Loading...
HomeMy WebLinkAboutMFP22000808.pdfDEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Major Franchise Permit: MFP22000808 IVR Number: 22000808 Permit Information Permit Name: Comcast Cable Franchise Permit Address/Location:02/17/2022Application Date:6624300070Parcel Number: 19010 102ND AVE SE Permit Type:03/28/2022Issue Date:Franchise Permit Work Class:03/28/2023Expiration Date:Major Utility Job Number: JB0000726989Franchise Type:Cable Description: Comcast JB0000726989 PLACE NEW 1x12 MUX IN EXISTING SPLICE CASE SP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4 DIGITAL NODE & PLACE 12CT PIGTAIL. PLACE STRAIGHT SPLICE. RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP. OVERLASH (1) HARDLINE COAX ON EXISTING AERIAL STRAND. RESPLICE EQUIPMENT & REBALANCE Contacts Name Address PhoneTypeBilling Rhonda Resnik Comcast 410 Valley Ave NW, Suite 12, Bldg C Puyallup, WA 98371 B: (253) 864-4246Applicant Annie Robertson Cannon Construction LLC 406 Porter Way Milton, WA 98354 ApplicantX Andrew Parker Comcast 410 Valley Ave NW, Suite 12 Bldg C Puyallup, WA 98371 B: (253) 225-0596Applicant James Hefley Cannon Construction 3601 20th St E Suite 2 Fife, WA 98424 Applicant Tom Donnelly Comcast Business Communications 1701 Jfk Blvd, 32nd Floor Philadelphia, PA 19103 B: (215) 286-7347 C: (215) 286-7557 Contact Michael Cannon Cannon Construction Inc 406 Porter Way Milton, WA 98354-9638 B: (253) 922-2787 C: (253) 588-4034 Contractor Business License Number: 20838Electrical Contractor: CANNOCI873CL Construction Contractor: CANNOCL791JK CITY OF RENTON ROW 1055 S Grady Way Renton, WA 98057-3232 Owner Laurie Dietz Comcast - Billing 1701 John F. Kennedy Blvd. Philadelphia, PA 19103 H: (425) 741-5733Specialized Billing General Conditions & Signature Permission is hereby given for the work described on this permit according to the conditions hereon and according to the approved plans and specifications pertaining thereto, subject to compliance with the Ordinance of the City of Renton. Ÿ This permit and plans must be posted at the job site at all times.Ÿ I hereby certify that no work is to be done except as described above and in approved plans, and that work is to conform to Renton Trench Restoration and Street Overlay Requirements. Ÿ Call 425.430.7203 or go to: https://permitting.rentonwa.gov one working day in advance to schedule an inspections and for ANY work in the Right of Way. Ÿ Call 8 1 1 to locate underground utilities at least two full business days prior to any excavation.Ÿ In accordance with RCW 19.122.033(4) the permit holder is required to contact (Williams Northwest Pipeline at 425.868.1010) (Olympic Pipeline at 206.510.0575) (Puget Sound Energy at 425.375.3397) to request a consultation with the transmission pipeline company prior to performing any construction or excavation activities. This requirement to consult with the transmission pipeline company is in addition to the requirement to Call before You Dig as required in RCW 19.122. Ÿ Page 1 of 2THIS PERMIT AND PLANS MUST BE POSTED AT THE JOB SITE AT ALL TIMES DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Page 1 of 1 | Published: 1/2/2019 Planning Division | 1055 South Grady Way, 6th Floor | Renton, WA 98057 | 425-430-7200 Email: franchisepermits@rentonwa.gov Website: rentonwa.gov FRANCHISE PERMIT APPLICATION Published: 1/2/2019 TO THE APPLICANT: Submit an electronic copy of the plans with the Franchise Permit Application and the Site Specific Traffic Control Application to franchisepermits@rentonwa.gov. Permit cost is $630.00. Inspection fee for trenching more than 60 lineal feet or installation of 6 or more poles will be billed at $60.00 per hour. Franchise Agency: Franchise Job Number: Phone: Contact Name: Email: Job Site Address: Project Name: Description of Work: Please check all that apply: ☐ New Construction ☐ Repair/Relocate ☐ Underground ☐ Overhead ☐ Sidewalk ☐ Street ☐ Open Trench ☐ Bore # of feet: Contractor Name: Phone: State Contractors License #: City of Renton Business License #: “I certify that I am the owner or applicant’s authorized agent and do hereby agree to abide to the terms and conditions set forth under this permit and shall comply with the City of Renton’s Trench Restoration and Street Overlay Requirements. ” Signature Date INSPECTIONS SHALL BE REQUESTED 24 HOURS PRIOR TO COMMENCEMENT OF ALL WORK BY CALLING THE INSPECTION LINE AT 425-430-7203 OR BY GOING TO MYBUILDINGPERMIT.COM Jobs are required to be called in for job start, re-inspection and project final. Re-inspection fees are billed at $125/hour. All Pre-Construction meetings shall be scheduled at a maximum of 14 days prior to the job start date. Plan Review/Development Engineering Date Approved as submitted Pre-Construction Meeting required Site Construction Inspector Date Approved with comments or redlines Camera inspection of utilities required Development Engineering Manager Date Comcast Cable Communications Management JB0000726989 Rhonda Resnik 253-905-8972 Rhonda_Resnik@comcast.com 19010 102ND AVE SE, RENTON, WA 98055 WAKVD00L00 2x4 PLACE NEW 1x12 MUX IN EXISTING SPLICE CASE SP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4 DIGITAL NODE & PLACE 12CT PIGTAIL. PLACE STRAIGHT SPLICE. RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP. OVERLASH(1) HARDLINE COAX ON EXISTING AERIAL STRAND. RESPLICE EQUIPMENT & REBALANCE Cannon Construction LLC - James Hefley 253-922-2787 ext 286 601590363 