The URL can be used to link to this page

Home My WebLink AboutMFP22002040DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Minor Franchise Permit: MFP22002040 IVR Number: 22002040 Permit Information Permit Name: Comcast Cable Franchise Permit-JB0000549729 Address/Location:04/19/2022Application Date:7227801320Parcel Number: 1130 GLENNWOOD AVE NE Permit Type:05/17/2022Issue Date:Franchise Permit Work Class:05/17/2023Expiration Date:Minor Utility Job Number: JB0000549729Franchise Type:Cable Description: Comcast JB0000549729 TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINE COAX THROUGH EXISTING RISER. OPEN TRENCH ON SOFT SURFACE. INSTALL (1) 4" CONDUIT & PULL (1) HARDLINE COAX THROUGH OPEN TRENCH ON HARD SURFACE. INSTALL (1) 4" CONDUIT & PULL (1) HARDLINE COAX THROUGH DIRECTIONAL BORE. INSTALL (1) 4" CONDUIT & PULL (1) HARDLINE COAX THROUGH. PLACE 17x30 LOAD BEARING VAULT. SPLICE TAP IN VAULT. SWEEP CONDUIT INTO EXISTING RISER & PULL (1) HARDLINE COAX THROUGH. WRECKOUT EXISTING AERIAL SPAN Contacts Name Address PhoneTypeBilling James Hefley Cannon Construction 3601 20th St E Suite 2 Fife, WA 98424 Applicant Joshua Day CCI SYSTEMS 105 Kent St Iron Mountain, MI 49801 Applicant Annie Robertson Cannon Construction LLC 406 Porter Way Milton, WA 98354 ApplicantX Sandra Castro Comcast C: (209) 561-4786Contact CITY OF RENTON ROW 1055 S Grady Way Renton, WA 98057-3232 Owner Laurie Dietz Comcast - Billing 1701 John F. Kennedy Blvd. Philadelphia, PA 19103 H: (425) 741-5733Specialized Billing General Conditions & Signature Permission is hereby given for the work described on this permit according to the conditions hereon and according to the approved plans and specifications pertaining thereto, subject to compliance with the Ordinance of the City of Renton. Ÿ This permit and plans must be posted at the job site at all times.Ÿ I hereby certify that no work is to be done except as described above and in approved plans, and that work is to conform to Renton Trench Restoration and Street Overlay Requirements. Ÿ Call 425.430.7203 or go to: https://permitting.rentonwa.gov one working day in advance to schedule an inspections and for ANY work in the Right of Way. Ÿ Call 8 1 1 to locate underground utilities at least two full business days prior to any excavation.Ÿ In accordance with RCW 19.122.033(4) the permit holder is required to contact (Williams Northwest Pipeline at 425.868.1010) (Olympic Pipeline at 206.510.0575) (Puget Sound Energy at 425.375.3397) to request a consultation with the transmission pipeline company prior to performing any construction or excavation activities. This requirement to consult with the transmission pipeline company is in addition to the requirement to Call before You Dig as required in RCW 19.122. Ÿ (Date)(Signature) Page 1 of 1THIS PERMIT AND PLANS MUST BE POSTED AT THE JOB SITE AT ALL TIMES DEPARTMENT OF COMMUNITY AND ECONOMIC DEVELOPMENT Page 1 of 1 | Published: 1/2/2019 Planning Division | 1055 South Grady Way, 6th Floor | Renton, WA 98057 | 425-430-7200 Email: franchisepermits@rentonwa.gov Website: rentonwa.gov FRANCHISE PERMIT APPLICATION Published: 1/2/2019 TO THE APPLICANT: Submit an electronic copy of the plans with the Franchise Permit Application and the Site Specific Traffic Control Application to franchisepermits@rentonwa.gov. Permit cost is $630.00. Inspection fee for trenching more than 60 lineal feet or installation of 6 or more poles will be billed at $60.00 per hour. Franchise Agency: Franchise Job Number: Phone: Contact Name: Email: Job Site Address: Project Name: Description of Work: Please check all that apply: ☐ New Construction ☐ Repair/Relocate ☐ Underground ☐ Overhead ☐ Sidewalk ☐ Street ☐ Open Trench ☐ Bore # of feet: Contractor Name: Phone: State Contractors License #: City of Renton Business License #: “I certify that I am the owner or applicant’s authorized agent and do hereby agree to abide to the terms and conditions set forth under this permit and shall comply with the City of Renton’s Trench Restoration and Street Overlay Requirements. ” Signature Date INSPECTIONS SHALL BE REQUESTED 24 