HomeMy WebLinkAboutContract IT-Fiber Splicing and TestingAGREEMENT Using State Master Contract #05620/w1165 CAG-2__-_____ th THISAGREEMENT Λͻ!ŭƩĻĻƒĻƓƷͼΜźƭƒğķĻğƭƚŅƷŷĻЊАķğǤƚŅ!ǒŭǒƭƷͲЋЉЋЋͲΛƷŷĻͻ9ŅŅĻĭƷźǝĻ5ğƷĻͼΜ byandbetweentheCityofRenton,anon-chartercodecityunderRCW35A,andamunicipal ĭƚƩƦƚƩğƷźƚƓǒƓķĻƩƷŷĻƌğǞƭƚŅƷŷĻ{ƷğƷĻƚŅ‘ğƭŷźƓŭƷƚƓΛͻ/źƷǤͼΜͲLƓƷƩğĭƚƒƒǒƓźĭğƷźƚƓ bĻƷǞƚƩƉ {ǤƭƷĻƒƭ LƓĭͲΛͻ/ƚƓƷƩğĭƷƚƩΉ Lb{LͼΜͲğ ‘ğƭŷźƓŭƷƚƓ ğĭƚƒƦğƓǤͲǞŷƚğƩĻĭƚƌƌĻĭƷźǝĻƌǤ ƩĻŅĻƩƩĻķƷƚğƭƷŷĻͻtğƩƷźĻƭͼͲƷƚƦƩƚǝźķĻŅźĬĻƩ ƭƦƌźĭźƓŭ ƭĻƩǝźĭĻƭͲ/źƷǤğƓķ/ƚƓƷƩğĭƷƚƩğŭƩĻĻğƭƭĻƷ forthbelow. WHEREAS,the City has entered into the State Master Contracts Usage Agreement (MCUA) #21725 authorizing the use of State Contracts; and, WHEREAS, through competitive bid process Washington State Department of Enterprise Services (DES) awarded Contract #05620 that provides for IT cabling materials and services for new and previously installed Local Area Networks (LANs) and Wide Area Networks (WANs) and other voice, data or video systems. WHEREAS,Contractor is a listed and participating Contractor for Contract#05620. The City and Contractor agree as set forth below: 1.Scope of Services:Contractor will provide all material and labor necessary to perform all workdescribedintheProposalwhichisattachedandfullyincorporatedintothis Agreementbyreferenceas!ƷƷğĭŷƒĻƓƷͻ!͵ͼ 2.ChangesinScopeofServices:City,withoutinvalidatingthisAgreement,mayorder changestotheScopeofServicesconsistingofadditions,deletionsormodifications,the AgreementSumbeingadjustedaccordinglybyPartiesmutualagreement.Suchchanges intheworkshallbeauthorizedbywrittenChangeOrdersignedbytheParties. 3.TimeofPerformance:ContractorshallcommenceperformanceoftheAgreementnolater P AGE 1 OF 8 ƷŷğƓЌЉĭğƌĻƓķğƩķğǤƭ ğŅƷĻƩƷŷĻ!ŭƩĻĻƒĻƓƷ͸ƭ 9ŅŅĻĭƷźǝĻ 5ğƷĻ͵ 4.TermofAgreement:TheTermofthisAgreementshallendatcompletionoftheScopeof Services,on October 1__________________, 2022.ThisAgreementmaybeextendedto accomplishchangeorders,ifrequired,uponmutualwrittenagreementofCityand Contractor. Termination: A.TheCityreservestherighttoterminatethisAgreement atanytime,withor ǞźƷŷƚǒƷĭğǒƭĻĬǤŭźǝźƓŭ ƷĻƓΛЊЉΜĭğƌĻƓķğƩķğǤƭ͸ƓƚƷźĭĻƷƚƷŷĻ/ƚƓƷƩğĭƷƚƩ źƓǞƩźƷźƓŭ͵ B.In the event this Agreement is terminated by the City, the Contractor shallbeentitled to payment for all hours worked to the effective date of termination, less all paymentspreviouslymade.IftheAgreementisterminatedbytheCityafterpartial performance of Work for which the agreed compensation is a fixed fee, the City shall paytheContractoranequitableshareofthefixedfee.Thisprovisionshallnotprevent theCityfromseekinganylegalremediesitmayhavefortheviolationor nonperformanceofanyof the provisions of this Agreement or from withholding payment for reasonably disputedcharges.NopaymentshallbemadebytheCityfor anyexpensesincurredorworkdone followingtheeffective dateofterminationunless authorizedinadvanceinwritingby theCity. 