20838 2/17/2022 MFP22000808 Scott Warlick 3/24/2022 DEPARTMENT OF PUBLIC WORKS Note: The Applicant is responsible for compliance with all codes and regulations, whether or not described in this document. Page 1 of 2 | Published: 11/25/2019 Transportation Division | 1055 South Grady Way, 5th Floor | Renton, WA 98057 | 425-430-7380 Website: rentonwa.gov TRAFFIC CONTROL PLAN (TCP) APPLICATION Published: 11/25/2019 TRAFFIC CONTROL PLAN (TCP) MUST BE SUBMITTED TO PUBLIC WORKS TRANSPORTATION DIVISION FOR REVIEW/APPROVAL NO LATER THAN FIVE (5) WORKING DAYS BEFORE THE DATE OF WORK. The City of Renton requires any contractor, firm, corporation, or other public/private agency to prepare a TCP and obtain City of Renton's approval of that plan when construction, repair, or maintenance work is to be conducted within the city's right-of-way. TO THE APPLICANT: Submit the TCP application form and required submittal documents to TCP@rentonwa.gov with the subject line “TCP Application – [Project Name]” or the above address. The following items, electronic copies preferred, are all required for submittal of the TCP Application: 1.☐ A copy of the Traffic Control Plan (TCP) Application form. 2.☐ A copy of the required TCP layout, preferred 11” X 17” paper size format, which shall: ☐Include map(s) showing the location of the project and work area. ☐Be legible lettering and clear, contrasting, symbols of viewing or printing. ☐Must indicate street names, and north arrow and scale. ☐All signs and detour routes shall conform to the MUTCD, WSDOT TCPs, and the Washington State Traffic Control Flagger Certification handbook, by the Evergreen Safety Council. ☐Types of plans required: ☐Work hour plan – show all mobility impacts during construction hours. ☐Non-work plan - show all mobility impacts after work hours when limited or no work is happening in the right-of-way (ROW), if applicable. ☐Changing construction phases – show construction sequence and each construction phase change even if the traffic control is not modified, if applicable. ☐Pedestrian access/detour plan, if applicable. Project Name: ______________________________________________ Permit #: _____________________ Project Address: ____________________________________________________________________________ Work Date: From _____________ To _____________ Work Time: Start ______________ End ______________ Description of Work, Work Schedule, Equipment Used: _____________________________________________ ___________________________________________________________________________________________ ___________________________________________________________________________________________ Construction Company: ________________________________________ Phone/Cell: (_____) _____-________ Applicant Name: _________________________________ Email: ______________________________________ Business Address: _________________________________ City/State: __________________ Zip: __________ Approved By: _______________________________________________ Date: ________________________ Transportation Operations Engineering WAKVD00L00 2x4 19010 102ND AVE SE, RENTON, WA 98055 Monday Friday 8:00am 3:00pm PLACE NEW 1x12 MUX IN EXIST- -ING SPLICE CASE SP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4 DIGITAL NODE & PLACE 12CT PIGTAIL. Cannon Construction LLC 253 922 2787 James Hefley jhefley@cannonconstructioninc.com 406 Milton Way Milton, WA 98354 MFP22000808 Scott Warlick CED 3/24/2022 Note: The Applicant is responsible for compliance with all codes and regulations, whether or not described in this document. Page 2 of 2 | Published: 11/25/2019 APPLICANT AGREES TO ALL THE FOLLOWING: •TCP must be approved prior to commencing the work, and all permit conditions shall be met. •Existing pedestrian access shall be maintained. The work on pedestrian facilities shall be limited to one corner at a time, with the least possible inconvenience or delay to pedestrians. •Signage shall be used to warn motorcyclists/bicyclists of the potential hazards on any uneven surfaced or slippery road conditions during work and non-work hours. •The start of Work Time begins when any street or travel lane is fully/partially closed or impacts the follow of traffic. This includes set up within the traveled way or immediately adjacent to the roadway. •Emergency services (253-852-2121) shall be notified twenty-four (24) hours before any street or lane closures. •Contractor or entity must call Renton School District (425-204-4455) or any public/private agency, including public transit, to be affected by a temporary lane or road closure. •TCP for all street and/or lane closures shall be implemented and performed in compliance with the Manual on Uniform Traffic Control Devices (MUTCD) and/or State of Washington Department of Transportation (WSDOT) and all traffic regulations of the City of Renton and Revised Code of Washington (RCW). •Any lane or street closures not in conformance with the approved traffic control plan and/or without notification of emergency services may result in receiving a citation for violation of RCW 47.36.200 Signs or Flaggers at thoroughfare work sites and RCW 9A.36.050 Reckless Endangerment, and other applicable State and City codes. •Indemnify and hold harmless the City of Renton from any and all claims, actions, and judgments, including all costs of defense and attorney’s fees incurred in defending against same, arising from and related to