATION OF APPROVALS VESTING: 1. Building Permits: Development of a building shall be based on the controls contained in the approved permit application, and permits are subject to. Vesting rights applicable to building permit applications would expire pursuant to permit expiration periods identified in the International Building Code (IBC) and adopted by reference herein in RMC 4‐5‐050, as it exists or may be amended. 2. Preliminary Plat: Development of an approved preliminary plat shall be based on the controls contained in the Hearing Examiner’s decision. A final plat meeting all of the requirements of the preliminary plat approval shall be submitted within the time frame specified in RMC 4‐7‐080L, unless a different time limitation was specifically authorized in the final approval. 23. Final Plat: The lots in a final plat may be developed by the terms of approval of the final plat, and the development regulations in effect at the time the preliminary plat application was deemed complete for a period of five (5) years from the recording date unless the City finds that a change in conditions creates a serious threat to the public health, safety or welfare. AGENDA ITEM # 7. e) ORDINANCE NO. ________ 4 4. Conditional Use Permit: The use authorized in a conditional use permit shall be allowed to develop for a period of two (2) years from the effective date of the permit approval unless a different time limitation was specifically authorized in the final approval. The development of an approved conditional use permit shall be governed by the terms of approval of the permit unless the City finds that a change in conditions creates a serious threat to the public health, safety or welfare. 53. Permits Associated with a Preliminary Plat: Permit applications, such as Planned Urban Developments (PUD) applications, that are approved as a companion to a preliminary plat application, shall remain valid for the duration of the permit application type or preliminary and final plat as provided in subsections F2 and 3 of this Section, whichever is longer as they exist or may be amended. 64. Short Plat: The lots in a short plat may be developed by the terms and conditions of approval, and the development regulations in effect at the time the application was deemed complete for a period of five (5) years from the recording date unless the City finds that a change in conditions creates a serious threat to the public health, safety or welfare. 7. Shoreline Development Permits: An approved Shoreline Permit shall be allowed to develop pursuant to the time limitations listed in RMC 4‐9‐190J (Time Requirements for Shoreline Permits), as it exists or may be amended. The development of an approved shoreline permit shall be governed by the terms of AGENDA ITEM # 7. e) ORDINANCE NO. ________ 5 approval of the permit unless the City finds that a change in conditions creates a serious threat to the public health, safety or welfare. 85. All approvals permits described in this Section shall be vested for the specific use, density, and physical development identified in the permit approval. SECTION V. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION VI. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. e) ORDINANCE NO. ________ 6 Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2140:11/4/2020 AGENDA ITEM # 7. e) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, REVISING ACCESSORY DWELLING UNIT (ADU) REGULATIONS BY AMENDING SUBSECTIONS 4‐2‐110.C, 4‐2‐110.E, AND 4‐2‐116.B.2 OF THE RENTON MUNICIPAL CODE, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, the City seeks to reduce barriers to Accessory Dwelling Unit (ADU) development and streamline the application process with the intent of diversifying and increasing housing opportunities in Renton; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. The Maximum Number and Size and Maximum Wall Plate Height regulations in subsection 4‐2‐110.C of the Renton Municipal Code are amended as shown below. All other provisions in 4‐2‐110.C remain in effect and unchanged. AGENDA ITEM # 7. f) ORDINANCE NO. ________ 2 4‐2‐110C DEVELOPMENT STANDARDS FOR RESIDENTIAL DEVELOPMENT (ACCESSORY DWELLING UNITS) MAXIMUM NUMBER AND SIZE General17 RC, R‐1, R‐4, R‐6, R‐8, R‐10, and R‐14 1 ADU is permitted per legal lot. Unit size shall be determined by lot size and the size of the primary structure; the total gross floor area square footage of the ADU shall not exceed the size stated in the Maximum Unit Size section of this table or 75% of the total square footage gross floor area of the primary structure, whichever is smaller.41 MAXIMUM UNIT SIZE Lot Area: Maximum ADU Size40, 41 3,000 sq. ft. or less 600 sq. ft. 3,001 ‐ 4,999 sq. ft. 700 sq. ft. 5,000 ‐ 6,999 sq. ft. 800 sq. ft. 7,000 ‐ 8,999 sq. ft. 900 sq. ft. Greater than 9,000 sq. ft. 1,000 sq. ft. MAXIMUM WALL PLATE HEIGHT 18, 19, 41 RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 ADUs are subject to