5.AgreementSum:ThetotalamountofthisAgreementisthesumof$11,500.00 which includes Washington State Sales Tax.This amount may be adjusted to a mutually agreed amountbasedonchanges to theScope ofServices. 6.Consideration:LƓĻǣĭŷğƓŭĻŅƚƩ/ƚƓƷƩğĭƷƚƩ͸ƭƦĻƩŅƚƩƒğƓĭĻƚŅƷŷĻźƷĻƒƭğƓķƩĻƭƦƚƓƭźĬźƌźƷźĻƭ identifiedin theScope ofServices,Cityagrees tomakepayment oftheamountidentifiedas theAgreementSum. 7.Prevailing Wage/ Method of Payment: Payment by the City for the Work will only be made after the Work has been performed and a voucher or invoice is submitted in a form acceptable to the City. A.Prevailing Wage Rates: Contractor must comply with the State of Washington prevailing wagerequirements. Contractor must file an Intent To Pay Prevailing Wage at the beginning of the project and an Affidavit of Wages Paid at the end of the project with the Washington State Department of Labor and Industries. The State of Washington prevailing wage rates applicable for this project, which is located in King County, may be found at the following website address of the P AGE 2 OF 8 Department of Labor and Industries: http://www.lni.wa.gov/TradesLicensing/PrevWage/default.asp http://www.lni.wa.gov/TradesLicensing/PrevWage/WageRates/default.asp Pursuant to WAC 296-127-011, the applicable effective date for prevailing wage rates paid for the duration of this contract shall be the date the contract is executed as ƩĻŅƌĻĭƷĻķ źƓ ƷŷĻ ͻ9ŅŅĻĭƷźǝĻ 5ğƷĻͼ źķĻƓƷźŅźĻķ ğƷ ƷŷĻ ƷƚƦ ƚŅ ƷŷĻ ŅźƩƭƷ ƦğŭĻ ƚŅ Ʒŷźƭ Agreement. Upon request, the City will provide a copy of the applicable prevailing wages for this project. Alternatively, the rates may be viewed at the City of Renton City Hall by making an appointment with the contact person identified herein or prior to contract award with the contact person identified as the City of Renton contact in Paragraph 15 Notices of this agreement. B.For limited Public Works Contracts under $35,000 For limited public works projects, the City chooses to waive the payment and performance bond requirements of chapter 39.08 RCW and the retainage requirements of chapter 60.28 RCW, for laborers, mechanics, subcontractors, material persons, suppliers, and taxes imposed under Title 82 RCW that may be due from the contractor for the limited public works project, however the City shall have the right of recovery against the contractor for any payments made on the contractor's behalf. C.City shall have the right to withhold payment to Contractor for any work not completed in a satisfactory manner until such time as Contractor modifies such work so that the same is satisfactory. D.Final Acceptance. Final Acceptance of the Project occurs when the Public Works Director has determined that