HOURS PRIOR TO COMMENCEMENT OF ALL WORK BY CALLING THE INSPECTION LINE AT 425-430-7203 OR BY GOING TO MYBUILDINGPERMIT.COM Jobs are required to be called in for job start, re-inspection and project final. Re-inspection fees are billed at $125/hour. All Pre-Construction meetings shall be scheduled at a maximum of 14 days prior to the job start date. Plan Review/Development Engineering Date Approved as submitted Pre-Construction Meeting required Site Construction Inspector Date Approved with comments or redlines Camera inspection of utilities required Development Engineering Manager Date Comcast Cable Communications Management JB0000549729 Sandra Castro 209-561-4786 sandra_castro2@comcast.com 1130 Glennwood Ave NE Renton, WA 98056 Renton Housing Authority TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINE COAX THROUGH EXISTING RISER. OPEN TRENCH ON SOFT/HARD SURFACE. INSTALL (1) 4" CONDUIT & PULL (1) HARDLINE COAX THROUGH DIRECTIONAL BORE. INSTALL (1) 4" CONDUIT & PULL (1) HARDLINE COAX THROUGH. PLACE 17x30 LOAD BEARING VAULT. SPLICE TAP IN VAULT SWEEP CONDUIT INTO EXISTING RISER & PULL (1) HARDLINE COAX THROUGH. WRECKOUT EXISTING AERIAL SPAN 275 FT. Cannon Construction LLC -253-922-2787 ext 601590363 20838 04/19/2022 Scott Warlick 5/2/2022 MFP22002040 RESTORATION PER CITY OF RENTON STANDARDS Note: The Applicant is responsible for compliance with all codes and regulations, whether or not described in this document. DEPARTMENT OF PUBLIC WORKS Page 1 of 3 | Published: 10/27/2021 Transportation Division | 1055 South Grady Way, 5th Floor | Renton, WA 98057 | 425-430-7380 Website: rentonwa.gov TRAFFIC CONTROL PLAN APPLICATION Published: 10/27/2021 TRAFFIC CONTROL PLAN (TCP) MUST BE SUBMITTED TO PUBLIC WORKS TRANSPORTATION DIVISION FOR REVIEW/APPROVAL AT LEAST FIVE (5) WORKING DAYS BEFORE THE DATE OF WORK. The City of Renton requires any contractor, firm, corporation, or other public/private agency to prepare a traffic control plan (TCP) and obtain city's approval of that plan when construction, repair, or maintenance work is to be conducted within the city's right-of-way. 1. Fill out the Traffic Control Plan (TCP) Application form and prepare required submittal documents. 2. The following items are all required for submittal of the TCP Application: ☐Electronic Copy of the TCP Application ☐Electronic Copy of the TCP Layout, on 11” X 17” paper size format, which shall: Include map(s) showing the location of the project and work area. Be legible lettering and clear, contrasting, symbols of viewing or printing. Must indicate street names, and north arrow and scale. Types of plans required: o Work hour plan – show all mobility impacts during construction hours. o Non-work plan - show all mobility impacts after work hours when limited or no work is happening in the right-of-way (ROW), if applicable. o Changing construction phases – show construction sequence and each construction phase change even if the traffic control is not modified, if applicable. o Pedestrian access/detour plan, if applicable. - Shall conform to the Washington State Traffic Control Flagger Certification handbook, by the Evergreen Safety Council. 3. Submit Application via email to TCP@rentonwa.gov with the subject line “TCP Application – [Project Name].” Project Name: Renton Housing Authority Permit #: Site Address: 1130 Glennwood Ave NE Renton, WA 98056 Work Date: From ______7/11/2022_______ To __________7/14/2022___ Work Time: Start ______________ End Contact Nam______________ e: Nate P Construction Company: Cannon Construction LLC Phone/Cell: 425.941.7820 _________________________ Business Address:406 Porter Way City/ State:Milton,WA Zip: 98354--9638 Description of Work:TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINE COAX THROUGH EXISTING See attached SOW Approval By: _________________________________________________ Date:____________________ Transportation Engineering MFP22002040 Scott Warlick CED 5/2/2022 Monday Friday 8:00AM - 3:00PM Note: The Applicant is responsible for compliance with all codes and regulations, whether or not described in this document. Page 2 of 