the maximum wall plate height of RMC 4‐2‐ 110A, and associated conditions and, except that the ADU shall not be taller than the primary structure. Additional ADU height allowances may be permitted upon application and approval of a modification pursuant to RMC 4‐9‐250.42 LOCATION General RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 ADUs shall be located at least 6 ft. from any residential structure. MINIMUM SETBACKS 4, 41 Front Yard and Secondary Front Yard RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 The ADU shall be set back an additional 5 ft. parallel to and measured from the front facade of the primary structure and shall comply with the setbacks applied to the primary structure, AGENDA ITEM # 7. f) ORDINANCE NO. ________ 3 as identified in RMC 4‐2‐110A, Development Standards for Residential Zoning Designations. ADUs shall not be permitted between the primary structure and the street unless approved in the Conditional Use Permit process. Side Yard RC and R‐1 25 ft. R4, R‐6 and R‐8 5 ft. R‐10 and R‐14 4 ft. Rear Yard RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 5 ft. When located within 10 ft. of the rear property line, at least 25% of the lineal length of the rear yard shall remain unoccupied from accessory dwellings, except when the rear property line abuts an alley. Clear Vision Area RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 In no case shall a structure over 42 in. in height intrude into the 20 ft. clear vision area defined in RMC 4‐11‐030. CRITICAL AREAS General RC, R‐1, R‐4, R‐6, R‐8, R‐10 and R‐14 See RMC 4‐3‐050, Critical Areas Regulations, and 4‐3‐090, Shoreline Master Program Regulations. SECTION III. Subsections 4‐2‐110.E.40 and 4‐2‐110.E.41 of the Renton Municipal Code are amended as shown below, and subsection 4‐2‐110.E of the Renton Municipal Code is amended to add a new subsection 4‐2‐110.E.42 to read as shown below. All other provisions in 4‐2‐110.E remain in effect and unchanged. 40. For the purpose of calculating maximum unit size only, tThe square foot calculation shall not include porches or exterior stairs. Garages attached to accessory dwellings shall be included in the square foot calculation, except for when the entirety of the living area accessory dwelling is located above a garage. AGENDA ITEM # 7. f) ORDINANCE NO. ________ 4 41. Conversion of accessory buildings to ADUs shall be exempted from the relevant development regulations if the accessory building was constructed prior to January 1, 2020. However, modifications made to accessory buildings after January 1, 2020 that would increase the nonconformance of the proposed conversion are ineligible from such exemptions. 42. ADUs built using City produced pre‐approved ADU base plans may exceed the wall plate height of the primary structure by four feet (4’) and may be allowed an additional height allowance upon application and approval of a modification pursuant to RMC 4‐9‐250. Applicant produced ADU plans seeking to exceed the wall plate height of the primary structure may be allowed upon application and approval of a modification pursuant to RMC 4‐9‐250. SECTION IV. Subsection 4‐2‐116.B.2 of the Renton Municipal Code is amended as shown below. All other provisions in 4‐2‐116.B remain in effect and unchanged. B. APPLICABILITY: 1. This Section shall apply to ADUs in the following zones: Residential‐4 (R‐ 4), Residential‐6 (R‐6), Residential‐8 (R‐8), Residential‐10 (R‐10), and Residential‐ 14 (R‐14). 2. If the primary structure where the ADU is proposed does not comply with the adopted architectural detailing standards adopted in the Residential Design standards (RMC 4‐2‐115E3), the primary structure shall be brought to proportional compliance prior to the issuance of ADU building permits. AGENDA ITEM # 7. f) ORDINANCE NO. ________ 5 a. The amount invested in physical improvements to reduce or eliminate the nonconformity related to the architectural detailing shall be determined by multiplying the valuation of the ADU, as determined by the City, by ten percent (10%). b. The Department shall evaluate and approve the allocation of the required investment in bringing the primary structure into compliance based on the above formula and RMC 4‐2‐115E3. SECTION V. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION VI. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. f) ORDINANCE NO. ________ 6 Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2141:10/28/2020 AGENDA ITEM # 7. f) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, AMENDING SUBSECTION 4‐9‐070.R OF THE RENTON MUNICIPAL CODE, RELATING TO THE STATE ENVIRONMENTAL POLICY ACT (SEPA) APPEALS PROCESS, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. Subsection 4‐9‐070.R of the Renton Municipal Code is amended as follows: R. APPEALS: 1. Except for permits and variances issued pursuant to RMC 4‐3‐090, Shoreline Master Program Regulations, when any proposal or action is granted, conditioned, or denied on the basis of SEPA substantive authority by a nonelected official other than the Hearing Examiner, the decision shall be appealable to the Hearing Examiner under the provisions of RMC 4‐8‐110, Appeals. When such a AGENDA ITEM # 7. g) ORDINANCE NO. ________ 2 proposal or action is conditioned or denied on the basis of SEPA substantive authority by an elected official or by the Hearing Examiner, there shall be no administrative appeal. 