implementation of the approved traffic control plans including claims arising from towing of private vehicles and the acts of the Applicant’s agents and employees. •The City of Renton shall be entitled, in its reasonable discretion, to settle claims prior to suit or judgment, and in such event shall indemnify and hold harmless the City for any such claims paid, including the City’s reasonable attorney’s fees and litigation costs incurred resulting from such claim. •In the event any claim or suit is brought against the City within the scope of this Agreement, Applicant will pay for legal counsel chosen by the City to defend against same. •Flagger and sign placement are subject to revision by the City Inspector on site, if needed to address traffic or pedestrian safety or travel. •Total road closure lasting more than twenty-four (24) hours is subject to the approval by the City Council. •Approved Temporary TCP must be at the work site during work hours. •Complete assistance and accommodation shall be provided to all kinds of pedestrian traffic when sidewalk or walkway is impeded to safely redirect pedestrians around a work zone. •Any vehicle, equipment, barricade, or portable tow-away sign used within the work area must display a company logo or any legally acceptable sign showing the company name, address, and telephone number at a conspicuous place on the vehicle or equipment. In the case of Temporary No Parking Zones, all the following apply in addition to previous: •Contractor must complete form to show limits of Temporary No Parking Zone identifying barricade locations for vacate parking or curb lane usage. •Contractor must post notice of dates and time of Temporary No Parking Zone with at least two signs per block seventy-two (72) hours in advance of effective date and time. •The cover sheet of this TCP form must be attached to each Temporary No Parking Sign on the project site. •Temporary traffic control devices must be removed immediately when work is done or no construction activities are going on. If deemed abandoned, City crews will remove and store them at the City’s maintenance shop (3555 NE 2nd Street; 425-430-7423). _______________________________ _______________________________ _______________________ Applicant’s Signature Print Name Date James Hefley 2/17/2022 10219190101902210042103091003310055188611030818865100501030510041190141030118855100561003418860190131030219018ROWROWROWROWROWROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSE 190TH STSE 190TH ST103RD CT SEEOPEOPEOPEOPEOPEOP EOP EOPEOPEOPEOPEOPEOP EOP EOPEOPEOPEOPEOPEOP102ND AVE SE102ND AVE SESIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKDRIVEWAYGRAVEL SHOULDERDRIVEWAYEOPWTWTW20-1W20-7aFLAGGERW20-4W20-1W20-7aFLAGGERW20-4W20-1W20-7aFLAGGERW20-4W20-1W20-7aFLAGGERW20-4R2-1R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[AERIAL WORK] CONTROL TYPE: FLAGGING CONTROL 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000111AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 18851188191883618861188151886510127188161885518860188261884610133101171884518839ROWROWROWROWROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROWROWROW ROWROWROWROWROW EOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP EOP EOP EOPEOPEOP102ND AVE SEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYEOPSE 190TH STW20-1W20-7aFLAGGERWTW20-4DRIVEWAYWTW20-1W20-7aFLAGGERW20-4R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[AERIAL WORK] CONTROL TYPE: FLAGGING CONTROL 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000112AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 010102188191010118721101401881018836101281881510127103551871718713188161035910011188261013310116187291011710035ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROW ROW ROWROWROW SE 188TH ST102ND AVE SEEOPEOPEOPEOP EOP EOP EOP EOP EOPEOPEOP 102ND AVE SE102ND AVE SEEOP EOP EOP SIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYW20-1W20-7aFLAGGERWTW20-4WTWTW20-1W20-7aFLAGGERW20-4W20-1W20-7aFLAGGERW20-4R2-1R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[AERIAL WORK] CONTROL TYPE: FLAGGING CONTROL 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000113AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 EOPEOPEOPEOP EOP9179239299354786859905911853010104 103704835102281861510308103631872110205102231033210349103171861648291031110216101041035518717102171871310335103011030710234103711035971848231021110229103391030910336100121001110348102221872910302103671021010035ROW ROW ROW ROW ROW ROW ROW ROWROWROWROW ROW ROWROW 102ND AVE SES 49TH STSE 186TH ST102ND AVE SESE 187TH STEOPEOPEOPEOP EOP EOP EOP EOPEOPEOPEOPEOP EOPEOPEOP102ND AVE SE102ND AVE SEEOP EOP EOPEOPSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAY DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYSIDEWALKROWROWROWROWROWROWROWROWROW R2-1W20-1W20-7aWTW20-4WTWTW20-1W20-7aW20-4W20-1W20-7aW20-4WTFLAGGERW20-1W20-7aFLAGGERW20-4FLAGGERR2-1R2-1R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[AERIAL WORK] CONTROL TYPE: FLAGGING CONTROL 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000114AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 SIDEWALKEOP EOP EOP EOP 1113907913919100510111020510208482310211102144817ROW ROWROWROWROWROWROWROWROWROW ROW ROW ROWROWROWROWROW SE 185TH PL102ND AVE SES 48TH STEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOPSIDEWALKDRIVEWAYDRIVEWAYROWROWROWROWROWROWROWROWROWROW102ND AVE SEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKSIDEWALKEOPEOPEOPW20-1W21-5WTR2-1W20-1W20-1R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000115AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 87386688047384744865470047064712870874472647034709471547214727729735739ROW ROW ROWEOPEOP EOPEOPEOP EOPEOPEOPROWROWROWROWROWROWROWBURNETT CT SS 47TH ST4720ROWROWROWROWROWROWROWROW EOPEOPEOPEOPEOPEOPEOPSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY D R I V E W A Y DRIVEWAYDRIVEWAYDRIVEWAYR2-1W20-1W21-5WTW20-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000116AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 4738729739EOP4723472647414714471772347204711470847504756472947354732ROW ROW ROW ROW SMITHERS AVE SS 47TH STDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKW20-1W20-7aFLAGGERWT W20-4W20-1W20-7aFLAGGERW20-4R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000117AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 112811341140114612101216112511311137114312091215ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWS 47TH PLEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYW20-1W20-7aFLAGGER WTW20-4W20-1W20-7aFLAGGERW20-4R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000118AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 10219103081886218865ROWROWROWROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW103RD CT SEEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPDRIVEWAYEOPEOPEOPEOPEOP EOP EOP EOP EOP W20-1W21-5WTW20-1R2-1SE 190TH STTHE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 000119AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 DRIVEWAYSIDEWALK19008103331902119004ROWROWROWROWROWROWROWEOPEOPEOPEOPROWROWROWROWROWROWROW 18926190101034118920190021901719018ROW ROW ROW ROW ROW ROW104TH PL SEEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP SE 190TH STDRIVEWAYSIDEWALKDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKSIDEWALKW20-1W21-5W20-1WTW20-1R2-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 0001110AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 188351882918823ROWROWROWROW EOPEOP1040610415104191041018908104131890710416ROW ROW ROW ROWROWROWROWROWROWROWROWSE 189TH CT104TH PL SESE 188TH CTEOPEOPEOPEOPEOPEOPEOP DRIVEWAYDRIVEWAY DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYWT W20-1W21-5W20-1R2-1THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHINTHIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVEDBY THE PUBLIC AUTHORITY HAVING JURISDICTIONSITE SPECIFIC TRAFFIC CONTROL PLAN[UNDERGROUND WORK] CONTROL TYPE: SHOULDER CLOSURE 2-LANE ROADSIGN SPACING = X (FEET)FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO)RURAL HIGHWAYS 60/65 MPH 800' +/-RURAL ROADS 45/55 MPH 500' +/-RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/-RURAL ROADS & URBAN ARTERIALSRESIDENTAL & BUSINESS DISTRICTSURBAN STREETS 25 MPH OR LESS 100' +/-25/30 MPH 200' +/-ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED(1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADEINTERSECTIONS AND DRIVEWAYS.(2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS.10105150205270450500550---11115160225295495550605660--12125180245320540600660720780840LANEWIDTH25303540455055606570MINIMUM TAPER LENGTH IN FEET = LPOSTED SPEED LIMIT (MPH)SPEED253035455055155200250360425495570LONGITUDINAL BUFFER SPACE = BLENGTH40305606570780840DISCLAIMERAll traffic control setups, sign spacing, and procedures will conformto the specifications stated in the federal Manual on Uniform TrafficControl Devices (M.U.T.C.D)Cities and various municipalities may have also adopted specializedguidelines for traffic control within their jurisdiction. It is theresponsibility of the on-site traffic control personnel to verify if anyspecial conditions exist.TRAFFIC CONTROL ADDITIONAL NOTES-For aerial work, there will be a moving traffic control setup-Will coordinate with businesses that will be affected byconstruction-Will have spotter on site to escort pedestrians throughwork zone-All work will stop while pedestrians are escorted throughwork zones-Will have no more than two work areas active at a timeSITE NOTES-Maintain driveway access at all times-Place temporary "NO PARKING" signs at least72 hours prior to work-Sidewalks to remain open during road workunless noted otherwiseFLAGGER SPOTTER WTLEGENDWork Vehicle Work AreaFlagger SpotterNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC TCPNODE SEGMENTATION JB0000726989 0001111AFWK2/17/2022NTSRENTON, WA 98055 19010 102ND AVE SE WAKVD00L00 2x4 17-050MFP22000808 SHEET INDEX: 1 - COVER SHEET 2 -LEGEND 3 -GENERAL NOTES 4 -OVERVIEW 5-11 -DESIGN THIS IS PROPRIETARY INFORMATION AND NOT MEANT FOR GENERAL PUBLICATION. ALL RIGHTS RESERVED BY CANNON COMPANIES HARDLINE COAX: 1370 FT + 20% STORAGE = 1644 FT CONTACTS: PROJECT MAP: *ALL FOOTAGES AND MATERIALS ARE ESTIMATED N SCOPE OF WORK: - PLACE NEW 1x12 MUX IN EXISTING SPLICE CASE SP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4 DIGITAL NODE & PLACE 12CT PIGTAIL. - PLACE STRAIGHT SPLICE. - RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP. - OVERLASH (1) HARDLINE COAX ON EXISTING AERIAL STRAND. - RESPLICE EQUIPMENT & REBALANCE. BILL OF MATERIALS*: NEW AERIAL = OVERLASH = NEW UNDERGROUND = EXISTING UNDERGROUND = RISER (0)= TOTAL ROW FOOTAGE = 0 FT. 1370 FT. 0 FT. 0 FT. 0 FT. 1370 FT. CANNON COMPANIES SAFETY | QUALITY | INTEGRITY | TEAMWORK Connecting The Future Since 1985 COMCAST 19010 102ND AVE