the Project is one hundred percent (100%) complete and has been constructed in accordance with the Plans and Specifications. E.Payment in the Event of Termination. In the event this Contract is terminated by the either party, the Contractor shall not be entitled to receive any further amounts due under this Contract until the work specified in the Scope of Work is satisfactorily completed, as scheduled, up to the date of termination. At such time, if the unpaid balance of the amount to be paid under the Contract exceeds the expense incurred by the City in finishing the work, and all damages sustained by the City or which may be sustained by the City or which may be sustained by the reason of such refusal, neglect, failure or discontinuance of Contractor performing the work, such excess shall be paid ĬǤ ƷŷĻ /źƷǤ Ʒƚ ƷŷĻ /ƚƓƷƩğĭƷƚƩ͵ LŅ ƷŷĻ /źƷǤ͸ƭ ĻǣƦĻƓƭĻ ğƓķ ķğƒğŭĻƭ ĻǣĭĻĻķ ƷŷĻ ǒƓƦğźķ P AGE 3 OF 8 balance, Contractor and his surety shall be jointly and severally liable therefore to the City and shall pay such difference to the City. Such expense and damages shall include all reasonable legal expenses and costs incurred by the City to protect the rights and interests of the City under the Contract. 8.HoldHarmless:Contractorshallindemnify,defendandholdharmlessCity,itselected officials,officers,agents,employeesandvolunteers,fromandagainstanyandallclaims, lossesorliability,oranyportionofthesame,includingbutnotlimitedtoreasonable ğƷƷƚƩƓĻǤƭ͸ŅĻĻƭͲƌĻŭğƌĻǣƦĻƓƭĻƭğƓķƌźƷźŭğƷźƚƓĭƚƭƷƭͲğƩźƭźƓŭŅƩƚƒźƓƆǒƩǤƚƩķĻğƷŷƷƚƦĻƩƭƚƓƭͲ źƓĭƌǒķźƓŭźƓƆǒƩźĻƭͲƭźĭƉƓĻƭƭͲķźƭĻğƭĻƚƩķĻğƷŷƚŅ/ƚƓƷƩğĭƷƚƩ͸ƭƚǞƓĻƒƦƌƚǤĻĻƭͲğŭĻƓƷƭ ğƓķ ǝƚƌǒƓƷĻĻƩƭͲƚƩķğƒğŭĻƷƚƦƩƚƦĻƩƷǤĭğǒƭĻķĬǤ/ƚƓƷƩğĭƷƚƩ͸ƭƓĻŭƌźŭĻƓƷğĭƷƚƩƚƒźƭƭźƚƓͲ exceptforthoseactscausedby orresulting fromanegligentact oromissionbyCityand its officers,agents,employees andvolunteers. Shouldacourt of competent jurisdiction determinethat thisagreement issubject toRCW 4.24.115, (Validityofagreement toindemnifyagainstliabilityfornegligencerelativeto construction, alteration, improvement, etc., of structure or improvementattachedtoreal ĻƭƷğƷĻͶΜƷŷĻƓͲźƓƷŷĻĻǝĻƓƷƚŅƌźğĬźƌźƷǤŅƚƩķğƒğŭĻƭğƩźƭźƓŭƚǒƷƚŅĬƚķźƌǤźƓƆǒƩǤƷƚƦĻƩƭƚƓƭ ordamagestopropertycausedbyorresultingfromtheconcurrentnegligenceofthe ĭƚƓƷƩğĭƷƚƩğƓķ/źƷǤͲźƷƭƚŅŅźĭĻƩƭͲƚŅŅźĭźğƌƭͲĻƒƦƌƚǤĻĻƭğƓķǝƚƌǒƓƷĻĻƩƭͲ/ƚƓƷƩğĭƷƚƩ͸ƭ ƌźğĬźƌźƷǤƭŷğƌƌĬĻƚƓƌǤƷƚƷŷĻĻǣƷĻƓƷƚŅ/ƚƓƷƩğĭƷƚƩ͸ƭƓĻŭƌźŭĻƓĭĻ͵LƷ źƭ ŅǒƩƷŷĻƩ ƭƦĻĭźŅźĭğƌƌǤ ğƓķ expressly understood that the indemnification provided inthis Agreement constitute /ƚƓƷƩğĭƷƚƩ͸ƭ ǞğźǝĻƩ ƚŅ źƒƒǒƓźƷǤ ǒƓķĻƩ ƷŷĻ LƓķǒƭƷƩźğƌLƓƭǒƩğƓĭĻ!ĭƷͲw/‘źƷƌĻЎЊͲƭƚƌĻƌǤ forthepurposesofthisindemnification.ThePartieshave mutually negotiatedandagreed tothiswaiver.Theprovisionsofthissectionshallsurvivetheexpiration or terminationofthis Agreement. 