2. Except for permits and variances issued pursuant to RMC 4‐3‐090, Shoreline Master Program Regulations, when any proposal or action is challenged as to a SEPA procedural determination, there shall be no administrative appeal. SECTION III. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION IV. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. g) ORDINANCE NO. ________ 3 Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2126:10/5/2020 AGENDA ITEM # 7. g) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, REVISING REGULATIONS RELATING TO GOVERNMENT FACILITIES BY AMENDING SUBSECTION 4‐2‐060.G OF THE RENTON MUNICIPAL CODE, AMENDING THE DEFINITION OF “GOVERNMENT FACILITIES, OTHER” IN SECTION 4‐11‐070 OF THE RENTON MUNICIPAL CODE, AND ADDING NEW DEFINITIONS OF “GOVERNMENT MAINTENANCE FACILITIES, OTHER” AND “GOVERNMENT OFFICE, OTHER” TO SECTION 4‐11‐070 OF THE RENTON MUNICIPAL CODE, PROVIDING FOR SEVERABILITY, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, pursuant to RCW 36.70A.106, on October 6, 2020, the City notified the State of Washington of its intent to adopt amendments to its development regulations; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. All portions of the Renton Municipal Code in this ordinance not shown in strikethrough and underline edits remain in effect and unchanged. SECTION II. The “Other government offices and facilities” row in subsection 4‐2‐060.G of the Renton Municipal Code is amended as shown in Attachment A. 4‐2‐060.G is further amended by adding new rows for “Other government maintenance facilities” and “Other government offices” to read as shown in Attachment A. All other provisions in 4‐2‐060.G remain in effect and unchanged. AGENDA ITEM # 7. h) ORDINANCE NO. ________ 2 SECTION III. The definition of “Government Facilities, Other” in section 4‐11‐070 of the Renton Municipal Code is amended as shown below. Section 4‐11‐070 is further amended to add new definitions in alphabetical order of “Government Maintenance Facilities, Other” and “Government Office, Other” to read as shown below. All other definitions in 4‐11‐070 remain in effect and unchanged. GOVERNMENT FACILITIES, OTHER: Facilities of any unit of county, state, federal, or special district a government agency other than the City. Types of facilities include community centers, vehicle and drivers licensing offices, public works maintenance facilities, courts of law, school support facilities, and other types of county, state, school district, special district, or federal facilities. This definition excludes offices, jails, parks, transit centers, park and& rides, sewage treatment plants, schools, municipally owned golf courses or airports, and libraries, storage of vehicles, and maintenance facilities, or other uses otherwise identified in 4‐2‐ 060. GOVERNMENT MAINTENANCE FACILITIES, OTHER: A facility used by a government agency other than the City as a place to maintain the equipment and facilities of the government agency. It may also include the storage of materials and vehicles used by the agency during maintenance. GOVERNMENT OFFICE, OTHER: The administrative offices of a government agency other than the City, where there is no direct provision of services to the public. This does not include the storage of materials or vehicles. AGENDA ITEM # 7. h) ORDINANCE NO. ________ 3 SECTION IV. If any section, subsection, sentence, clause, phrase or work of this ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction, such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other section, subsection, sentence, clause, phrase or word of this ordinance. SECTION V. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2139:11/10/2020 AGENDA ITEM # 7. h) ORDINANCE NO. ________ 4 ATTACHMENT A 4‐2‐060.G USES: RESIDENTIAL ZONING DESIGNATIONS INDUSTRIAL COMMERCIAL ZONING DESIGNATIONS RC R‐1 R‐4 R‐6 R‐8 RMH R‐10 R‐14 RMF IL IM IH CN CV CA CD CO COR UC G. OTHER COMMUNITY AND PUBLIC FACILITIES Other government offices and facilities H H H H H H H H H H H H H H H H H H H Other government maintenance facilities H H Other government offices AD42 P P P AD P112 P P P P P92 AGENDA ITEM # 7. h) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. _______ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, ADOPTING THE 2020 AMENDMENTS TO THE CITY'S 2015 COMPREHENSIVE PLAN, MAPS, AND DATA IN CONJUNCTION THEREWITH, AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, the Council has heretofore adopted and filed a Comprehensive Plan and the