SE RENTON, WA 98055WAKVD00L00 2x4 JB0000726989 NODE SEGMENTATION CANNON COMPANIES Alex Fox - (253)-359-6809 - afox@cannonconstructioninc.com ROW FOOTAGES*: NEW BUILDING PATHWAY = EXISTING BUILDING PATHWAY = NEW UNDERGROUND = EXISTING UNDERGROUND = TOTAL SITE FOOTAGE = 0 FT. 0 FT. 0 FT. 0 FT. 0 FT. SITE FOOTAGES*: TOTAL PROJECT FOOTAGE =1370 FT. POLE INFORMATION: POLE COUNT = POLES THAT NEED PERMIT = POLES THAT NEED MAKE READY = TRANSMISSION = 0 DISTRIBUTION = 11 11 11 2 5 6 7 8 9 10 11 This permit is for Major construction work in the ROW and will be billed at an additional $60/HR for inspections. After hours and weekend work will be billed at $125/HR MFP22000808 OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAFNTS000211LEGENDEDGE OF PAVEMENTFOGLINEPOWERCOMMUNICATIONSEWERDRAINDRAINAGE DITCHGASWATERTRAFFIC SIGNALTELCOMSTEAMUNKNOWN UTILITYRIGHT OF WAYTRAFFIC CONESPROPOSED NEW BORESTRAW WATTLESPLTCWRUTILITY POLEVAULT - SMALLPEDESTALSTREET LIGHTCROSSWALK LIGHTUTILITY RISERVVAULT - SMALL444LA MANHOLEVAULT - 25TACATCH BASINCATCH BASIN WITH SOCKGLULAM UTILITY POLECENTER LINELANE LINEFENCEHIGH VISIBILITY FENCE SSEWER MANHOLEDDRAIN MANHOLEWWATER MANHOLEVUTILITY VALVESHRUBBERYBORE PITVAULT - LARGEVAULT - 25TACCOMMUNICATION MANHOLEFIRE HYDRANTDISTANCE STATIONSTA 0+00CONSTRUCTION NOTE CALLOUT#X.XDISTANCE DIMENSIONASPHALT SURFACECONCRETE ROADWAY PANELHFH-FRAMEVAULT - LARGECABCABINETLEGENDLANE DIRECTION INDICATORPROPOSEDMARK-UP NOTATIONSRESTORATION TYPESEXISTING FEATURESLINE TYPESA7LANDSCAPECROSS SECTION SYMBOLCROSS SECTION NAMECROSS SECTION SHOWN ON PAGEFLFLPPTSTSCCDDDDDDDDDDDDGGWWTTSTSTROWROWSUKCBCBPPVVVVVVPROPOSED WORK1LOCATIONPHOTO NOTE CALLOUT#PHOTO LOCATOR SYMBOLPROPOSED NEW TRENCHEXISTING UNDERGROUND PATHWAYPROPOSED NEW AERIAL STRANDEXISTING AERIAL PATHWAYEXISTING SPLICE CASEPROPOSED SPLICE CASEEXISTING FIBER/COAX STORAGEPROPOSED FIBER/COAX STORAGETREEEOPVVAULT - SMALL444LA MANHOLEVAULT - 25TAVAULT - LARGEEXISTING - CONTINUED233LA MANHOLE233LA MANHOLEMFP22000808 OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAFNTS000311GENERAL NOTESMFP22000808 1370'1V5V5V5VV555V5431CONSTRUCTION NOTES:PLACE NEW 1x12 MUX IN EXISTING SPLICE CASESP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4DIGITAL NODE & PLACE 12CT PIGTAIL.PLACE STRAIGHT SPLICE.RESPLICE FROM AMP AA009 TO SPLICE & TERM AMPOVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.RESPLICE COAX DEVICE & REBALANCE.23452OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAFNTS000411DESIGNNOVERVIEWMFP22000808 DRIVEWAY1021919010100421005518861100501004119014188551005610034188601030218846ROWROWROWROWROWROWROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSE 190TH STSE 190TH STEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOPEOPEOPEOPEOPEOP102ND AVE SE102ND AVE SESIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKDRIVEWAY189'125'P3P2P1MATCH LINESEE SHEET 6321CONSTRUCTION NOTES:PLACE NEW 1x12 MUX IN EXISTING SPLICE CASESP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4DIGITAL NODE & PLACE 12CT PIGTAIL.PLACE STRAIGHT SPLICE.RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP.OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.RESPLICE EQUIPMENT & REBALANCE.V41245GRAVEL SHOULDER53OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P3PSE316084 - 166088NEUTRAL254N/ASECONDARY254N/ASECONDARY DRIP232N/ASTREET LIGHT217N/ASTREET LIGHT DRIP213N/ACOMCAST203N/ATELCO193N/ADNNYNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P2PSE316074 - 166087NEUTRAL264N/ASECONDARY264N/ASECONDARY DRIP250N/ACOMCAST218N/ATELCO209N/ADNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P1PSE316061 - 166087NEUTRAL286N/ASECONDARY286N/ASECONDARY DRIP270N/ASTREET LIGHT244N/ASTREET LIGHT DRIP240N/ACOMCAST228N/ATELCO215N/ADNNNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'511DESIGNNMFP22000808 18819188101883618815101271881618826101331884518839ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROW ROWROW SE 188TH ST102ND AVE SEEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP EOP EOP EOP EOPEOPEOPEOP102ND AVE SEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY152'146'170'P5P4MATCH LINESEE SHEET 71CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 511OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P5PSE326117 - 166088NEUTRAL258N/ASECONDARY255N/ASECONDARY DRIP232N/ASTREET LIGHT245N/ASTREET LIGHT DRIP235N/ACOMCAST212N/ATELCO201N/ADNNYNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P4PSE316102 - 166088NEUTRAL2510N/ASECONDARY252N/ASECONDARY DRIP248N/ASTREET LIGHT234N/ACOMCAST213N/ATELCO202N/ADNNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'611DESIGNNMFP22000808 1872110140101281871718713101161872910035ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROW SE 187TH STEOP EOP EOP EOP EOP EOPEOPEOPEOPEOP102ND AVE SE102ND AVE SEEOP EOP EOP EOP EOP EOPEOPEOPEOPEOPSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY102'184'75'P9P8P7P6MATCH LINESEE SHEET 81CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 611OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P9PSE316171 - 166089NEUTRAL2710N/ASECONDARY2710N/ASECONDARY DRIP265N/ASTREET LIGHT245N/ASTREET LIGHT DRIP240N/ACOMCAST230N/ATELCO2011N/ADNNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P8PSE316161 - 166089NEUTRAL2610N/ASECONDARY2610N/ASECONDARY DRIP2510N/ACOMCAST2111N/ATELCO209N/ADNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P7PSE316143 - 166089NEUTRAL283N/ASECONDARY283N/ASECONDARY