9.Insurance:Contractorshallsecureandmaintain: A.Commercialgeneralliabilityinsuranceintheminimumamountsof$1,000,000for eachoccurrence/$2,000,000aggregatefortheTermofthisAgreement. B.Professionalliabilityinsurance,intheminimumamountof$1,000,000foreach occurrence, shall also be secured for any professional services being provided toCity thatareexcludedinthecommercialgeneral liability insurance. /͵‘ƚƩƉĻƩƭ͸ ĭƚƒƦĻƓƭğƷźƚƓ ĭƚǝĻƩğŭĻͲ ğƭ ƩĻƨǒźƩĻķ ĬǤ ƷŷĻ LƓķǒƭƷƩźğƌ LƓƭǒƩğƓĭĻ ƌğǞƭ ƚŅ ƷŷĻ StateofWashington, shallalsobesecured. D.Commercial Automobile Liability for owned, leased, hired or non-owned, leased, P AGE 4 OF 8 hired or non-owned, with minimum limits of $1,000,000 per occurrence combined ƭźƓŭƌĻ ƌźƒźƷͲ źŅ ƷŷĻƩĻ Ǟźƌƌ ĬĻ ğƓǤ ǒƭĻ ƚŅ /ƚƓƭǒƌƷğƓƷ͸ƭ ǝĻŷźĭƌĻƭ ƚƓ ƷŷĻ /źƷǤ͸ƭ tƩĻƒźƭĻƭ ĬǤ or on behalf of the City, beyond normal commutes. E.Consultant shall name the City as an Additional Insured on its commercial general ƌźğĬźƌźƷǤ ƦƚƌźĭǤ ƚƓ ğ ƓƚƓΏĭƚƓƷƩźĬǒƷƚƩǤ ƦƩźƒğƩǤ Ĭğƭźƭ͵ ŷĻ /źƷǤ͸ƭ źƓƭǒƩğƓĭĻ ƦƚƌźĭźĻƭ ƭŷğƌƌ not be a source for payment of any Consultant liability, nor shall the maintenance of any insurance required by this Agreement be construed to limit the liability of /ƚƓƭǒƌƷğƓƷ Ʒƚ ƷŷĻ ĭƚǝĻƩğŭĻ ƦƩƚǝźķĻķ ĬǤ ƭǒĭŷ źƓƭǒƩğƓĭĻ ƚƩ ƚƷŷĻƩǞźƭĻ ƌźƒźƷ ƷŷĻ /źƷǤ͸ƭ recourse to any remedy available at law or in equity. C͵{ǒĬƆĻĭƷ Ʒƚ /źƷǤ͸ƭ ƩĻǝźĻǞ ğƓķ ğĭĭĻƦƷğƓĭĻͲ ğ ĭĻƩƷźŅźĭğƷĻ ƚŅ źƓƭǒƩğƓĭĻ ƭŷƚǞźƓŭ ƷŷĻ proper endorsements, shall be delivered to Citybefore executing the work of this Agreement. G.Contractor shall provide Citywith written notice of any policy cancellation, within two (2) businessdays oftheirreceiptofsuchnotice. 10.Discrimination Prohibited:Exceptto the extentpermitted bya bona fideoccupational qualification,theContractoragrees asfollows: !͵/ƚƓƷƩğĭƷƚƩͲğƓķ/ƚƓƷƩğĭƷƚƩ͸ƭğŭĻƓƷƭͲĻƒƦƌƚǤĻĻƭͲƩĻƦƩĻƭĻƓƷğƷźǝĻƭͲğƓķǝƚƌǒƓƷĻĻƩƭ withregard to the services performed or to be performed under this Agreement, shall notdiscriminateonthebasisofrace,color,sex,religion,nationality,creed, maritalstatus,sexualorientationorpreference,age(exceptminimumageand retirementprovisions), honorably discharged veteran or military status, or the presence of anysensory, mental or physical handicap, unless based upon a bona fide occupationalqualification in relationship to hiring and employment, in employment or applicationfor employment, the administration of the delivery of services or any other benefitsunderthisAgreement,or procurementofmaterials or supplies. B.TheContractorwilltakeaffirmativeactiontoinsurethatapplicantsareemployed andthat employees are treated during employment without regard to their race, creed,color,nationalorigin,sex,age,sexualorientation,physical,sensoryormental handicaps, or marital status.Such action shall include, but not be limited to the followingemployment,upgrading,demotionortransfer,recruitmentor recruitment advertising, layoff or termination, rates of pay or other forms of compensation andselectionfortraining. /͵LŅ/ƚƓƷƩğĭƷƚƩŅğźƌƭƷƚĭƚƒƦƌǤǞźƷŷğƓǤƚŅƷŷźƭ!