Council has implemented and amended the Comprehensive Plan from time to time, together with the adoption of various codes, reports and records; and WHEREAS, the Planning Commission has heretofore fully recommended to the Council, from time to time, certain amendments to the Comprehensive Plan; and WHEREAS, the City of Renton, pursuant to the Washington State Growth Management Act, periodically reviews its Comprehensive Plan; and WHEREAS, as set forth in the Land Use Element of the Comprehensive Plan, the City’s Residential‐8 (R‐8) zoning district is intended to implement the Residential Medium Density (RMD) land use designation, but 21 R‐8‐zoned parcels north of the Virginia Mason Athletic Center had been designated Residential High Density (RHD) instead of RMD; and WHEREAS, the City’s Residential‐6 (R‐6) zoning district is intended to implement the RMD land use designation, but one parcel along N 40th St and Lake Washington Blvd had been designated RHD instead of RMD; and WHEREAS, the City’s Residential‐10 (R‐10) zoning district is intended to implement the RMD land use designation, but one parcel along NE 2nd Ln and Bremerton Ave NE had been designated RMD instead of RHD; and AGENDA ITEM # 7. i) ORDINANCE NO. ________ 2 WHEREAS, the City’s R‐8 and R‐10 zoning districts are intended to implement land use designations RMD and RHD, respectively, but six parcels were split zoned R‐8 and R‐10, resulting in conflicting land use designations; and WHEREAS, the City’s R‐6 and Residential‐4 (R‐4) zoning districts are intended to implement land use designations RMD and Residential Low Density (RLD), respectively, but a driveway tract on Duvall Pl SE serving four R‐4 zoned residences was split zoned R‐4 and R‐6, and the total tract had been designated RLD; and WHEREAS, the City’s R‐8 and R‐10 zoning districts are intended to implement land use designations RMD and RHD, respectively, but two parcels off of NE 4th St at Garden Ave N and Factory Ave N, were split zoned R‐8 and R‐10, resulting in conflicting land use designations; and WHEREAS, the City’s Resource Conservation (RC) zoning district is intended to implement land use designation RLD, but one parcel at the entrance to the Cedar River Nature Trail had been designated RMD and RLD instead of solely RLD; and WHEREAS, the City’s Commercial Arterial (CA) zoning district is intended to implement land use designation Commercial Mixed Use (CMU), but one CA zoned parcel at the intersection of Renton Ave S and SW Victoria St, surrounded entirely by R‐10 parcels, had been designated RHD; and WHEREAS, the City’s R‐8, R‐10, and CA zoning districts are intended to implement land use designations RMD, RHD, and CMU, respectively, but two Seattle Public Utilities (SPU) split zoned parcels had not been designated the correct proportional amount RMD, RHD, and CMU equal to that of the area comprised by the R‐8, R‐10, and CA zoning; and AGENDA ITEM # 7. i) ORDINANCE NO. ________ 3 WHEREAS, the City’s CA, Industrial‐Medium (IM) and Residential Multi Family (RMF) zoning districts are intended to implement land use designations CMU, Employment Area (EA), and RHD, respectively, but two Burlington Northern Santa Fe (BNSF) Right‐of‐Way parcels had not been designated the correct proportional amount CMU, EA, and RHD equal to that of the area comprised by the CA, IM, and RMF zoning; and WHEREAS, as set forth in the Land Use Element of the Comprehensive Plan, the City’s CA zoning district is intended to implement both the EA land use designation and CMU land use designation, but the CMU land use designation will ensure consistency with the land use designation of other adjacent parcels where mixed‐use development is expected to occur; and WHEREAS, it is appropriate for a small portion of the Benson Hill Community immediately south of SE Petrovitsky Rd to have the current land use designation of RLD be amended to RMD land use designation because the area can serve as a transition between the significant critical areas that lie to the east and the higher density zoned area to the west; and WHEREAS, the City held a public hearing on this matter on September 16, 2020; and WHEREAS, the Planning Commission has made certain findings and recommendations to the Council; and WHEREAS, the Council has duly determined after due consideration of the evidence before it that it is advisable and appropriate to amend and modify the City's Comprehensive Plan; and WHEREAS, such modification and elements for the Comprehensive Plan being in the best interest for the public benefit; AGENDA ITEM # 7. i) ORDINANCE NO. ________ 4 NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The above findings and recitals are found to be true and correct in all respects. SECTION II. The Comprehensive Plan Land Use Map is hereby modified, amended, and adopted as reflected in Attachment A, which attachment shows the 21 parcels within the City’s Kennydale Area that are changed from the RHD land use designation to the RMD land use designation. SECTION III. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment B, which attachment shows one parcel within the City’s Kennydale Area that is changed from the RHD land use designation to the RMD land use designation. SECTION IV. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment C, which attachment shows one parcel within the City’s Highlands Area that is changed from the RMD land use designation to the RHD land use designation. SECTION V. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment D, which attachment shows six parcels with the following changes: The west segment of PID 152305UNKN, PID 0100300610, PID 0100300120, PID 0100300240, PID 0100300620: Split land use designation RMD and RHD changed to land use designation RMD. AGENDA ITEM # 7. i) ORDINANCE NO. ________ 5 PID 0100300280: Split land use designation RMD and RHD changed to land use designation RHD. SECTION VI. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment E, which attachment shows two parcels within the City Center with split land use designations RHD and CMU changed to land use designation RHD. SECTION VII. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment F, which attachment shows one parcel within the City’s Cedar River area with split land use designations RLD and COR changed to land use designation RLD. SECTION VIII. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment G, which attachment shows a segment of the SPU waterline within the City’s West Hill and City Center Areas changed to land use designation RHD. SECTION IX. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment H, which attachment shows a segment of the BNSF Right‐ of‐Way within the City’s Employment Area with split land use designations RHD and EA changed to land use designation RHD. SECTION X. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment I, which attachment shows one parcel within the City Center with split land use designations EA and CMU changed to land use designation CMU. SECTION XI. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment J, which attachment shows the parcel at 900 Lind Ave SW that is changed from land use designation EA to land use designation CMU. AGENDA ITEM # 7. i) ORDINANCE NO. ________ 6 SECTION XII. The Comprehensive Plan Land Use Map is hereby also modified, amended, and adopted as reflected in Attachment K, which attachment shows 29 parcels south of SE Petrovitsky Rd, west of 118th Ave SE, north of SE 180th St, east of 116th Ave SE that are changed from land use designation RLD to land use designation RMD. SECTION XIII. The Community and Economic Development Administrator is hereby authorized and directed to make the necessary changes on said City's Comprehensive Plan and the maps in conjunction therewith to evidence the aforementioned amendments. SECTION XIV. The City Clerk is authorized and directed to file this ordinance as provided by law, and a complete copy of said document likewise being on file with the office of the City Clerk of the City of Renton. SECTION XV. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. i) ORDINANCE NO. ________ 7 Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2144:11/2/2020 AGENDA ITEM # 7. i) ATTACHMENT A Residential Area North of Seahawks Training Camp Action: Change land use to RMD ORDINANCE NO. ________ 8 AGENDA ITEM # 7. i) ATTACHMENT B N 40th St & Lake Washington Blvd Action: Change land use to RMD ORDINANCE NO. ________ 9 AGENDA ITEM # 7. i) ATTACHMENT C 4433 NE 2nd Ln Action: Change land use to RHD ORDINANCE NO. ________ 10 AGENDA ITEM # 7. i) ATTACHMENT D NE 4th St & Hoquiam Ave NE Action: Designate parcels RMD and RHD ORDINANCE NO. ________ 11 AGENDA ITEM # 7. i) ATTACHMENT E NE 4th St & Hoquiam Ave NE Action: Designate both parcels RHD ORDINANCE NO. ________ 12 AGENDA ITEM # 7. i) ATTACHMENT F Cedar River Natural Area Action: Designate parcel RLD ORDINANCE NO. ________ 13 AGENDA ITEM # 7. i) ATTACHMENT G Seattle Public Utilities Waterline Action: Designate westerly and center parcels RHD ORDINANCE NO. ________ 14 AGENDA ITEM # 7. i) ATTACHMENT H BNSF ROW Action: Designate parcel RHD ORDINANCE NO. ________ 15 AGENDA ITEM # 7. i) ATTACHMENT I Wal-Mart Action: Designate parcel CMU ORDINANCE NO. ________ 16 AGENDA ITEM # 7. i) ATTACHMENT J M:01 900 Lind Ave Action: Designate Parcels CMU Land Use Designation ORDINANCE NO. ________ 17 AGENDA ITEM # 7. i) ATTACHMENT K M:03 Benson Upland Group Action: Designate Parcels RMD Land Use Designation ORDINANCE NO. ________ 18 AGENDA ITEM # 7. i) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. _______ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, CHANGING THE ZONING CLASSIFICATION OF ONE PARCEL (KING COUNTY PARCEL NUMBER 1923059047) WITHIN THE CITY OF RENTON FROM INDUSTRIAL MEDIUM (IM) TO COMMERCIAL ARTERIAL (CA) (CPA 2019‐M‐01) AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the parcel identified as King