3 | Published: 10/27/2021 PERMIT HOLDER AGREES TO ALL THE FOLLOWING: Must have approved Traffic Control Plan (TCP) prior to commencing the work. Maintain existing pedestrian access. The work on pedestrian facilities, shall be limited to one corner at a time, with the least possible inconvenience or delay to pedestrians. WORK TIME begins when any street or travel lane is fully or partially closed. This includes set up within the traveled way. Comply with all traffic regulations of the City of Renton and the State of Washington. Prepare a traffic control plan and obtain City approval of that plan. That plan shall be implemented for all street and lane closures, and the plan shall be performed in compliance with the Manual on Uniform Traffic Control Devices. Notify emergency services (253-852-2121) twenty-four (24) hours before any street or lane closures. Contractor or entity must call Renton School District (425-204-4455) or any public/private agency, including public transit, to be affected by a temporary lane or road closure a minimum of five business days (excluding weekends and holidays) prior to starting any work. Contractor or entity must notify King County Metro in writing at construction.coord@kingcounty.gov a minimum of five business days (excluding weekends and holidays) prior to starting any work impacting bus stops, a temporary lane or road closure. Work requiring removing a bus shelter or sign requires notification in writing a minimum of 30 business days (excluding weekends and holidays). Please call King County Metro at 206-477-1140 with any questions. Any lane or street closures not in conformance with the approved traffic control plan and/or without notification of emergency services may result in receiving a citation for violation of R.C.W. 47.36.200 Signs or Flaggers at thoroughfare work sites and R.C.W. 9A.36.050 Reckless Endangerment, and other applicable State and City codes. Indemnify and hold harmless the City of Renton from any and all claims, actions, and judgments, including all costs of defense and attorney’s fees incurred in defending against same, arising from and related to implementation of the approved traffic control plans including claims arising from towing of private vehicles and the acts of the Permit Holder’s agents and employees. The City of Renton shall be entitled, in its reasonable discretion, to settle claims prior to suit or judgment, and in such event shall indemnify and hold harmless the City for any such claims paid, including the City’s reasonable attorney’s fees and litigation costs incurred resulting from such claim. In the event any claim or suit is brought against City within the scope of this Agreement, Permit Holder will pay for legal counsel chosen by the City to defend against same. Flagger and sign placement are subject to revision by the City Inspector on site, if needed to address traffic or pedestrian safety or travel. All permit conditions shall be met. NOTES: Total road closure lasting more than twenty-four (24) hours is subject to the approval by the City Council. Work Zone Traffic Control shall be in accordance with the Manual on Uniform Traffic Control Devices (MUTCD) and shown by a traffic control plan layout or reference to WSDOT. Approved Temporary Traffic Control Plan must be at the work site during work hours. Complete assistance and accommodation shall be provided to all kinds of pedestrian traffic when sidewalk or walkway is impeded to safely redirect pedestrians around a work zone. Signage shall be used to warn motorcyclists/bicyclists of the potential hazards on any uneven surfaced or slippery road conditions during work and non-work hours. Any vehicle, equipment, barricade, or portable tow-away sign used within the work area must display a company logo or any legally acceptable sign showing the company name, address, and telephone number at a conspicuous place on the vehicle or equipment. Note: The Applicant is responsible for compliance with all codes and regulations, whether or not described in this document. Page 3 of 3 | Published: 10/27/2021 In the case of Temporary