DRIP2511N/ASTREET LIGHT257N/ACOMCAST222N/ATELCO214N/ADNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P6PSE316138 - 166087NEUTRAL301N/ASECONDARY301N/ASECONDARY DRIP290N/ASTREET LIGHT276N/ACOMCAST (MA)220N/ADNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'711DESIGNNMFP22000808 9179239299359059111010418615186164829102161010410210ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROW102ND AVE SES 49TH STSE 186TH ST102ND AVE SEEOPEOPEOPEOPEOP EOP EOP EOPEOPEOPEOP EOP EOP EOP EOPEOPEOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYSIDEWALKEOPEOPEOPEOPEOPEOPEOP EOP ROWROWROWROWROWROWROWROWROWROWROWROWROW170'149'P11P101CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 711OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P11PSE316201 - 166090NEUTRAL309N/ASECONDARY309N/ASECONDARY DRIP296N/ASTREET LIGHT243N/ASTREET LIGHT DRIP2310N/ACOMCAST2210N/ATELCO2110N/ADNNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P10PSE316181 - 166089NEUTRAL3010N/ASECONDARY3010N/ASECONDARY DRIP2910N/ACOMCAST2411N/ATELCO222N/ADNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'811DESIGNNMFP22000808 473847444700470647124726470347094715472147274733729735736739730ROWROWROWROWROWROWROWROWROWEOPEOPEOPEOPEOPEOPEOPROW ROWEOP EOPEOPEOPROWBURNETT CT SS 47TH ST4723472647077067244714471747017127234720471170071847084750472947354732ROWROW ROWROWROWROWROWROWV ROWROW EOPEOPEOPEOPS 47TH STVDRIVEWAYSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRI VEWAY D R I V E W A Y DRIVEWAYDRIVEWAYDRIVEWAY111CONSTRUCTION NOTES:RESPLICE EQUIPMENT & REBALANCEOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'911DESIGNNMFP22000808 SIDEWALK110111071113111911251131113711491143120912151203100510111031010220102261020810232102144817ROWROWROWROWROWROWROWROWROWROWROWROWROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSE 185TH PLS 47TH PLEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOPEOPEOPEOPEOPEOPDRIVEWAYEOP ROWROWROWROW V102ND AVE SE102ND AVE SEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKEOP1CONSTRUCTION NOTES:RESPLICE EQUIPMENT & REBALANCE21OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'1011DESIGNNMFP22000808 SIDEWALK10318188351882919004ROW ROWROWROWROWROWROWROWEOPEOPROWROWROWROWROWROW18926104061034110415189201883519002104101042618908189141890710416ROW ROW ROWROWROWROW104TH PL SESE 189TH CT104TH PL SEVVEOPEOPEOPEOPEOP EOPEOPEOPEOPSE 190TH STDRIVEWAYSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY DRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAY1CONSTRUCTION NOTES:RESPLICE EQUIPMENT & REBALANCE11OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'1111DESIGNNMFP22000808 Cannon Construction LLC. 406 Porter Way Milton, WA 98354 3/21/2022 City of Renton 1055 South Grady Way Renton, WA 98057 RE: Aerial Variance Request for JB0000726989 To whom it may concern: Cannon Construction has been contracted to design and engineer this project on behalf of Comcast Cable Communications Management. Comcast is applying for a variance request in order to upgrade their existing facilities. Comcast proposes to PLACE NEW 1x12 MUX IN EXISTING SPLICE CASE SP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4 DIGITAL NODE & PLACE 12CT PIGTAIL. - PLACE STRAIGHT SPLICE. - RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP. - OVERLASH (1) HARDLINE COAX ON EXISTING AERIAL STRAND. - RESPLICE EQUIPMENT & REBALANCE. 19010 102ND AVE SE RENTON, WA 98055 Comcast is requesting that the City of Renton approve this variance request based on the fact that the requirements for undergrounding this proposed over-lash on existing plant will cause undue hardship. 1. Installation of undergrounding facilities will increase the total cost of construction roughly 15-25 times the amount of an aerial over-lash on the existing Comcast strand. 2. Risk of potential damage to underground facilities will be increased. 3. Over-lash will not cause substantial adverse impact to other persons or entities in the immediate area. Over-lashing the cable will be accomplished in a few days, and the residents will not notice any impact. Comcast will clean up the over-lashed spans as necessary and identify and remove any existing dead cables along this route. 4. The variance is necessary to prevent any undue hardship due to the increased construction costs if forced to install the proposed extension underground. 5. The granting of the variance will not be materially detrimental to the public welfare. Comcast does agree to participate in future underground improvements for its proportionate share of the undergrounding costs, waiving the obligation into the future when all other utilities are undergrounded to prevent an undue hardship against Comcast currently. Upon the granting of the variance, Comcast will coordinate construction and traffic control as per your requirements. Comcast and their contractors want to cooperate at the highest level and agree to adhere to all provisions and requirements set forth by the City of Renton to insure safe installation and maintenance of the proposed facilities. If you have any further questions regarding this project, please contact Alex Fox 253.359.6809 Thank you for your consideration in this matter. James Hefley Permit Coordinator Cannon Construction Inc. o 253-922-2787 ext 286 | jhefley@cannonconstructioninc.com March 28, 2022 James Hefley Cannon Construction Inc. 4610 Tacoma Avenue, Sumner WA 98390 Via Email: jhefley@cannonconstruction.com