County Parcel Number 1923059047 and depicted in Attachment A (the “Property”) has heretofore been zoned as Industrial Medium (IM); and WHEREAS, the City initiated the proceeding change of zone classification of the Property with the support of the Property owner; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, the Planning Commission recommended the Property be zoned as Commercial Arterial (CA); and WHEREAS, said zoning request being in conformity with the City’s Comprehensive Plan, as amended; and AGENDA ITEM # 7. j) ORDINANCE NO. ________ 2 WHEREAS, the City Council considered all relevant matters, and heard all parties in support or opposition; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The Property is hereby rezoned to Commercial Arterial (CA). The Planning Division is hereby authorized and directed to change the Official Zoning Map of the City, as amended, to evidence said rezoning, to‐wit: See Attachment A attached hereto and made a part hereof as if fully set forth herein. SECTION II. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _____ day of _______________, 2020. Jason Seth, City Clerk APPROVED BY THE MAYOR this _____ day of _______________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. j) ORDINANCE NO. ________ 3 Approved as to form: Shane Moloney, City Attorney Date of Publication: ________________ ORD:2145:11/4/2020 AGENDA ITEM # 7. j) 4Attachment AZoning Map Changefrom Industrial, Medium(IM) to CommercialArterial (CA)900 Lind Ave SWParcel Number1923059047Car Pros KiaZoning Map ChangeORDINANCE NO.__________4AGENDA ITEM # 7. j) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. _______ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, CHANGING THE ZONING CLASSIFICATION OF 14 PARCELS WITHIN THE CITY OF RENTON AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the six parcels depicted in Attachment A bound by NE 4th St and Field Pl NE to the north and west of Hoquiam Ave NE, have heretofore been split zoned as Residential‐8 (R‐8) and Residential‐10 (R‐10); and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the parcel depicted in Attachment B located south of Elma Pl SE, north of SE 2nd Pl, and east of Duvall Ave SE has heretofore been split zoned Residential‐4 (R‐4) and Residential‐6 (R‐6); and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the western segment of the parcel depicted in Attachment C containing a utilities right‐of‐way bound by S 134th St to the north, 84th Ave S to the east, SW Langston Rd to the south, and Oakesdale Ave SW to the west has heretofore been split zoned R‐8 and R‐10; and AGENDA ITEM # 7. k) ORDINANCE NO. ________ 2 WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the two parcels depicted in Attachment D located south of N 4th St, west of Factory Ave N, east of Garden Ave N, and N 3rd St to the south have heretofore been split zoned R‐8 and R‐10; and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the parcel depicted in Attachment E bound by Renton Ave S to the northwest, Hardie Ave SW to the east, and SW Victoria St to the south has heretofore been zoned CA; and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the parcel depicted in Attachment F containing a utility right‐of‐way north of SW 7th St and west of Hardie Ave SW has heretofore been split zoned Residential Multi‐Family (RMF), CA, and Center Downtown (CD); and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, a second parcel depicted in Attachment F containing a utility right‐of‐way north of SW 7th St and west of Hardie Ave SW has heretofore been split zoned RMF and CA; and WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps AGENDA ITEM # 7. k) ORDINANCE NO. ________ 3 and reports adopted in conjunction therewith, the parcel depicted in Attachment G bound by SW 7th St to the north, Hardie Ave SW and Rainier Ave S to the east, S Grady Way to the south, and Lind Ave SW to the west has heretofore been split zoned CA and Industrial‐Medium (IM); and WHEREAS, the City initiated the proceeding change of zone classification for the King County Parcels described above and depicted in Attachments A‐G; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, the Planning Commission recommended the five of the six parcels that compromise the area bound by NE 4th St and Field Pl NE to the north and west of Hoquiam Ave NE be zoned R‐8 and one parcel be zoned R‐10 as depicted in Attachment A; and WHEREAS, the Planning Commission recommended a parcel south of Elma Pl SE, north of SE 2nd Pl, and east of Duvall Ave SE be zoned R‐4 as depicted in Attachment B; and WHEREAS, the Planning Commission recommended the western segment of the parcel containing a utilities right‐of‐way bound by S 134th St to the north, 84th Ave S to the east, SW Langston Rd to the south, and Oakesdale Ave SW to the west be zoned R‐10 as depicted in Attachment C; and WHEREAS, the Planning Commission recommended the parcels south of N 4th St, west of Factory Ave