No Parking Zones, all the following apply in addition to previous: Contractor must complete form to show limits of Temporary No Parking Zone identifying barricade locations for vacate parking or curb lane usage. Contractor must post notice of dates and time of Temporary No Parking Zone with at least two signs per block seventy-two (72) hours in advance of effective date and time. The cover sheet of this Traffic Control Plan form must be attached to each Temporary No Parking Sign on the project site. Temporary traffic control devices must be removed immediately when work is done or no construction activities are going on. If deemed abandoned, City crews will remove and store them at the City’s maintenance shop (3555 NE 2nd Street). I certify that the information on this application and within the submittal documents are accurate to the best of my knowledge and I acknowledge all the requirements on this application. Applicant’s Signature Date Applicant’s Name (Print) James Hefley Permit Coordinator 04/19/2022 ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSIDEWALK0 11481146 1143 1100 1063 1135 1139 1130 2502 1127 1140 1131 1081 1132 1123 0 0 0 1125 1133 1141 1137 1100 1110 1132 1145 1129 1065 SIDEWA LK SI D EW A L K SIDE W A L K SIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAYLANDSCAPE LANDSCAPING LAND S C A PI N GLANDSCAPINGDRIVEWAYDRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY SIDEWALKLANDSCAPINGROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWROW ROWROW ROW ROW ROW RO W ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWS S S S S S SUNSET LN NE HARRINGTON AVE NEGLENNWOOD AVE NEEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPGLENNWOOD AVE NELANDSCAPINGASPHALT SHOULDER1062 1060EOPEOPEOPEOPEOPEOPEOPEOP EOP DRIVEWAY DRIVEWA Y DRIVEWAY WTW20-1 W20-7aFLAGGER W20-4 W20-1 W20-7a FLAGGER W20-4 SIGN SPACING = X (FEET) FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO) RURAL HIGHWAYS 60/65 MPH 800' +/- RURAL ROADS 45/55 MPH 500' +/- RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/- RURAL ROADS & URBAN ARTERIALS RESIDENTAL & BUSINESS DISTRICTS URBAN STREETS 25 MPH OR LESS 100' +/- 25/30 MPH 200' +/- ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED (1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADE INTERSECTIONS AND DRIVEWAYS. (2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS. DISCLAIMER All traffic control setups, sign spacing, and procedures will conform to the specifications stated in the federal Manual on Uniform Traffic Control Devices (M.U.T.C.D) Cities and various municipalities may have also adopted specialized guidelines for traffic control within their jurisdiction. It is the responsibility of the on-site traffic control personnel to verify if any special conditions exist. TRAFFIC CONTROL ADDITIONAL NOTES -For aerial work, there will be a moving traffic control setup -Will coordinate with businesses that will be affected by construction -Will have spotter on site to escort pedestrians through work zone -All work will stop while pedestrians are escorted through work zones -Will have no more than two work areas active at a time SITE NOTES -Maintain driveway access at all times -Place temporary "NO PARKING" signs at least 72 hours prior to work -Sidewalks to remain open during road work unless noted otherwiseFLAGGER SPOTTERWT LEGEND Work Vehicle Work Area Flagger Spotter N OF APPROVED BY: PROJECT CODE: DRAWN BY: DATE: SCALE:PROJECT REVISIONSREVDESCRIPTION OF CHANGEDATEBYQCTCP FORCED RELOCATEJB0000549729000 3 1 NS WK 4/8/2022 NTSRENTON, WA 980561130 GLENNWOOD AVE NERENTON HOUSING AUTHORITY17-050 10 105 150 205 270 450 500 550 --- 11 115 160 225 295 495 550 605 660 -- 12 125 180 245 320 540 600 660 720 780 840 LANEWIDTH 25 30 35 40 45 50 55 60 65 70 MINIMUM TAPER LENGTH IN FEET = L POSTED SPEED LIMIT (MPH) SPEED 25 30 35 45 50 55 155 200 250 360 425 495 570 LONGITUDINAL BUFFER SPACE = B LENGTH 40 305 60 65 70 780 840 THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHIN THIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVED BY THE PUBLIC AUTHORITY HAVING