ŭƩĻĻƒĻƓƷ͸ƭƓƚƓΏķźƭĭƩźƒźƓğƷźƚƓ provisions,Cityshallhavetheright,atitsoption,tocanceltheAgreementinwholeor inpart. P AGE 5 OF 8 D.Contractor is responsible to be aware of and in compliance with all federal, state and local laws and regulations that may affect the satisfactory completion of the project, whichincludesbutisnotlimitedtofairlabor lawsandworker'scompensation. 11.Independent Contractorʹ /ƚƓƷƩğĭƷƚƩ͸ƭ ĻƒƦƌƚǤĻĻƭͲ ǞŷźƌĻ ĻƓŭğŭĻķ źƓ ƷŷĻ ƦĻƩŅƚƩƒğƓĭĻ ƚŅğƓǤ ƚŅ /ƚƓƷƩğĭƷƚƩ͸ƭ ƭĻƩǝźĭĻƭ ǒƓķĻƩ Ʒŷźƭ !ŭƩĻĻƒĻƓƷͲ ƭŷğƌƌ ĬĻ ĭƚƓƭźķĻƩĻķ ĻƒƦƌƚǤĻĻƭ ƚŅ ƷŷĻ Contractorandnotemployees,agents,representativesofCityandasaresult,shallnotbe ĻƓƷźƷƌĻķ Ʒƚ ğƓǤ ĭƚǝĻƩğŭĻ ƚƩ ĬĻƓĻŅźƷƭ ŅƩƚƒ ƷŷĻ /źƷǤ ƚŅ /źƷǤ͵ /ƚƓƷƩğĭƷƚƩ͸ƭ ƩĻƌğƷźƚƓ Ʒƚ/źƷǤƭŷğƌƌ ĬĻğƷğƌƌƷźƒĻƭğƭğƓźƓķĻƦĻƓķĻƓƷĭƚƓƷƩğĭƷƚƩ͵!ƓǤğƓķğƌƌ‘ƚƩƉƒğƓ͸ƭ/ƚƒƦĻƓƭğƷźƚƓ!ĭƷ claimsonbehalfofContractoremployees,andanyandallclaimsmadebyathird-partyasa ĭƚƓƭĻƨǒĻƓĭĻƚŅğƓǤƓĻŭƌźŭĻƓƷğĭƷƚƩƚƒźƭƭźƚƓƚƓƷŷĻƦğƩƷƚŅ/ƚƓƷƩğĭƷƚƩ͸ƭ ĻƒƦƌƚǤĻĻƭͲ ǞŷźƌĻ engaged in services provided to be rendered under thisAgreement, shallbethesolely /ƚƓƷƩğĭƷƚƩ͸ƭƚĬƌźŭğƷźƚƓğƓķƩĻƭƦƚƓƭźĬźƌźƷǤ͵ 12.City of Renton Business License: Unless exempted by the Renton Municipal Code, Contractor shall obtain a City of Renton Business License prior to performing any Work and maintain the business license in good standing throughout the term of this agreement with the City. Information regarding acquiring a city business license can be found at: https://www.rentonwa.gov/Tax Information regarding State business licensing requirements can be found at: https://dor.wa.gov/doing-business/register-my-business 13.Record Keeping and Reporting:Contractor shall maintain accounts and records, which properlyreflectalldirectandindirectcostsexpendedandServicesprovidedinthe performance of this Agreement. The Contractor agrees to provide access to,and copies of any records related to this Agreement as required by the City to audit expenditures and charges and/or to comply with the Washington State Public Records Act (Chapter 42.56 RCW). 14.Public Records Compliance.To the full extent the City determines necessary to complywith theWashingtonStatePublicRecordsAct,Contractorshallmakeaduediligentsearchof all recordsin its possession, including, but not limited to, e-mail, correspondence,notes, saved telephone messages, recordings, photos, or drawings and provide them totheCityfor production.IntheeventContractorbelievessaidrecordsneedtobeprotectedfrom ķźƭĭƌƚƭǒƩĻͲ źƷ ƭŷğƌƌͲ ğƷ /ƚƓƷƩğĭƷƚƩ͸ƭ ƚǞƓ ĻǣƦĻƓƭĻͲƭĻĻƉ Ɔǒķźĭźğƌ ƦƩƚƷĻĭƷźƚƓ͵ /ƚƓƷƩğĭƷƚƩƭŷğƌƌ źƓķĻƒƓźŅǤͲķĻŅĻƓķͲğƓķŷƚƌķŷğƩƒƌĻƭƭƷŷĻ/źƷǤŅƚƩğƌƌĭƚƭƷƭͲźƓĭƌǒķźƓŭğƷƷƚƩƓĻǤƭ͸ŅĻĻƭͲ attendant to any claim or litigation related to a Public Records Act request for which Contractor has responsive records andfor which Contractor has withheld records or P AGE 6 OF 8 information contained therein, or not provided them to the City in a timely manner. Contractor shall produce for distribution any and all records responsive to the Public RecordsActrequestinatimelymanner,unlessthoserecordsareprotectedbycourtorder. 