SUBJECT: Request for Undergrounding Exemption (JB#726989, MFP22000808, 19010 102nd Ave SE) Dear Mr. Hefley: The City of Renton has reviewed your request to grant Comcast an exemption from Renton Municipal Code (RMC) 4-6-090(C) which states that all new electrical or communication facilities shall be required to be installed underground, pursuant to the standards of the section of RMC. Comcast proposes to have Cannon Construction Inc overlash new coax for a total of approximately 1,460 lineal feet to existing Puget Sound Energy (PSE) poles along 102nd Ave SE within the City. See the enclosed Site Plan showing the proposed overlashing limits. ANALYSIS: The City has considered the request for an exemption from RMC 4-6-090. Ordinance 5720 grants Comcast, the right to install fiber optic cable and related appurtenances under, along, over, below, through and across the streets, avenues and alleys of City of Renton within the right-of-way of Renton. Section 3.4 of the franchise ordinance states that if all of the distribution lines all the wireline service providers, such as telecommunications service providers, as defined in RCW 35.99.010, a utility service provider or a Cable Operator (collectively “Service Providers”) in any portion of the Franchise Area are underground, Grantee shall place its Cable System’s distribution cables underground within that area; provided that such underground locations are actually capable of accommodating Grantee’s cable and other equipment without technical degradation of the Cable Systems’ signal quality. The proposal would utilize existing poles with other attached franchisee communication facilities and overlash to the existing Comcast aerial path. As minimum vertical height clearance of 15’-6” would need to be provided for, any existing obsolete cable will need to be removed; staff recommends these as conditions of approval. Therefore, the City is granting an exemption with conditions, per the Comcast franchise agreement which allows new overhead facilities to be placed overhead provided there are other similar providers overhead as well. Comcast is required to obtain all necessary private utility easements for work on private property. DECISION: The requested exemption from underground utility installation requirements RMC4-6-090 (C) as requested by the applicant is approved with conditions subject to the conditions below as the request complies with the Comcast Franchise Agreement. Comcast Job JB#426989 Page 2 of 2 March 28, 2022 Conditions of Approval: 1. Any existing height violations within the Project Reach must be resolved at the time of construction. New aerial lines within the Project Reach must have a minimum vertical clearance of 15’-6”. 2. Any abandoned or unused lines within the Project Reach must be removed at the time that construction is taking place. 3. A traffic control plan must be separately submitted to the City, and no construction may take place until the City has approved a traffic control plan. 4. The new aerial fiber lines within the Project Reach must be converted to underground facilities in the future, at the Applicant’s cost, when any one of the following events occurs: (1) any other utilities are undergrounded within the Project Reach, (2) a joint use trench is proposed by a franchisee within the Project Reach, in which case the Applicant shall participate in the joint use trench installation for the purpose of undergrounding its aerial lines, or (3) a conduit is made available within the Project Reach that will accommodate the aerial lines. The new aerial lines must be undergrounded within one year, or approved otherwise by the City of Renton Community and Economic Development Administrator or designee, from the first event triggering the requirement to underground the aerial lines. This decision to approve the exemption with conditions is subject to a fourteen (14) day appeal period from the date of this letter per RMC 4-8-110. Any appeals of the administrative decision must be filed with the City Clerk, along with the required appeal fee, by 5:00 pm, April 11, 2022. Due to the ongoing state of emergency enacted by Governor’s Proclamation 20-05, the City Clerk’s Office is working remotely. For that reason, appeals must be submitted electronically to the City Clerk at cityclerk@rentonwa.gov or delivered to City Hall 1st floor Lobby Hub only on Tuesdays and/or Wednesdays. The appeal fee, normally due at the time an appeal is submitted, will be collected at a future date if your appeal is submitted electronically. Appeals to the Hearing Examiner are governed by RMC 4-8-110 and additional information regarding the appeal process may be obtained from the City Clerk’s Office, cityclerk@rentonwa.gov. Sincerely, Brianne Bannwarth, PE Development Engineering Manager cc: C.E. “Chip” Vincent, CED Administrator Vanessa Dolbee, Planning Director Justin Johnson, Construction Manager Scott Warlick, Engineering Specialist III Holly Powers, Permit Technician Franchise Permits Enclosures: Site Plan DRIVEWAY1021919010100421005518861100501004119014188551005610034188601030218846ROWROWROWROWROWROWROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSE 190TH STSE 190TH STEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOPEOPEOPEOPEOPEOP102ND AVE SE102ND AVE SESIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKDRIVEWAY189'125'P3P2P1MATCH LINESEE SHEET 6321CONSTRUCTION NOTES:PLACE NEW 1x12 MUX