N, east of Garden Ave N, and N 3rd St to the south be zoned R‐10 as depicted in Attachment D; and AGENDA ITEM # 7. k) ORDINANCE NO. ________ 4 WHEREAS, the Planning Commission recommended the parcel bound by Renton Ave S to the northwest, Hardie Ave SW to the east, and SW Victoria St to the south be zoned R‐10 as depicted in Attachment E; and WHEREAS, the Planning Commission recommended the parcels containing a utility right‐ of‐way north of SW 7th St and west of Hardie Ave SW be zoned RMF as depicted in Attachment F; and WHEREAS, the Planning Commission recommended the parcel bound by SW 7th St to the north, Hardie Ave SW and Rainier Ave S to the east, S Grady Way to the south, and Lind Ave SW to the west be zoned CA as depicted in Attachment G; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, said zoning requests being in conformity with the Comprehensive Plan, as amended; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, the City Council considered all relevant matters, and heard all parties in support or opposition; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The following parcels are hereby rezoned as follows: AGENDA ITEM # 7. k) ORDINANCE NO. ________ 5 Five of the six parcels depicted in Attachment A are hereby rezoned to R‐8 and the remaining parcel is hereby rezoned R‐10; and The parcel depicted in Attachment B is hereby rezoned to R‐4; and The parcel depicted in Attachment C is hereby rezoned to R‐10; and The parcels depicted in Attachment D are hereby rezoned to R‐10; and The parcel depicted in Attachment E is hereby rezoned to R‐10; and The parcels depicted in Attachment F are hereby rezoned to RMF; and The parcel depicted in Attachment G is hereby rezoned to CA. See Attachments A‐G attached hereto and made a part of hereof as if fully set forth herein. SECTION II. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _____ day of _______________, 2020. Jason Seth, City Clerk APPROVED BY THE MAYOR this _____ day of _______________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. k) ORDINANCE NO. ________ 6 Approved as to form: Shane Moloney, City Attorney Date of Publication: ________________ ORD:2147:11/10/2020 AGENDA ITEM # 7. k) ATTACHMENT A NE 4th St & Hoquiam Ave NEAction: Assign single zone (R-8 or R-10) to each parcelORDINANCE NO. ________7AGENDA ITEM # 7. k) ATTACHMENT B Duvall Pl SE Action: Zone entire parcel R-4 ORDINANCE NO. ________ 8 AGENDA ITEM # 7. k) ATTACHMENT C SPU Waterline ParcelsAction: Assign R-10 zone to westerly parcelORDINANCE NO. ________9AGENDA ITEM # 7. k) ATTACHMENT DNE 4th St at Garden Ave N & Factory Ave NAction: Assign R-10 zone both parcelsORDINANCE NO. ________10AGENDA ITEM # 7. k) ATTACHMENT E Renton Ave S and SW Victoria St Action: Change zoning to R-10 ORDINANCE NO. ________ 11 AGENDA ITEM # 7. k) ATTACHMENT F BNSF Right of WayAction: Assign RMF zoning to both parcelsORDINANCE NO. ________12AGENDA ITEM # 7. k) ATTACHMENT G WalmartAction: Assign CA zoning to entire parcelORDINANCE NO. ________13AGENDA ITEM # 7. k) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. _______ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, CHANGING THE ZONING CLASSIFICATION OF TWENTY‐NINE PARCELS BOUNDED BY SE PETROVITSKY ROAD TO THE NORTH, 118TH AVENUE SE TO THE EAST, SE 180TH STREET TO THE SOUTH, AND 116TH AVENUE SE TO THE WEST WITHIN THE CITY OF RENTON FROM RESIDENTIAL FOUR (R‐4) TO RESIDENTIAL SIX (R‐6) (CPA 2019‐ M‐03) AND ESTABLISHING AN EFFECTIVE DATE. WHEREAS, under Section 4‐2‐020 of Chapter 2, Zoning Districts – Uses and Standards, of Title IV (Development Regulations), of the Renton Municipal Code, as amended, and the maps and reports adopted in conjunction therewith, the property herein below described has heretofore been zoned as Residential Four (R‐4); and WHEREAS, on behalf of 14 property owners, including the Applicant, who together own 18 contiguous lots of the 29 parcels within the block bounded by SE Petrovitsky Road to the north, 118th Avenue SE to the east, SE 180th Street to the south, and 116th Avenue SE to the west (hereinafter, the 29 parcels are collectively the “Property”), an application was submitted and a proceeding for change of zone classification of said Property was initiated; and WHEREAS, this matter was duly referred to the Planning Commission for investigation and study, and the matter was considered by the Planning Commission; and WHEREAS, the Planning Commission held a public hearing on September 16, 2020, considered all relevant matters, and heard all parties in support or opposition, and subsequently forwarded a recommendation to the City Council; and WHEREAS, the Planning Commission recommended the Property be zoned as Residential Six (R‐6); and AGENDA ITEM # 7. l) ORDINANCE NO. ________ 2 WHEREAS, said zoning request being in conformity with the City’s Comprehensive Plan, as amended; and WHEREAS, the City Council considered all relevant matters, and heard all parties in support or opposition; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The Property is hereby rezoned to Residential Six (R‐6). The Planning Division is hereby authorized and directed to change the Official Zoning Map of the City, as amended, to evidence said rezoning, to‐wit: See Attachment A attached hereto and made a part hereof as if fully set forth herein. SECTION II. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. PASSED BY THE CITY COUNCIL this _____ day of _______________, 2020. Jason Seth, City Clerk APPROVED BY THE MAYOR this _____ day of _______________, 2020. Armondo Pavone, Mayor AGENDA ITEM # 7. l) ORDINANCE NO. ________ 3 Approved as to form: Shane Moloney, City Attorney Date of Publication: ________________ ORD:2146:11/4/2020 AGENDA ITEM # 7. l) Attachment A ORDINANCE NO. ________ 4 AGENDA ITEM # 7. l) 1 CITY OF RENTON, WASHINGTON ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, VACATING A PORTION OF AN ALLEY, LOCATED NEAR 1300 BRONSON WAY N AND SITUATED EAST OF GARDEN AVENUE N, WEST OF MEADOW AVENUE N, NORTH OF BRONSON WAY N, AND SOUTH OF N 2ND STREET. (1300 BRONSON WAY N STREET VACATION; VAC‐20‐001.) WHEREAS, a proper petition for vacating a portion of right‐of‐way as hereinafter more particularly described was filed with the City Clerk on July 21, 2020, and that petition was signed by the owners representing more than two‐thirds (2/3) of the property abutting upon the street or alley to be vacated; and WHEREAS, the City Council, by Resolution No. 4417, passed on October 5, 2020, set October 19, 2020, at 7:00 p.m., by means of the Zoom video conferencing web application as the time and place for a public hearing on this matter; and the City Clerk gave proper notice of this public hearing as provided by law, and all persons were heard who appeared to testify in favor or in opposition on this matter, and the City Council considered all information and arguments presented to it to determine whether the vacation is in the public interest, whether the property is not required for overall circulation of traffic within the City, and that the requested vacation is not detrimental to the public health, safety and general welfare; and WHEREAS, the Administrator of the Department of Community and Economic Development has considered this petition for vacation, and has found it to be in the public interest and for the public benefit, and that it is unlikely that injury or damage to any person or properties will result from this vacation; and AGENDA ITEM # 7. m) ORDINANCE NO. ________ 2 WHEREAS, on December 7, 2020, the City Council determined that the vacation should be granted and adopted the recommendation of the Department of Community and Economic Development to set compensation at $0 for the right‐of‐way vacation; NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO ORDAIN AS FOLLOWS: SECTION I. The following described portion of an alley located near 1300 Bronson Way N, to wit: (A portion of an alley situated east of Garden Avenue N, west of Meadow Avenue N, north of Bronson Way N, and south of N 2nd Street.) See Exhibit A, and depicted in Exhibit B, attached hereto and made a part hereof as if fully set forth herein, is hereby vacated. SECTION II. Compensation is hereby set at $0 for this right‐of‐way vacation. SECTION III. This ordinance shall be in full force and effect five (5) days after publication of a summary of this ordinance in the City’s official newspaper. The summary shall consist of this ordinance’s title. A certified copy of this ordinance shall be filed with the King County Recorder’s Office, and as otherwise provided by law. PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2020. Jason A. Seth, City Clerk AGENDA ITEM # 7. m) ORDINANCE NO. ________ 3 APPROVED BY THE MAYOR this _______ day of _____________________, 2020. Armondo Pavone, Mayor Approved as to form: Shane Moloney, City Attorney Date of Publication: ORD:2150:12/1/2020 AGENDA ITEM # 7. m) RIGHT OF WAY VACATION Exhibit A Legal Description Project: WO# PID GRANTOR: Street: THE WEST 1.00 FEET OF THE 16.00 FOOT WIDE ALLEY IN BLOCK 1, CAR WORK'S ADDITION TO RENTON, PER PLAT RECORDED IN VOLUME 15 OF PLATS, PAGE 47, RECORDS OF KING COUNTY, WASHINGTON, MORE PARTICULARLY DESCRIBED AS FOLLOWS: BEGINNING AT THE NORTHEAST CORNER OF LOT 1 IN SAID BLOCK 1; THENCE SOUTH 89°25'13" EAST, ALONG THE SOUTHERLY MARGIN OF NORTH 2ND STREET, A DISTANCE OF 1.00 FEET TO A LINE PARALLEL AND 1.00 FEET EASTERLY OF THE EASTERLY LINE OF LOTS 1 THROUGH 8; THENCE SOUTH 01 °03'27" WEST ALONG SAID PARALLEL LINE, A DISTANCE OF 314.95 FEET TO THE NORTHERLY MARGIN OF BRONSON WAY NORTH. THENCE SOUTH 81 °37'13" WEST ALONG SAID NORTHERLY MARGIN, A DISTANCE OF 1.01 FEET TO THE SOUTHEAST CORNER OF SAID LOT 8; THENCE NORTH 01 °03'27" EAST, ALONG THE EASTERL V LINE OF SAID LOTS 1 THROUGH 8, A DISTANCE OF 315.11 FEET TO THE POINT OF BEGINNING. CONTAINING 315 SQUARE FEET, MORE OR LESS. AGENDA ITEM # 7. m) AGENDA ITEM # 7. m)