15.OtherProvisions: A.Administration and Notices.Each individual executing this Agreement on behalf of CityandContractorrepresentsandwarrantsthatsuchindividualsareduly authorized to execute and deliver this Agreement on behalf of Cityor Contractor. Any notices required to be given by the Parties shall be delivered at the addresses setforth below.Any notices may be delivered personally to the addressee of the noticeormay be deposited in the United States mail, postage prepaid, to the address setforth below.Any notice so posted in the United States mail shall be deemed receivedthree(3)calendardaysafterthedateofmailing.ThisAgreementshallbe administeredbyand anynoticesshould be senttotheundersignedindividualsor theirdesignees. CITY OF RENTONCONTRACTOR Ian HardgraveIntracommunication Network Systems, 1055 South Grady WayInc. (INSI) Renton, WA 980574922 N. Pearl ST Phone: (425) 430-6876Tacoma, WA. 98407 ihardgrave@rentonwa.govPhone: (253) 760-0418 AriS@INSIcabling.com Fax: (253) 879-0186 B.AmendmentandModification.ThisAgreementmaybeamendedonlybyan instrumentinwriting,dulyexecutedby bothParties. C.Assignment and Subcontract.Contractor shall not assign or subcontract any portion ƚŅƷŷźƭ!ŭƩĻĻƒĻƓƷǞźƷŷƚǒƷƷŷĻ /źƷǤƚŅwĻƓƷƚƓ͸ƭƦƩźƚƩ ĻǣƦƩĻƭƭ ǞƩźƷƷĻƓĭƚƓƭĻƓƷ͵ D.CompliancewithLaws͵/ƚƓƷƩğĭƷƚƩğƓķğƌƌƚŅƷŷĻ/ƚƓƷƩğĭƷƚƩ͸ƭĻƒƦƌƚǤĻĻƭƭŷğƌƌƦĻƩŅƚƩƒ theservicesinaccordancewithallapplicablefederal,state,countyandcitylaws, codesand ordinances. A copy of this language must be made a part of any contractor orsubcontractor agreement. E.Conflicts.In the event of any inconsistencies between contractor proposals and this contract,thetermsofthis contractshallprevail. F.Governing Law.This Agreement shall be made in and shall be governed by and P AGE 7 OF 8 interpretedinaccordancewiththelaws oftheStateofWashington. G.Joint Drafting Effort. This Agreement shall be considered for all purposes as preparedby the joint efforts of the Parties and shall not be construed against one party or theotherasaresultofthepreparation,substitution,submissionorother eventofnegotiation,draftingorexecution. H.JurisdictionandVenue.Anylawsuitorlegalactionbroughtbyanypartytoenforce orinterpret this Agreement or any of its terms or covenants shall be brought in the KingCounty Superior Court for the State of Washington at the Maleng Regional JusticeCenterinKent,King County, Washington,orits