JURISDICTIONCONTROL TYPE:[UNDERGROUND WORK]FLAGGING 2-LANE ROADSITE SPECIFIC TRAFFIC CONTROL PLAN ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWSIDEWALK0 11481146 1143 1100 1063 1135 1139 1130 2502 1127 1140 1131 1081 1132 1123 0 0 0 1125 1133 1141 1137 1100 1110 1132 1145 1129 1065 SIDEWALK SI D E W A L K SIDE W A L K SIDEWALKSIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAYLANDSCAPE LANDSCAPING LAND S C A PI N GLANDSCAPINGDRIVEWAYDRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAY DRIVEWAYSIDEWALK LANDSCAPINGROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROW ROW ROW ROW ROWROWROW ROW ROWROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW S S S S S S S SUNSET LN NEGLENNWOOD AVE NEEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPLANDSCAPINGASPHALT SHOULDER1062 1060EOPEOPEOPEOPEOPEOPEOPEOP EOPDRIVEWAY DRIVEWAY DRIVEWAY WTW20-1 W20-7a FLAGGER W20-4 W20-1 W20-7aFLAGGER W20-4 HARRINGTON AVE NESIGN SPACING = X (FEET) FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO) RURAL HIGHWAYS 60/65 MPH 800' +/- RURAL ROADS 45/55 MPH 500' +/- RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/- RURAL ROADS & URBAN ARTERIALS RESIDENTAL & BUSINESS DISTRICTS URBAN STREETS 25 MPH OR LESS 100' +/- 25/30 MPH 200' +/- ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED (1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADE INTERSECTIONS AND DRIVEWAYS. (2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS. DISCLAIMER All traffic control setups, sign spacing, and procedures will conform to the specifications stated in the federal Manual on Uniform Traffic Control Devices (M.U.T.C.D) Cities and various municipalities may have also adopted specialized guidelines for traffic control within their jurisdiction. It is the responsibility of the on-site traffic control personnel to verify if any special conditions exist. TRAFFIC CONTROL ADDITIONAL NOTES -For aerial work, there will be a moving traffic control setup -Will coordinate with businesses that will be affected by construction -Will have spotter on site to escort pedestrians through work zone -All work will stop while pedestrians are escorted through work zones -Will have no more than two work areas active at a time SITE NOTES -Maintain driveway access at all times -Place temporary "NO PARKING" signs at least 72 hours prior to work -Sidewalks to remain open during road work unless noted otherwiseFLAGGER SPOTTERWT LEGEND Work Vehicle Work Area Flagger Spotter N OF APPROVED BY: PROJECT CODE: DRAWN BY: DATE: SCALE:PROJECT REVISIONSREVDESCRIPTION OF CHANGEDATEBYQCTCP FORCED RELOCATEJB0000549729000 3 2 NS WK 4/8/2022 NTSRENTON, WA 980561130 GLENNWOOD AVE NERENTON HOUSING AUTHORITY17-050 10 105 150 205 270 450 500 550 --- 11 115 160 225 295 495 550 605 660 -- 12 125 180 245 320 540 600 660 720 780 840 LANEWIDTH 25 30 35 40 45 50 55 60 65 70 MINIMUM TAPER LENGTH IN FEET = L POSTED SPEED LIMIT (MPH) SPEED 25 30 35 45 50 55 155 200 250 360 425 495 570 LONGITUDINAL BUFFER SPACE = B LENGTH 40 305 60 65 70 780 840 THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHIN THIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVED BY THE PUBLIC AUTHORITY HAVING JURISDICTIONCONTROL TYPE:[UNDERGROUND WORK]FLAGGING 2-LANE ROADSITE SPECIFIC TRAFFIC CONTROL PLAN ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWROWROWROWROWROWROWROWROW ROWROWROWROWSIDEWALK1100 1063 1130 2502 1127 1081 1123 1125 1100 1110 1132 1129 1065 SIDEWA LK SI D EW A L K SIDE W A L K SIDE W A L K SIDEWALK SIDEWALKSIDEWALKSIDEWALKSIDEWALKDRIVEWAYLANDSCAPE LANDSCAPING LAND S C A PI N GLANDSCAPING DRIVEWAY DRIVEWAY DRIVEWAY ROW ROW ROW ROW ROW ROW ROW ROWROWROW ROW ROW ROW ROW ROW ROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROW ROW ROW RO W RO WROWROWROWROWROWROWROWROW ROW ROW ROWROWROWROWROWROWROWROWROW ROW RO W ROWROW ROW ROW ROW ROWROWROWROW ROW ROW ROW ROWROWROWROWROWROWROWROWROWROWROWROWROWROWROWROW SUNSET LN NE SUNSET LN NEGLENNWOOD AVE NEEOP EOPEOPEOP EOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP EOP EOP EOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOPEOP EOP EOP EOP EO P EO P LANDSCAPINGASPHALT SHOULDER1062 1060EOPEOPEOPEOPEOP EOP DRIVEWAY DRIVEWA Y DRIVEWAY WTWTW20-1W20-7a FLAGGERW20-4 W20-1 W20-7aFLAGGER W20-4 W20-1 W20-7a FLAGGER W20-4 HARRINGTON AVE NESUNSET LN NESIGN SPACING = X (FEET) FREEWAYS & EXPRESSWAYS 50/70 MPH 1500' +/-(OR AS PER MUTCO) RURAL HIGHWAYS 60/65 MPH 800' +/- RURAL ROADS 45/55 MPH 500' +/- RURAL ROADS & URBAN ARTERIALS 35/40 MPH 350' +/- RURAL ROADS & URBAN ARTERIALS RESIDENTAL & BUSINESS DISTRICTS URBAN STREETS 25 MPH OR LESS 100' +/- 25/30 MPH 200' +/- ALL SIGNS ARE 48"x48" BLACK ON ORANGE UNLESS OTHERWISE DESIGNATED (1) ALL SIGN SPACING MAY BE ADJUSTED TO ACCOMMODATE INTERCHANGE RAMPS, AT GRADE INTERSECTIONS AND DRIVEWAYS. (2) THE SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROADWAY CONDITIONS. DISCLAIMER All traffic control setups, sign spacing, and procedures will conform to the specifications stated in the federal Manual on Uniform Traffic Control Devices (M.U.T.C.D) Cities and various municipalities may have also adopted specialized guidelines for traffic control within their jurisdiction. It is the responsibility of the on-site traffic control personnel to verify if any special conditions exist. TRAFFIC CONTROL ADDITIONAL NOTES -For aerial work, there will be a moving traffic control setup -Will coordinate with businesses that will be affected by construction -Will have spotter on site to escort pedestrians through work zone -All work will stop while pedestrians are escorted through work zones -Will have no more than two work areas active at a time SITE NOTES -Maintain driveway access at all times -Place temporary "NO PARKING" signs at least 72 hours prior to work -Sidewalks to remain open during road work unless noted otherwiseFLAGGER SPOTTERWT LEGEND Work Vehicle Work Area Flagger Spotter N OF APPROVED BY: PROJECT CODE: DRAWN BY: DATE: SCALE:PROJECT REVISIONSREVDESCRIPTION OF CHANGEDATEBYQCTCP FORCED RELOCATEJB0000549729000 3 3 NS WK 4/8/2022 NTSRENTON, WA 980561130 GLENNWOOD AVE NERENTON HOUSING AUTHORITY17-050 10 105 150 205 270 450 500 550 --- 11 115 160 225 295 495 550 605 660 -- 12 125 180 245 320 540 600 660 720 780 840 LANEWIDTH 25 30 35 40 45 50 55 60 65 70 MINIMUM TAPER LENGTH IN FEET = L POSTED SPEED LIMIT (MPH) SPEED 25 30 35 45 50 55 155 200 250 360 425 495 570 LONGITUDINAL BUFFER SPACE = B LENGTH 40 305 60 65 70 780 840 THE DESIGNED TRAFFIC CONTROLS CONTAINED WITHIN THIS TCP WILL NOT BE IMPLEMENTED UNTIL APPROVED BY THE PUBLIC AUTHORITY HAVING JURISDICTIONCONTROL TYPE:[UNDERGROUND WORK]FLAGGING 2-LANE ROADSITE SPECIFIC TRAFFIC CONTROL PLAN SHEET INDEX: 1 - COVER SHEET 2 -LEGEND 3 -GENERAL NOTES 4 -OVERVIEW 5-6 -DESIGN THIS IS PROPRIETARY INFORMATION AND NOT MEANT FOR GENERAL PUBLICATION. ALL RIGHTS RESERVED BY CANNON COMPANIES HARDLINE COAX: 551 FT + 20% STORAGE = 661 FT CONTACTS: PROJECT MAP: *ALL FOOTAGES AND MATERIALS ARE ESTIMATED N SCOPE OF WORK: - TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINE COAX THROUGH EXISTING RISER. - OPEN TRENCH ON SOFT SURFACE. INSTALL (1) 4" SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAX THROUGH - OPEN TRENCH ON HARD SURFACE. INSTALL (1) 4" SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAX THROUGH - DIRECTIONAL BORE. INSTALL (1) 4" SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAX THROUGH - PLACE 17x30 VAULT IN SOFT SURFACE. SPLICE TAP IN VAULT - SWEEP CONDUIT INTO VAULT & PULL (1) HARDLINE COAX THROUGH - SWEEP CONDUIT INTO EXISTING RISER & PULL (1) HARDLINE COAX THROUGH - WRECKOUT EXISTING AERIAL SPAN BILL OF MATERIALS*: AERIAL WRECKOUT = OVERLASH = NEW UNDERGROUND = EXISTING UNDERGROUND = RISER (2)= TOTAL ROW FOOTAGE = 226 FT. 0 FT. 275 FT. 0 FT. 50 FT. 551 FT. CANNON COMPANIES SAFETY | QUALITY | INTEGRITY | TEAMWORK Connecting The Future Since 1985 COMCAST 1130 GLENNWOOD AVE NE RENTON, WA 98056RENTON HOUSING AUTHORITY JB0000549729 FORCED RELOCATE CANNON COMPANIES Nate Smith - (253)-922-2787 - nsmith@teamcannon.com ROW FOOTAGES*: NEW BUILDING PATHWAY = EXISTING BUILDING PATHWAY = NEW UNDERGROUND = EXISTING UNDERGROUND = TOTAL SITE FOOTAGE = 0 FT. 0 FT. 0 FT. 0 FT. 0 FT. SITE FOOTAGES*: TOTAL PROJECT FOOTAGE =551 FT. POLE INFORMATION: POLE COUNT = POLES THAT NEED PERMIT = POLES THAT NEED MAKE READY = TRANSMISSION = 0 DISTRIBUTION = 2 2 0 0 5 6 MFP22002040 OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000549729 RENTON HOUSING AUTHORITY 1130 GLENNWOOD AVE NE RENTON, WA 98056 FORCED RELOCATE17-0504/8/2022WKNSNTS00026REV1 5/4/22 SCH. 80 PVC/ VAULTS WK NS LEGENDEDGE OF PAVEMENTFOGLINEPOWERCOMMUNICATIONSEWERDRAINDRAINAGE DITCHGASWATERTRAFFIC SIGNALTELCOMSTEAMUNKNOWN UTILITYRIGHT OF WAYTRAFFIC CONESPROPOSED NEW BORESTRAW WATTLESPLTCWRUTILITY POLEVAULT - SMALLPEDESTALSTREET LIGHTCROSSWALK LIGHTUTILITY RISERVVAULT - SMALL444LA MANHOLEVAULT - 25TACATCH BASINCATCH BASIN WITH SOCKGLULAM UTILITY POLECENTER LINELANE LINEFENCEHIGH VISIBILITY FENCE SSEWER MANHOLEDDRAIN MANHOLEWWATER MANHOLEVUTILITY VALVESHRUBBERYBORE PITVAULT - LARGEVAULT - 25TACCOMMUNICATION MANHOLEFIRE HYDRANTDISTANCE STATIONSTA 0+00CONSTRUCTION NOTE CALLOUT#X.XDISTANCE DIMENSIONASPHALT SURFACECONCRETE ROADWAY PANELHFH-FRAMEVAULT - LARGECABCABINETLEGENDLANE DIRECTION INDICATORPROPOSEDMARK-UP NOTATIONSRESTORATION TYPESEXISTING FEATURESLINE TYPESA7LANDSCAPECROSS SECTION SYMBOLCROSS SECTION NAMECROSS SECTION SHOWN ON PAGEFLFLPPTSTSCCDDDDDDDDDDDDGGWWTTSTSTROWROWSUKCBCBPPVVVVVVPROPOSED WORK1LOCATIONPHOTO NOTE CALLOUT#PHOTO LOCATOR SYMBOLPROPOSED NEW TRENCHEXISTING UNDERGROUND PATHWAYPROPOSED NEW AERIAL STRANDEXISTING AERIAL PATHWAYEXISTING SPLICE CASEPROPOSED SPLICE CASEEXISTING FIBER/COAX STORAGEPROPOSED FIBER/COAX STORAGETREEEOPVVAULT - SMALL444LA MANHOLEVAULT - 25TAVAULT - LARGEEXISTING - CONTINUED233LA MANHOLE233LA MANHOLEMFP22002040 OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000549729 RENTON HOUSING AUTHORITY 1130 GLENNWOOD AVE NE RENTON, WA 98056 FORCED RELOCATE17-0504/8/2022WKNSNTS00036REV1 5/4/22 SCH. 80 PVC/ VAULTS WK NSGENERAL NOTESMFP22002040 321CONSTRUCTION NOTES:TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINECOAX THROUGH EXISTING RISER.OPEN TRENCH ON SOFT SURFACE. INSTALL (1) 4"SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAXTHROUGHOPEN TRENCH ON HARD SURFACE. INSTALL (1) 4"SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAXTHROUGHDIRECTIONAL BORE. INSTALL (1) 4" SCHEDULE 80CONDUIT & PULL (1) HARDLINE COAX THROUGHPLACE 17x30 VAULT IN SOFT SURFACE. SPLICE TAP INVAULTSWEEP CONDUIT INTO VAULT & PULL (1) HARDLINECOAX THROUGHSWEEP CONDUIT INTO EXISTING RISER & PULL (1)HARDLINE COAX THROUGHWRECKOUT EXISTING AERIAL SPAN4567' TRENCH35' TRENCH44' BORE98' BORE80' BORE11' TRENCH3244427226' CONT.8718V5V566OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000549729 RENTON HOUSING AUTHORITY 1130 GLENNWOOD AVE NE RENTON, WA 98056 FORCED RELOCATE17-0504/8/2022WKNSNTS00046REV1 5/4/22 SCH. 80 PVC/ VAULTS WK NS DESIGNNMFP22002040 SIDEWALK 1130114011311123112511331132SIDEWALK SIDEWALK DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY DRIVEWAYROWROW ROW ROW ROW ROW ROW ROW ROW ROW ROW SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS W W WWMM MMGLENNWOOD A V E N EEOPEOPEOPG G G G GG D D EOPEOP EOP EOPPSCB WWWP P P P PVLTSTA 12+00STA 12+50STA 13+00STA 13+50BOREPITLANDSCAPING ASPHALT SHOU L D E RSTA 13+01STA 13+04STA 12+53STA 12+57VPROPOSED PATH DISCLAIMERS1.PROPOSED PATH MAY CHANGE AT TIME OFCONSTRUCTION DUE TO UTILITY LOCATIONSAND INSPECTOR REQUIREMENTS2.UNKNOWN UTILITY DEPTHS TO BE VERIFIED INFIELD DURING TIME OF CONSTRUCTIONUTILITY DISCLAIMERALL LOCATIONS OF UTILITIES SHOWN AREAPPROXIMATE. LOCATION OF ALL UTILITIES TO BEVERIFIED PRIOR TO CONSTRUCTION. CALL UTILITYUNDERGROUND LOCATION CENTER AT1-800-424-5555321POTHOLE IS SOFT SURFACESWHEN AVAILABLE. PATCHPOTHOLE LOCATION PER LOCALJURISDICTION SPECIFICATIONLOCATIONPOTHOLE DISCLAIMERCSWPP LEGENDNATIVE TRENCH MATERIAL SHALL BE COVER WITHPROTECTIVE TARP AND SECURED WITH SANDBAGSTO PREVENT RAIN WATER ABSORPTION.CATCH BASIN WITH SOCKCBCONSTRUCTION NOTES:TIE INTO EXISTING AERIAL COAX. PULL (1) HARDLINECOAX THROUGH EXISTING RISER.OPEN TRENCH ON SOFT SURFACE. INSTALL (1) 4"SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAXTHROUGHOPEN TRENCH ON HARD SURFACE. INSTALL (1) 4"SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAXTHROUGHDIRECTIONAL BORE. INSTALL (1) 4" SCHEDULE 80CONDUIT & PULL (1) HARDLINE COAX THROUGHPLACE 17x30 VAULT IN SOFT SURFACE. SPLICE TAP INVAULTSWEEP CONDUIT INTO VAULT & PULL (1) HARDLINECOAX THROUGHWRECKOUT EXISTING AERIAL SPANDRAINAGE SYSTEM DISCLAIMEREXISTING DRAINAGE SYSTEM (GRATE INLET, DITCH, ETC.)SHALL BE PROTECTED AND FUNCTIONAL THROUGHOUT THECONSTRUCTION PROJECT. IF ANY PARTS OF THE SYSTEM AREIMPACTED BY CONSTRUCTION ACTIVITIES, THEY SHALL BERESTORED TO THE ORIGINAL CONDITIONS.MATCH LINESEE SHEET 6STATION STARTSTATIONING STARTS AT 10+00 AT THE INTERSECTIONOF GLENNWOOD AVE NE & SUNSET LN NE453R2R1RRESTORATION NOTES:RESTORE LANDSCAPING PER CITY OF RENTONSPECIFICATIONSRESTORE ASPHALT ROADWAY PER CITY OF RENTONSPECIFICATIONSRESTORE CONCRETE SIDEWALK PER CITY OFRENTON SPECIFICATIONS98' BORE44' BORE35' TRENCH14544'5'5'5'2'4'3'3226'767' TRENCH2R33'3'3R2R1R1RRESTORATION LEGEND:= ASPHALT= CONCRETE= GRASS=LANDSCAPE106215'23'DRIVEWAYDRIVEWAY72'2'2'2'63R3ROFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000549729 RENTON HOUSING AUTHORITY 1130 GLENNWOOD AVE NE RENTON, WA 98056 FORCED RELOCATE17-0504/8/2022WKNS1" = 20'0102056REV1 5/4/22 SCH. 80 PVC/ VAULTS WK NS DESIGNNvault and grading isshown on privateproperty. verify ROWlocation, if on privateproperty provideproof of an existingeasement or that aneasement has beenexecuted, otherwise,vault and gradingshall be in the ROW.MFP22002040 10631065SIDEWALKSIDEWALKS I D EW A L K S I D EW A L K SIDEWALKSIDEWALKSIDEWALKSIDEWALKLANDSCAPELANDSCAPINGLANDSCAP ING LANDSCAPINGROWROWROWROWROWSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSDDDDDDFHWWWWWW WWWWM MVVVVVVSUNSET LN NEEOPEOPGGGGDDDDDEOPPPPPPEOPEOPEOPSGLENNWOOD AVE NECB CBCBDDCBCBLTLT LT LTPPPPPP P P CCCC C LTL T VVPPS T A 1 0 + 0 0 S T A 1 0 + 5 0 STA 1 1+00STA 11+50BOREPITR S T A 1 0 + 7 9 S T A 1 0 + 8 6 STA 11+59STA 11+62STA 11+74VMATCH LINESEE SHEET 5STATION STARTSTATIONING STARTS AT 10+00 AT THE INTERSECTIONOF GLENNWOOD AVE NE & SUNSET LN NEPROPOSED PATH DISCLAIMERS1.PROPOSED PATH MAY CHANGE AT TIME OFCONSTRUCTION DUE TO UTILITY LOCATIONSAND INSPECTOR REQUIREMENTS2.UNKNOWN UTILITY DEPTHS TO BE VERIFIED INFIELD DURING TIME OF CONSTRUCTIONUTILITY DISCLAIMERALL LOCATIONS OF UTILITIES SHOWN AREAPPROXIMATE. LOCATION OF ALL UTILITIES TO BEVERIFIED PRIOR TO CONSTRUCTION. CALL UTILITYUNDERGROUND LOCATION CENTER AT1-800-424-5555321POTHOLE IS SOFT SURFACESWHEN AVAILABLE. PATCHPOTHOLE LOCATION PER LOCALJURISDICTION SPECIFICATIONLOCATIONPOTHOLE DISCLAIMERCSWPP LEGENDNATIVE TRENCH MATERIAL SHALL BE COVER WITHPROTECTIVE TARP AND SECURED WITH SANDBAGSTO PREVENT RAIN WATER ABSORPTION.CATCH BASIN WITH SOCKCBCONSTRUCTION NOTES:PLACE 17x30 VAULT IN SOFT SURFACE. SPLICE COAXTAP IN VAULTSWEEP CONDUIT INTO VAULT & PULL (1) HARDLINECOAX THROUGHDIRECTIONAL BORE. INSTALL (1) 4" SCHEDULE 80CONDUIT & PULL (1) HARDLINE COAX THROUGHOPEN TRENCH ON SOFT SURFACE. INSTALL (1) 4"SCHEDULE 80 CONDUIT & PULL (1) HARDLINE COAXTHROUGHSWEEP CONDUIT INTO EXISTING RISER & PULL (1)HARDLINE COAX THROUGHWRECKOUT EXISTING AERIAL SPANDRAINAGE SYSTEM DISCLAIMEREXISTING DRAINAGE SYSTEM (GRATE INLET, DITCH, ETC.)SHALL BE PROTECTED AND FUNCTIONAL THROUGHOUT THECONSTRUCTION PROJECT. IF ANY PARTS OF THE SYSTEM AREIMPACTED BY CONSTRUCTION ACTIVITIES, THEY SHALL BERESTORED TO THE ORIGINAL CONDITIONS.411' TRENCH80' BORE3543'8'2'5'5'4'5'226' CONT.651RRESTORATION NOTES:RESTORE LANDSCAPING PER CITY OF RENTONSPECIFICATIONSRESTORE CONCRETE SIDEWALK PER CITY OFRENTON SPECIFICATIONS1RRESTORATION LEGEND:= ASPHALT= CONCRETE= GRASS=LANDSCAPE106014'21'DRIVEWAY 161R2'2'2'2'2R2R2R2OFAPPROVED BY:PROJECT CODE:DRAWN BY:DATE:SCALE:PROJECT REVISIONS REV DESCRIPTION OF CHANGEDATE BY QC JB0000549729 RENTON HOUSING AUTHORITY 1130 GLENNWOOD AVE NE RENTON, WA 98056 FORCED RELOCATE17-0504/8/2022WKNS1" = 20'010'20'66REV1 5/4/22 SCH. 80 PVC/ VAULTS WK NS DESIGNNvault and grading isshown on privateproperty. verify ROWlocation, if on privateproperty provideproof of an existingeasement or that aneasement has beenexecuted, otherwise,vault and gradingshall be in the ROW.MFP22002040