IN EXISTING SPLICE CASESP.WAKV.0798. REPLACE KTVTH05300 WITH NEW 2x4DIGITAL NODE & PLACE 12CT PIGTAIL.PLACE STRAIGHT SPLICE.RESPLICE FROM AMP AA009 TO SPLICE & TERM AMP.OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.RESPLICE EQUIPMENT & REBALANCE.V41245GRAVEL SHOULDER53OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P3PSE316084 - 166088NEUTRAL254N/ASECONDARY254N/ASECONDARY DRIP232N/ASTREET LIGHT217N/ASTREET LIGHT DRIP213N/ACOMCAST203N/ATELCO193N/ADNNYNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P2PSE316074 - 166087NEUTRAL264N/ASECONDARY264N/ASECONDARY DRIP250N/ACOMCAST218N/ATELCO209N/ADNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P1PSE316061 - 166087NEUTRAL286N/ASECONDARY286N/ASECONDARY DRIP270N/ASTREET LIGHT244N/ASTREET LIGHT DRIP240N/ACOMCAST228N/ATELCO215N/ADNNNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'511DESIGNNMFP22000808 18819188101883618815101271881618826101331884518839ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROW ROWROW SE 188TH ST102ND AVE SEEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP EOP EOP EOP EOPEOPEOPEOP102ND AVE SEDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY152'146'170'P5P4MATCH LINESEE SHEET 71CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 511OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P5PSE326117 - 166088NEUTRAL258N/ASECONDARY255N/ASECONDARY DRIP232N/ASTREET LIGHT245N/ASTREET LIGHT DRIP235N/ACOMCAST212N/ATELCO201N/ADNNYNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P4PSE316102 - 166088NEUTRAL2510N/ASECONDARY252N/ASECONDARY DRIP248N/ASTREET LIGHT234N/ACOMCAST213N/ATELCO202N/ADNNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'611DESIGNNMFP22000808 1872110140101281871718713101161872910035ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROW SE 187TH STEOP EOP EOP EOP EOP EOPEOPEOPEOPEOP102ND AVE SE102ND AVE SEEOP EOP EOP EOP EOP EOPEOPEOPEOPEOPSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY102'184'75'P9P8P7P6MATCH LINESEE SHEET 81CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 611OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P9PSE316171 - 166089NEUTRAL2710N/ASECONDARY2710N/ASECONDARY DRIP265N/ASTREET LIGHT245N/ASTREET LIGHT DRIP240N/ACOMCAST230N/ATELCO2011N/ADNNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P8PSE316161 - 166089NEUTRAL2610N/ASECONDARY2610N/ASECONDARY DRIP2510N/ACOMCAST2111N/ATELCO209N/ADNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P7PSE316143 - 166089NEUTRAL283N/ASECONDARY283N/ASECONDARY DRIP2511N/ASTREET LIGHT257N/ACOMCAST222N/ATELCO214N/ADNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P6PSE316138 - 166087NEUTRAL301N/ASECONDARY301N/ASECONDARY DRIP290N/ASTREET LIGHT276N/ACOMCAST (MA)220N/ADNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'711DESIGNNMFP22000808 9179239299359059111010418615186164829102161010410210ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROW102ND AVE SES 49TH STSE 186TH ST102ND AVE SEEOPEOPEOPEOPEOP EOP EOP EOPEOPEOPEOP EOP EOP EOP EOPEOPEOPEOPEOPEOPSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYSIDEWALKSIDEWALKSIDEWALKDRIVEWAYDRIVEWAYSIDEWALKEOPEOPEOPEOPEOPEOPEOP EOP ROWROWROWROWROWROWROWROWROWROWROWROWROW170'149'P11P101CONSTRUCTION NOTES:OVERLASH (1) HARDLINE COAX ON EXISTING AERIALSTRAND.MATCH LINESEE SHEET 711OWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P11PSE316201 - 166090NEUTRAL309N/ASECONDARY309N/ASECONDARY DRIP296N/ASTREET LIGHT243N/ASTREET LIGHT DRIP2310N/ACOMCAST2210N/ATELCO2110N/ADNNNNNNNOWNER:POLE#:- ATTACHMENTS - HEIGHTCLASS/HT:POLE TYPE:- MAKE READY - VIOLATIONMID SPAN:P10PSE316181 - 166089NEUTRAL3010N/ASECONDARY3010N/ASECONDARY DRIP2910N/ACOMCAST2411N/ATELCO222N/ADNNNNNOFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000726989 WAKVD00L00 2x4 19010 102ND AVE SE RENTON, WA 98055 NODE SEGMENTATION17-0502/17/2022WKAF1" - 40'020'40'811DESIGNNMFP22000808 DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Conditions for Permit MFP22000808 Engineering 1 Any abandoned or unused lines within the Project Reach must be removed at the time that construction is taking place. 2 The new aerial fiber lines within the Project Reach must be converted to underground facilities in the future, at the Applicant’s cost, when any one of the following events occurs: (1) any other utilities are undergrounded within the Project Reach, (2) a joint use trench is proposed by a franchisee within the Project Reach, in which case the Applicant shall participate in the joint use trench installation for the purpose of undergrounding its aerial lines, or (3) a conduit is made available within the Project Reach that will accommodate the aerial lines. The new aerial lines must be undergrounded within one year, or approved otherwise by the City of Renton Community and Economic Development Administrator or designee, from the first event triggering the requirement to underground the aerial lines. 3 A traffic control plan must be separately submitted to the City, and no construction may take place until the City has approved a traffic control plan. 4 Any existing height violations within the Project Reach must be resolved at the time of construction. New aerial lines within the Project Reach must have a minimum vertical clearance of 15'-6". Page 1 of 1 DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Major Franchise Permit: MFP22000808 (Date)(Signature) Page 2 of 2THIS PERMIT AND PLANS MUST BE POSTED AT THE JOB SITE AT ALL TIMES