replacementorsuccessor. I.Severability͵! ĭƚǒƩƷ ƚŅ ĭƚƒƦĻƷĻƓƷ ƆǒƩźƭķźĭƷźƚƓ͸ƭ determination that any provision or part of this Agreement is illegal or unenforceable shall not cancel or invalidate the remainderofthisAgreement,whichshall remaininfullforceandeffect. J.Sole and Entire Agreement.This Agreement contains the entire agreement of the Partiesandanyrepresentationsorunderstandings,whetheroralorwritten,not incorporated areexcluded. K.Third-Party Beneficiaries.Nothing in this Agreement is intended to, nor shall be construed to give any rights or benefits in the Agreement to anyone other than the Parties, and all duties and responsibilities undertaken pursuant to this Agreement willbeforthe soleand exclusivebenefitofthePartiesandnooneelse. L.Waivers͵ !ƌƌ ǞğźǝĻƩƭ ƭŷğƌƌ ĬĻ źƓ ǞƩźƷźƓŭ ğƓķ ƭźŭƓĻķ ĬǤ ƷŷĻ ǞğźǝźƓŭ ƦğƩƷǤ͵ 9źƷŷĻƩ ƦğƩƷǤ͸ƭ failure to enforce any provision of this Agreement shall not be a waiver and shall not preventeitherCityorContractorfromenforcingthatprovisionoranyotherprovision of this Agreement in the future.Waiver of breach of any provision of thisAgreement shall not be deemed to be a waiver of any prior or subsequent breachunlessitis expressly waivedinwriting. IN WITNESS WHEREOF, the Parties have voluntarily entered into this Agreement as of Effective Date above. CITY OF RENTONCONTRACTOR ____________________________ _____________________________ Kristi Rowland Deputy Chief Administrative Officer P AGE 8 OF 8 _____________________________ _____________________________Date Date Approved as to Legal Form _______________________________ Shane Moloney Renton City Attorney Clb & RM 8-19-22 (2173) Non-Standard P AGE 9 OF 8 Phone 253.761.0418  4922 North Pearl Tacoma, WA 98407 Fax: 253.879.0186 *C O N S U L T I N G *D E S I G N *I N S T A L L A T I O N  Statement of Work INSI/DES Contract Number 05620/w1165 $XJXVW &LW\RI5HQWRQ 6*UDG\:D\ 5HQWRQ:$  7KDQN\RXIRUDOORZLQJIntracommunication Network Systems Inc. (INSI)WKHRSSRUWXQLW\WRSURYLGHWKH IROORZLQJTXRWDWLRQWRSURYLGH7HOHFRPPXQLFDWLRQVHUYLFHVIRUWKH&LW\RI5HQWRQ  6FRSHRI:RUN±)LEHU6SOLFLQJ5HQWRQ&LW\+DOO 5HQWRQ6FKRRO'LVWULFW  7KH&LW\RI5HQWRQ &R5 LVORRNLQJWRWHVWILEHUVRQDVPILEHUFDEOHWKDWLVVKDUHGZLWKWKH5HQWRQ6FKRRO'LVWULFW 56' 7KLV ILEHUFDEOHJRHVIURP1VW6W :HOOV$YH1WR6*UDG\:D\ :HOOV$YH67KHUHZDVDVXVSHFWHGEUHDNDW6QG6W :HOOV$YH6 IURPVRPHFRQVWUXFWLRQZRUN :HDUHORRNLQJWRJHWWKHWRWDOGLVWDQFHVIRUILEHUV EXIIHUWXEHV ZLWKQRWHVRIZKHUHORVVLVIRXQGRQWKHOLQHWRGHWHUPLQHLI ZHQHHGWRUHSODFHWKHVPFDEOHRUPDNHGRZLWKWKHFXUUHQWGDPDJHRIWKHILEHUVDUHDOUHDG\VSOLFHGDQGZLOOQHHGWREHFXW WHVWHGDQGUHVSOLFHG7KHRWKHUILEHUVDUHFXWGDUNLQWKHVSOLFHFDVHV 7KHUHDUHVSOLFHFDVHVLQYROYHG  x7KHZRUNZLOOFRQVLVWRI                  o Optical Time-Domain Reflectometer Optical Loss Test Set o Assumptions of Scope: Exempt from Scope: Terms and Conditions: