Loading...
HomeMy WebLinkAboutFinal Agenda Packet AGENDA City Council Regular Meeting 7:00 PM - Monday, August 20, 2018 Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way 1. CALL TO ORDER AND PLEDGE OF ALLEGIANCE 2. ROLL CALL 3. PROCLAMATION a) Ready in Renton - September 2018 4. PUBLIC HEARING a) 2019 - 2024 Transportation Improvement Program 5. APPEAL a) Planning & Development Committee Report: Wilson Park 1 INABILITY OF THE CITY COUNCIL TO TAKE TESTIMONY ON APPEALS DURING COUNCIL MEETINGS State law requires that the City establish a process to handle appeals from application of environmental and developmental rules and regulations. The Renton City Council, feeling it was best for the elected representatives to handle the appeals rather than require citizens to go to court, has retained appellate jurisdiction to itself. The courts have held that the City Council, while sitting as an appellate body, is acting as a quasi-judicial body and must obey the rules of procedure of a court more than that of a political body. By City Code, and by State law, the City Council may not consider new evidence in this appeal. The parties to the appeal have had an opportunity to address their arguments to the Planning & Development Committee of the City Council at a meeting previously held. Because of the court requirements prohibiting the City Council from considering new evidence, and because all parties have had an opportunity to address their concerns to the Planning & Development Committee, the City Council may not consider oral or written testimony at the City Council meeting. The Council understands that this is frustrating to citizens and is outside the normal process of open discourse provided to citizenry during the audience comment portion of the City Council meeting. However, this burden of not allowing Council to be addressed concerning pending appeals is outweighed by the quick, inexpensive and local appeal process provided by the Renton City Council. 6. ADMINISTRATIVE REPORT 7. AUDIENCE COMMENTS • Speakers must sign-up prior to the Council meeting. • Each speaker is allowed five minutes. • When recognized, please state your name & city of residence for the record. NOTICE to all participants: Pursuant to state law, RCW 42.17A.555, campaigning for any ballot measure or candidate in City Hall and/or during any portion of the council meeting, including the audience comment portion of the meeting, is PROHIBITED. 8. CONSENT AGENDA The following items are distributed to Councilmembers in advance for study and review, and the recommended actions will be accepted in a single motion. Any item may be removed for further discussion if requested by a Councilmember. a) Approval of Council Meeting minutes of August 13, 2018. Council Concur b) AB - 2198 City Clerk submits a 60% Direct Petition to Annex for the proposed Parker Annexation, and recommends a public hearing to consider the petition be set for September 10, 2018; 14.5 acres located at the southeastern portion of City limits, bordered by City limits at the west, the urban growth boundary at the west and south, and by SE 124th St. at the south. Council Concur; Set Public Hearing on 09/10/2018. c) AB - 2200 Executive Department recommends approval of a three-year contract with Diamond Marketing Solutions, Inc., with an annual cost of $98,551.20, for postal metering and delivery services. Refer to Finance Committee d) AB - 2203 Executive Department recommends approval of an agreement with the Renton Regional Fire Authority outlining the responsibilities and requirements with regards to the development of Fire Station #15. Council Concur e) AB - 2201 Public Works Administration recommends ratifying the Second Addendum to the Indemnification Agreement, CAG-18-150, with The Boeing Company. Council Concur f) AB - 2196 Utility Systems Division recommends approval of an agreement with Northwest Hydraulic Consultants, Inc., in the amount of $132,377, for the Annual Cedar River Sediment Survey and Analysis project. Refer to Utilities Committee g) AB - 2197 Utility Systems Division recommends approval of the Water Quality Grant Agreement WQC-2017-Renton-00002, with the Department of Ecology, to accept $93,000 in grant funds for the Heather Down Detention Pond Water Quality Retrofit project. A $31,000 city match is required. Refer to Utilities Committee 9. UNFINISHED BUSINESS Topics listed below were discussed in Council committees during the past week. Those topics marked with an asterisk (*) may include legislation. Committee reports on any topics may be held by the Chair if further review is necessary. a) Transportation Committee: Temporary Total Closure of Intersection E. Valley Rd*; Temporary Total Closure of SW 19th St*; 2019 - 2024 Transportation Improvement Program* 10. LEGISLATION Resolutions: a) Resolution No. 4351: 2019 - 2024 Transportation Improvement Program (See item 9.a.) b) Resolution No. 4352: Temporary Total Closure of the Intersection of East Valley Road and SW 19th Street (See item 9.a) c) Resolution No. 4353: Temporary Total Closure of SW 19th Street (See item 9.a) Ordinance for second and final reading: a) Ordinance No. 5886: Alarm System Regulation (First Reading 8/13/2018) 11. NEW BUSINESS (Includes Council Committee agenda topics; visit rentonwa.gov/cityclerk for more information.) 12. ADJOURNMENT COMMITTEE OF THE WHOLE MEETING AGENDA (Preceding Council Meeting) 6:00 p.m. - 7th Floor - Council Chambers Hearing assistance devices for use in the Council Chambers are available upon request to the City Clerk CITY COUNCIL MEETINGS ARE TELEVISED LIVE ON GOVERNMENT ACCESS CHANNEL 21 To view Council Meetings online, please visit rentonwa.gov/councilmeetings DenisLawMayorProctamationWftereas,SeptemberhasbeendesignatedbythePresidentoftheUnitedStatesofAmericaas“NationalPreparednessMonth”andcoincideswiththeCityofRenton’s“ReadyinRenton”emergencypreparednesscampaign;and(4%iereas,Rentonhasexperiencednaturalandhuman-causeddisastersinthepast,andscientificevidenceindicatesthecityandtheregionremainvulnerabletodisastersinthefuture;andWfiereas,investinginthepreparednessofourselves,ourfamilies,ourbusinesses,andourneighborhoodscanreduceinjuries,fatalities,andeconomicdevastationfromdisasters;andW’tzereas,thebasicstepsofemergencypreparednessarethesameforeveryone:makeaplan,buildakit,andhelponeanothertobecomeself-sufficientforuptotwoweeks;andWfiereas,becausestayinginformedisavitalpartofrespondingappropriatelytoemergencies,allmembersoftheRentoncommunityareencouragedtolocateandbookmarktheirsourcesofemergencyinformationinadvanceatrentonwa.gov,tosignupforALERTRenton,andtofollowthecity’ssocialmediaaccountsonFacebook,Twitter,andNextDoor;andWñereas,thereisgreatlanguagediversitywithinthecommunity,andRentonresidentsandbusinessesareencouragedtosharewiththeirneighborsthetranslatedinformationatbit.ly/PreparednessPublications,andtorelayanyemergencymessagestohelptheirneighborsunderstandandtakeappropriatelife-savingactions;andWfiereas,“ReadyinRenton”createsanimportantopportunityforeverymemberoftheRentoncommunitytopreparetheirhomes,businesses,andneighborhoodsforanytypeofemergency;Wow,tfierefore,I,DenisLaw,MayoroftheCityofRenton,doherebyproclaimthemonthofSeptember2018tobe?cad5in?entonWtonthintheCityofRentonandencourageallRentonresidentstoformulateapreparednessplan.Inwitnesswhereof,IhavehereuntosetmyhandandcausedthesealoftheCityofRentontobeaffixedthis20thdayofAugust,2018.DenisLaw,MayorCityofRenton,WashingtonRentonCityHaIl,7thFloor1055SouthGradyWay,Renton,WA98057.rentonwa.govAGENDA ITEM #3. a) 2019-2024 Transportation Improvement Plan AGENDA ITEM #4. a) Purpose A multi-year planning tool for the development of transportation facilities that: Supports the City’s Mission and Vision Helps achieve the goals of the Renton Business Plan Reflects the involvement of City residents and Elected Officials AGENDA ITEM #4. a) Essential Planning Tool The Transportation Improvement Plan (TIP) is vital to the City because it: Is mandated by Washington State code Establishes project eligibility for state and federal grant programs Helps foster collaboration and coordination with other jurisdictions/agencies AGENDA ITEM #4. a) What’s New? Format Interactive Map Updated Projects Information New Projects Added AGENDA ITEM #4. a) Project Categories Maintenance & Preservation (11 Projects) Corridor Projects (22 Projects) Traffic Operations & Safety (11 Projects) Non-Motorized (6 Projects) Other Programs (4 Projects) Breakdown of Proposed Expenditures by Category Type within TIP 10% 74% 3%12% 1%AGENDA ITEM #4. a) Funding Summary King County / Developer Local Revitalization Funds Fund Balance Mitigation (Impact Fees) Grants Business and Occupation Vehicle Fuel Tax AGENDA ITEM #4. a) New Grants TIP No.Project Grant Amount 2.2 SW 43rd St Pavement Preservation $1,000,000 15 Bronson Way N. Bridge Seismic Retrofit & Painting $3,000,000 16 Duvall Ave NE (additional sidewalk)$1,223,939 17 Houser Way N. Seismic Retrofit & Painting $2,999,000 21 Rainier Ave -Phase 4 (Right-of-Way)$3,000,000 21 Rainier Ave -Phase 4 (Construction)$4,500,000 24 S. 2nd Street Conversion (Design)$1,200,000 25 Williams Ave. N Seismic Retrofit & Painting $2,985,000 TOTAL $19,907,939 AGENDA ITEM #4. a) New Projects Added TIP No.Project 2.2 SW 43rd St Pavement Preservation 15 Bronson Way N. Bridge Seismic Retrofit & Painting 17 Houser Way N. Seismic Retrofit & Painting 22 Renton Connector 25 Williams Ave. N Seismic Retrofit & Painting 28 Houser Way Non-Motorized Improvements 37 Nile Ave NE Bridge Repair 39 Renton Bus Rapid Transit (BRT)Improvements 40 Transit Master Plan AGENDA ITEM #4. a) Recent Constructed Projects SUNSET LANE NE / NE 10TH AVE IMPROVEMENTS AGENDA ITEM #4. a) Recent Constructed Projects CONNECTING DOWNTOWN –PHASE 1 AGENDA ITEM #4. a) Recent Constructed Projects 116TH AVE SE PEDESTRIAN IMPROVEMENTS Before After AGENDA ITEM #4. a) Anticipated Construction DUVALL AVE NE ROADWAY PRESERVATION RENTON AVE NE ROADWAY PRESERVATION WILLIAMS AVE S/WELLS AVE S TWO-WAY CONVERSION LAKE WASHINGTON LOOP TRAIL –PHASE 3 AGENDA ITEM #4. a) Interactive Map Active Link on Website: http://www.rentonwa.gov/TIPMap Allows general public to see additional graphics on projects, when available Project information can be updated in real time AGENDA ITEM #4. a) Recommended Action Approve the annual updates to the 2019-2024 Transportation Improvement Program Present the Resolution for reading and adoption AGENDA ITEM #4. a) Questions?AGENDA ITEM #4. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES  MINUTES  City Council Regular Meeting  7:00 PM ‐ Monday, August 13, 2018  Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way    CALL TO ORDER AND PLEDGE OF ALLEGIANCE     Mayor Law called the meeting of the Renton City Council to order at 7:00 PM and led the  Pledge of Allegiance.    ROLL CALL    Councilmembers Present:  Ed Prince, Council President  Randy Corman  Ryan McIrvin  Ruth Pérez  Armondo Pavone  Don Persson  Carol Ann Witschi  Councilmembers Absent:                           ADMINISTRATIVE STAFF PRESENT    Denis Law, Mayor  Robert Harrison, Chief Administrative Officer  Leslie Clark, Senior Assistant City Attorney   Jason Seth, City Clerk  Chip Vincent, Community & Economic Development Administrator  Gregg Zimmerman, Public Works Administrator  Jennifer Henning, Planning Director  Mark Santos‐Johnson, Community Development Project Manager  Commander Kevin Keyes, Police Department      PROCLAMATION   a) Jerene Battisti Day: A proclamation by Mayor Law was read declaring August 13, 2018 to be  Jerene Battisti Day, and encouraging all citizens to join in this special observance. Ms. Battisti  expressed appreciation for the proclamation.    MOVED BY PRINCE, SECONDED BY WITSCHI, COUNCIL CONCUR IN THE  PROCLAMATION. CARRIED.  AGENDA ITEM #8. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES  PUBLIC HEARING   a) Interim Control for Fee Waivers & Property Tax Exemptions in Residential Targeted Areas:  This being the date set and proper notices having been posted and published in accordance  with local and State laws, Mayor Law opened the public hearing to consider an interim control  prohibiting the acceptance of applications for fee waivers or property tax exemptions for  multi‐family housing in residential targeted areas.     Community Project Development Manager Mark Santos‐Johnson reported that Council  adopted an interim control prohibiting the acceptance of applications for fee waivers or  property tax exemptions for multi‐family housing in residential targeted areas on June 25,  2018, and noted that State law required a public hearing be set within 60 days of adopting the  interim control to consider the issue. Mr. Santos‐Johnson explained that Council has docketed  a legislative review of Renton Municipal Code (RMC) 4‐1‐210 Waived Fees regarding the  eligibility and standards for fee waivers, and RMC 4‐1‐220 regarding property tax exemptions  for multi‐family housing in residential targeted areas. He further explained that the region is  currently experiencing a housing shortage, particularly for affordable housing.      Continuing, Mr. Santos‐Johnson reported that the purpose of multi‐family housing incentives  has been to encourage owner‐occupied and/or rental housing in eligible zones in the  Downtown or Sunset Areas, which are two high‐priority redevelopment centers for the City.  He noted that actual and/or proposed residential development has significantly increased in  these areas since the incentives were adopted. Mr. Santos‐Johnson reported that the purpose  of implementing the interim control was so that Council, the Planning Commission, and staff  could have the opportunity to advance potential amendments to the multi‐family housing  incentives program without the potential of applications being received that may not be in  the City's interest. Concluding, he reported the following next steps:   Develop and present proposals to the Planning Commission and Council Planning &  Development Committee;   Continue to accept and provide opportunities for additional public comment; and    Continue to provide public notice of the ongoing process either through the City's  website or by encouraging interested parties to become parties of record.     Public Comment was invited.      The following people spoke in opposition of the proposed interim control:   Howard McOmber, Renton, stated the incentives are vital to the effort of developing  and redeveloping properties in the residential targeted areas.   Anita Woo, Bellevue, remarked that the interim control jeopardizes the financial  feasibility of her current redevelopment project located near Jefferson Ave NE and NE  16th St.   Craig Keppler, Seattle, speaking on behalf of the Renton Village project, spoke in favor  of limiting fee waivers to projects located within the residential targeted areas.    Jim Houton, Bellevue, expressed support for the fee waivers because it mitigates  some investment risk.   Timothy Woo, Bellevue, expressed support for the fee waivers because they lower  risks for property investors.  AGENDA ITEM #8. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES  There being no further public comment, it was    MOVED BY MCIRVIN, SECONDED BY WITSCHI, COUNCIL CLOSE THE PUBLIC  HEARING. CARRIED.    APPEAL   a) Planning & Development Committee ‐ Wilson Park I Preliminary Plat     MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL POSTPONES ITS FINAL  ACTION ON THE WILSON PARK I HEARING EXAMINER DECISION UNTIL ITS NEXT  COUNCIL MEETING, AUGUST 20, 2018. THE WILSONS HAVE UNTIL FRIDAY,  AUGUST 17, 2018 TO COMMIT IN WRITING TO CITY STAFF THAT WILSON PARK I  WILL BE BUILT TO ALL CITY LAWS, REGULATIONS, STANDARDS, AND  SPECIFICATIONS IN EFFECT AS OF AUGUST 17, 2018. IN OTHER WORDS, WILSON  PARK I WILL LOSE ITS VESTED STATUS. HOWEVER, CITY STAFF WOULD ALLOW THE  APPLICATION TO PROCEED WITHOUT NEED TO RE‐APPLY FOR PRELIMINARY PLAT  APPROVAL AND WITHOUT NEED TO PAY PRELIMINARY PLAT APPLICATION FEES.  IN EXCHANGE, THE CITY COUNCIL TAKES THE PRELIMINARY ACTION TONIGHT TO  MODIFY THE HEARING EXAMINER DECISION TO EXTEND THE PLAT EXPIRATION  DATE FOR WILSON PARK I FROM AUGUST 16, 2018 TO AUGUST 23, 2018. IF THE  WILSONS COMMIT TO THE ABOVE TERM (FOR WILSON PARK I TO MEET CURRENT  LAWS, REGULATIONS, STANDARDS, AND SPECIFICATIONS), THEN CITY STAFF WILL  RECOMMEND TO THE CITY COUNCIL TO EXTEND THE WILSON PARK I EXPIRATION  TO JULY 5, 2019. THE CITY COUNCIL HOLDS OPEN THE APPEAL HEARING FOR  WILSON PARK I TO RETAIN JURISDICTION AND TO MAKE A FINAL DECISION AS TO  THE HEARING EXAMINER DECISION. CARRIED.    ADMINISTRATIVE REPORT    Chief Administrative Officer Robert Harrison reviewed a written administrative report  summarizing the City’s recent progress towards goals and work programs adopted as part of  its business plan for 2018 and beyond. Items noted were:   The second annual Cruz the Loop event will take place Saturday, August 18th from  5:00 to 9:00 p.m.  It will be an evening of live music, food, classic cars, and the vintage  cruise around the Renton loop.  Pre‐registration is required as spots are limited.  For  more information, visit http://rentonwa.gov/cruz.      Learn how to respond to disasters.  Renton CERT classes are taught by local subject  matter experts including firefighters, police officers, chaplains, emergency managers,  and medical professionals.  Learn to extinguish fires, conduct search and rescue,  provide basic first aid, identify and respond to terrorism, assist professional  responders, reduce survivor stress, and prepare yourself and your community for  emergencies.  Summer classes will take place August 23rd through 25th from 8:00  a.m. to 5:00 p.m.  Register online with code 61514 or call 425‐430‐6700.   Preventative street maintenance will continue to impact traffic and result in  occasional street closures.    CONSENT AGENDA  Items listed on the Consent Agenda were adopted with one motion, following the listing.   a) Approval of Council Meeting minutes of August 6, 2018. Council Concur.  AGENDA ITEM #8. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES    b) AB ‐ 2178 City Clerk recommended granting a 20‐year latecomer agreement, File No. LA‐17‐ 001, in the amount of $188,408, to Kushal Varma and Kajal Ram for sewer main extension on  SE 132nd St., and authorizing staff to finalize the latecomer agreement per City Code,  including directing the City Clerk to notify affected property owners. Refer to Utilities  Committee.   c) AB ‐ 2195 Transportation Systems Division recommended adoption of a resolution authorizing  the temporary complete closure of SW 19th St. between 100 SW 19th St. and 204 SW 19th St.  for a period of up to 10 calendar days between September 4 and September 30, 2018 to  construct the Rolling Hills Creek culvert tie‐in as part of the I‐405/SR 167 Interchange Direct  Connector project. Refer to Transportation (Aviation) Committee.    MOVED BY PRINCE, SECONDED BY CORMAN, COUNCIL CONCUR TO APPROVE THE  CONSENT AGENDA, AS PRESENTED. CARRIED.    UNFINISHED BUSINESS   a) Public Safety Committee Chair Pavone presented a report concurring in the staff  recommendation to repeal and replace Renton Municipal Code 6‐3, with language and processes  that support modern false alarm reduction programs.    MOVED BY PAVONE, SECONDED BY PERSSON, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   b) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to  approve the Award of the Falcon Ridge Lift Station Replacement and Force Main Improvements  Project to Road Construction Northwest, Inc. with a bid of $926,502.50. The Utilities Committee  further recommended concurrence in the staff recommendation of a budget transfer of  $250,000 from Thunder Hill Interceptor Rehabilitation project (426.465495) to Falcon Ridge Lift  Station Replacement and Force Main Improvements project (426.465480) as part of the next  budget adjustment. The proposed $1,250,000 budget for Falcon Ridge Lift Station Replacement  and Force Main Improvements project will be sufficient to cover the bid amount plus an  approximate 20% contingency, the engineering contract, and staff time.     MOVED BY WITSCHI, SECONDED BY MCIRVIN, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   c) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to  execute Change Order No. 1 to CAG‐17‐174 with Laser Underground & Earthworks, Inc. in the  amount of $302,406.79 for the rebuilding of Cedar Avenue South.    MOVED BY WITSCHI, SECONDED BY CORMAN, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.                 AGENDA ITEM #8. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES  d) Finance Committee Chair Persson presented a report concurring in the staff recommendation to  approve the following payments:  1. Accounts Payable – total payment of $12,193,110.73 for vouchers 10081‐10084, 72518,  72718, 7012018, 366581‐366584, 366596‐366929, 366943‐367341; payroll benefit  withholding vouchers 5845‐5864, 70218, 70918, 366585‐366595, 366930‐366942; and  seventeen wire transfers.  2. Payroll – total payment of $3,017,559.20 for payroll vouchers which includes 1,575 direct  deposits and 79 checks (June 15‐30 & July 01‐15 2018 pay periods).  3. Kidder Mathews – total payment of $25,842.40 for vouchers 5671‐5684.    MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   e) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to  execute the agreement with Murraysmith, Inc. in the amount of $683,735 for Phase 2 of the  Downtown Utility Improvement Project.    MOVED BY WITSCHI, SECONDED BY CORMAN, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   f) Finance Committee Chair Persson presented a report concurring in the staff recommendation to  approve the Consortium Fiber Project Agreement to conduct a feasibility study to utilize the  Eastside Rail Corridor as a fiber optic infrastructure corridor.    MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.   g) Finance Committee Chair Persson presented a report concurring in the staff recommendation to  authorize and sign the En Pointe Technology purchase order in the amount of $157,730.17 for  the renewal of Microsoft Enterprise Licenses True‐up under an existing Volume Licensing  Agreement (Enrollment No. 81271399 / Agreement No. 01E73965).    MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE  COMMITTEE RECOMMENDATION. CARRIED.    LEGISLATION   Resolution:   a) Resolution No. 4350:  A resolution was read authorizing the Mayor and City Clerk to enter  into an interlocal agreement with the City of Bellevue, City of Kirkland, City of Redmond, King  County, Bellevue School District 405, Lake Washington School District, and Renton School  District, entitled "Consortium Project Agreement 73," regarding the Eastside Rail Corridor  (ERC) Fiber Optic Feasibility Study, with such study being a project of the Community  Connectivity Consortium which was previously formed by interlocal agreement.     MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL ADOPT THE RESOLUTION AS  READ. CARRIED.             AGENDA ITEM #8. a) August 13, 2018 REGULAR COUNCIL MEETING MINUTES  Ordinance for first reading:   b) Ordinance No. 5886:  An ordinance was read repealing and replacing Chapter 6‐3 of the  Renton Municipal Code, amending alarm system regulations, and providing for severability  and establishing an effective date.     MOVED BY PAVONE, SECONDED BY PERSSON, COUNCIL REFER THE ORDINANCE  FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED.    NEW BUSINESS   Please see the attached Council Meeting Calendar.    MOVED BY PAVONE, SECONDED BY CORMAN, COUNCIL REFER THE TOPIC OF THE RENTON  REGIONAL FIRE AUTHORITY’S SEPARATION FROM RECEIVING CITY SUPPORT FOR CERTAIN  SERVICES TO THE COMMITTEE OF THE WHOLE. CARRIED.    ADJOURNMENT    MOVED BY PRINCE, SECONDED BY PERSSON, COUNCIL ADJOURN. CARRIED. TIME:  7:37 P.M.    Jason A. Seth, CMC, City Clerk  Jason Seth, Recorder  Monday, August 13, 2018  AGENDA ITEM #8. a) Council Committee Meeting Calendar August 13, 2018 August 20, 2018 Monday 4:00 PM Transportation Committee, Chair Corman – Council Conference Room 1. Temporary Total Closure of East Valley Rd & SW 19th St. Intersection 2. Temporary Total Closure of SW 19th St. 3. 2019-2024 Six-year Transportation Improvement Program 4. Regional Transit Planning Discussion 5. Emerging Issues in Transportation - Including Wells and Williams Conversion Update 5:30 PM Community Services Committee, Chair Pérez – Council Conference Room 1. Park Maintenance Responsibility of Homeless Camp Removals & Requirements 2. Emerging Issues in Community Services 6:00 PM Committee of the Whole, Chair Prince – Council Chambers 1. King County Metro’s Sewer Interceptor Rehabilitation Project 2. Regional Issues AGENDA ITEM #8. a) AB - 2198 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Proposed Annexation - Parker 60% Direct Petition to Annex RECOMMENDED ACTION: Council Concur; Set Public Hearing on XX/XX/XXXX DEPARTMENT: City Clerk STAFF CONTACT: Jason Seth, City Clerk EXT.: 6502 FISCAL IMPACT SUMMARY: N/A SUMMARY OF ACTION: On March 11, 2013, Council authorized Adria Krail, petitioner, to circulate a 60% Direct Petition to Annex specifying that property owners must accept City zoning and their proportional share of the City's existing bonded indebtedness. On June 12, 2018, Ms. Krail submitted the 60% Direct Petition to Annex to the City. The petition was then forwarded to King County Department of Assessments to certify the petition's sufficienc y per RCW 35A.01.040. King County certified the petition in a letter dated July 12, 2018 (attached). Therefore, staff recommends a Public Hearing to consider the 60% Direct Petition to Annex for the proposed Parker Annexation be set for September 10, 2018. The proposed annexation area was pre-zoned via Ordinance #5254 with R-4 zoning, which will become effective upon annexation. The proposed 14.5-acre Parker Annexation is located at the southeastern portion of the City limits. The Parker Annexation Area is bordered by Renton City limits at the west, by the urban growth boundary at the west and south, and by Southeast 124th St. at the south. EXHIBITS: A. Issue Paper B. King County Certification Letter C. Vicinity Map STAFF RECOMMENDATION: Set September 10, 2018 as a Public Hearing to consider the 60% Direct Petition to Annex for the proposed Parker Annexation. AGENDA ITEM #8. b) DEPARTMENT OF COMMUNITY & ECONOMIC DEVELOPMENT M E M O R A N D U M DATE: August 1, 2018 TO: Ed Prince, Council President Members of the Renton City Council VIA: Denis Law, Mayor FROM: Chip Vincent, Administrator x6592 STAFF CONTACT: Angie Mathias, Long Range Planning Manger x6576 SUBJECT: Parker Annexation - Acceptance of 60% Direct Petition to Annex ISSUES: Should the City Council accept the 60% Direct Petition to Annex from the Parker Annexation Area now that the petition has been certified by the King County Department of Assessments? If the City Council accepts the 60% Direct Petition, should the Administration be directed to forward the Notice of Intent package for this annexation to the Boundary Review Board? RECOMMENDATION: Council accept the 60% Direct Petition to Annex the approximately 8- acre Parker Annexation site; Council authorize the Administration to forward the Notice of Intent for the Parker Annexation to the Boundary Review Board for King County for their review. BACKGROUND SUMMARY: At its March 11, 2013 public meeting, Council accepted the 10% Notice of Intent to Commence Annexation petition and authorized the circulation of a 60% Direct Petition to Annex. City of Renton departments reviewed the annexation proposal and all staff reported that the annexation represents a logical extension of their respective services and systems. There were no issues identified that would impede the annexation. On June 12, 2018, the petitioner submitted the 60% Direct Petition to Annex. That petition was certified as sufficient, with signatures of property owners representing at least 60% of the taxable value of the annexation area, by King County on July 12, 2018. AGENDA ITEM #8. b) Ed Prince, Council President Page 2 of 2 August 1, 2018 Page 2 of 4 BACKGROUND SUMMARY: The proposed 14.5-acre Parker Annexation is located at the southeastern portion of the City limits. The Parker Annexation Area is bordered by Renton City limits at the west, by the urban growth boundary at the east and north, and by Southeast 124th St at the south. 1. Location: The proposed 14.5-acre Parker Annexation is bordered by the existing City limits at its west. 2. Assessed value: The 2018 assessed valuation of the subject annexation site is $18,991,000. 3. Natural features: The topography is level with only very small areas of grade change of small hills rising to five feet above the grade of the surrounding land. Approximately 560 feet of a type Ns stream runs through a portion of the annexation area. It is in the southeastern portion of the area. Type Ns streams are waters that do not contain fish or fish habitat and have intermittent flows, they are seasonal non-habitat streams in which surface flow is not present for at least some portion of a year of normal rainfall. Ns Waters must be physically connected by an above-ground channel system to Type S, F, or Np Waters. Any future development would be required to comply with Critical areas regulations which require a 50 foot buffer from the stream and an additional 15 foot structure setback beyond the buffer. Additionally a large wetland in a tract is located along the western boundary of the annexation area. It appears that there is no vacant land adjacent to the wetland so buffers for new development would not be applied. 4. Existing land uses: There are 44 single-family residences and vacant land. 5. Existing zoning: Existing King County zoning is R-4. This area was prezoned by the City of Renton as part of the East Renton Plateau pre-zoning. City of Renton Ordinance #5254 prezoned the area with R-4 zoning; this zoning will become effective upon annexation. 6. Comprehensive Plan: Renton’s Comprehensive Plan designates the subject annexation site as Residential Low Density (RLD). 7. School District: The Parker Annexation area is in the Issaquah School District. 8. Public services: All responding City of Renton departments and divisions noted that the annexation represents a logical extension of their respective services and systems and presents no foreseeable problems. Specific comments follow: AGENDA ITEM #8. b) Ed Prince, Council President Page 2 of 2 August 1, 2018 Page 3 of 4 Water Utility. The subject site is located within Water District No. 90’s water service area by agreement under the coordinated water system plan. A certificate of water availability from District 90 will be required prior to the issuance of development permits within the subject area, following annexation to the City. It is expected that developer extensions of District No. 90’s water mains will be required to provide service for fire protection and domestic use within the annexation area. The proposed area will not generate need for additional City employees because it is within Water District No. 90. Wastewater Utility. The area is within the Renton wastewater service area and is currently served with sewer service by the City. The annexation does not present any problems for the utility. Parks. The Community Services department indicated that the annexation represents a logical extension of the services provided by their department. Staff noted that the area is currently underserved with Renton parks and recreation. Staff stated that the Community Planning area this annexation falls in has been identified as needing to acquire land for two neighborhood parks and one community park. However, King County’s Coal Field Park is adjacent to the site. Police. The Police Department did not indicate any concerns regarding this proposed annexation. It is estimated that the area will generate an additional 39 calls for service annually. Fire. Renton Regional Fire Authority currently serve the area, they will continue to serve it. Staff did not indicate any concerns regarding this proposed annexation. Surface Water. The area is located in the May Creek drainage basin and any future development will be required to comply with the City’s Surface Water Design Manual and the Flow Control Duration Matching Forested Site Conditions should be applied. Staff noted that the area contains very limited stormwater infrastructure, consisting of primarily ditches. There are no curb and gutters and some lawns encroach into the right of way. Several parcels contain standing water and are possible wetlands. Additionally, an unnamed stream that is a tributary to May Creek originates within this area. There are no records of drainage complaints with King County. If the area annexes, it will require maintenance from the City. The annexation is a logical extension of the services provided by the division. Transportation Systems. The Transportation Systems staff has no concerns regarding the proposed annexation. Staff indicated that additional AGENDA ITEM #8. b) Ed Prince, Council President Page 2 of 2 August 1, 2018 Page 4 of 4 Transportation Systems staff would not be required and that the annexation represents a logical extension of services. Staff indicated that dedication of right-of-way on Southeast 120th and Southeast 124th may be required if the streets were to be redeveloped in the future to current Renton standards. Also, the roadways in the area have not been constructed to include curb, gutter, and sidewalks, which is the current Renton development standard for roadways. The area does have street lighting, but it does not meet current Renton Standards. Energy costs associated with existing and new street lighting, existing and new traffic control signage, and pavement markings may be incurred by the City. Staff indicated that the City would assume ownership and responsibility of all existing streets in the area. Public Works Maintenance. The annexation does not present any problems for the Department and it represents a logical extension of their services. Staff noted that seven years ago the area had some roads rebuilt and in some places the roads are cracking. Also, there are shoulders in the area that will need to be maintained. Building. The Building section did not indicate any concerns regarding the proposed annexation. Planning. The Planning section did not indicate any concerns regarding the proposed annexation. CONCLUSION: The proposed Parker Annexation has been certified as having sufficient signatures representing at least 60% of the area’s assessed value. It also has reasonable boundaries and appears to comply with Boundary Review Board objectives. Reviewing staff raised no objections to this annexation. The proposed Parker Annexation furthers the City’s Business Plan goals and is in the general welfare and interest of the City. The Administration recommends the Council accept the 60% Direct Petition and authorize staff to forward the Notice of Intent package to the Boundary Review Board for King County. AGENDA ITEM #8. b) AGENDA ITEM #8. b) Coalfield ParkCoalfield ParkShadow Ave NENE 7th Pl NE 6th St Private RdNE 6 t h S t SE 120th St SE 124th St NE 7th Ct Rosario Pl NES E 1 2 4 t h S t156th Ave SERosario Pl NES hado w A ve NE155th Ave SEParker A nnexat ionVicinity Ma pAnnex b ou nd a ry Pa rks Pa rce lso1:3,200 0 400200Fee t Pa th: H:\CED\Planning\GIS\GIS_projects\annex ations\parker_annex\Mx ds \1_parker_annex _v ic inity.mxd Pri nted Date: 03/13/2013 AGENDA ITEM #8. b) AB - 2200 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Office Mail Metering Services Contract with Diamond Marketing Solutions, Inc. RECOMMENDED ACTION: Refer to Finance Committee DEPARTMENT: Executive STAFF CONTACT: Karl Hurst, Print & Mail Coordinator EXT.: 6975 FISCAL IMPACT SUMMARY: $98,551.20 yearly; contract for a three-year term totaling $295,653.60 Cost of contract will be covered in Print/Mail’s current budget. SUMMARY OF ACTION: Print/Mail Services has used the vendor Postal Express since before 1996. Services provided are: metering, postal delivery, pickup/delivery from Highlands USPS to City of Renton and pickup/delivery from City of Renton to Postal Express. Postal Express was purchased by GSO several years ago and became a subsidiary of the company. Since the acquisition, services provided to the City has declined, including but not limited to: late service, missed daily service, an d not funding postage to their subcontracted m etering company. Print/Mail Services would like to contract with vendor Diamond Marketing Solutions, Inc. (which is an innovative, full - service, Renton business) for metering and postal delivery. Yearly cost would be $98,551.20, compared to $99,299.47, cost of same services for the past 12 months with Postal Express. All costs are estimated and depend on amount of office mail generated in the future (see Exhibit C). A new service provider will be procured for pickup/delivery from Highlands USPS to City of Renton and pickup/delivery from City of Renton to Diamond Marketing Solutions, Inc. Preliminary estimates from one delivery service suggest costs could be cut by 20 to 30 percent from what Postal Express was charging (see exhibit B). EXHIBITS: A. Contract w/Diamond Marketing Solutions, Inc. B. Cost Comparisons between vendors C. Mail Trends STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to sign a contract with Diamond Marketing Solutions, Inc. for postal metering and delivery for a three-year period. AGENDA ITEM #8. c) AGREEMENT FOR MAIL METERING/PRESORT SERVICE THIS AGREEMENT, dated August 1st, 2018, is by and between the City of Renton (the “City”), a Washington municipal corporation, and Diamond Marketing Solutions Group, Inc. (“Consultant”), a Delaware Corporation with principal place of business at 700 SW 34th Street, Renton WA. The City and the Consultant are referred to collectively in this Agreement as the “Parties.” Once fully executed by the Parties, this Agreement is effective as of the last date signed by both parties. 1. Scope of Work: Consultant agrees to provide presort services, mail metering, and submission of mail to USPS as specified in Exhibit A, which is attached and incorporated herein and may hereinafter be referred to as the “Work.” 2. Changes in Scope of Work: The City, without invalidating this Agreement, may order changes to the Work consisting of additions, deletions or modifications. Any such changes to the Work shall be ordered by the City in writing and the Compensation shall be equitably adjusted consistent with the rates set forth in Exhibit A or as otherwise mutually agreed by the Parties. 3.Time of Performance: Consultant shall commence performance of the Agreement pursuant to the schedule(s) set forth in Exhibit A. 4. Compensation: A. Amount. Total compensation to Consultant for Work provided pursuant to this Agreement shall not exceed $350,000.00 plus any applicable state and local sales taxes. Compensation shall be paid based upon Work actually performed according to the rate(s) or amounts specified in Exhibit A. The Consultant agrees that any hourly or flat rate charged by it for its Work shall remain locked at the negotiated rate(s) unless otherwise agreed to in writing or provided in Exhibit A. Except as specifically provided herein, the Consultant shall be solely responsible for payment of any taxes imposed as a result of the performance and payment of this Agreement. B. Method of Payment. On a monthly or no less than quarterly basis during any quarter in which Work is performed, the Consultant shall submit a voucher or invoice in a form specified by the City, including a description of what Work has been performed. Payment shall be made by the City for Work performed within thirty (30) calendar days after receipt and approval by the appropriate City representative AGENDA ITEM #8. c) PAGE 2 OF 11 of the voucher or invoice. If the Consultant’s performance does not meet the requirements of this Agreement, the Consultant will correct or modify its performance to comply with the Agreement. The City may withhold payment for work that does not meet the requirements of this Agreement. C. Effect of Payment. Payment for any part of the Work shall not constitute a waiver by the City of any remedies it may have against the Consultant for failure of the Consultant to perform the Work or for any breach of this Agreement by the Consultant. D. Non-Appropriation of Funds. If sufficient funds are not appropriated or allocated for payment under this Agreement for any future fiscal period, the City shall not be obligated to make payments for Work or amounts incurred after the end of the current fiscal period, and this Agreement will terminate upon the completion of all remaining Work for which funds are allocated. No penalty or expense shall accrue to the City in the event this provision applies. 5. Termination: A. The City reserves the right to terminate this Agreement at any time, with or without cause by giving ten (10) calendar days’ notice to the Consultant in writing. In the event of such termination or suspension, all finished or unfinished documents, data, studies, worksheets, models and reports, or other material prepared by the Consultant pursuant to this Agreement shall be submitted to the City, if any are required as part of the Work. B. In the event this Agreement is terminated by the City, the Consultant shall be entitled to payment for all Work performed to the effective date of termination, less all payments previously made. If the Agreement is terminated by the City after partial performance of Work for which the agreed compensation is a fixed fee, the City shall pay the Consultant an equitable share of the fixed fee. This provision shall not prevent the City from seeking any legal remedies it may have for the violation or nonperformance of any of the provisions of this Agreement and such charges due to the City shall be deducted from the final payment due the Consultant. No payment shall be made by the City for any expenses incurred or work done following the effective date of termination unless authorized in advance in writing by the City. 6. Warranties And Right To Use Work Product: Consultant represents and warrants that Consultant will perform all Work identified in this Agreement in a professional and workmanlike manner and in accordance with all reasonable and professional standards and laws. Compliance with professional standards includes, as applicable, performing the Work in compliance with applicable City standards or guidelines (e.g. design criteria and Standard Plans for Road, Bridge and Municipal Construction). Professional AGENDA ITEM #8. c) PAGE 3 OF 11 engineers shall certify engineering plans, specifications, plats, and reports, as applicable, pursuant to RCW 18.43.070. Consultant further represents and warrants that all final work product created for and delivered to the City pursuant to this Agreement shall be the original work of the Consultant and free from any intellectual property encumbrance which would restrict the City from using the work product. Consultant grants to the City a non-exclusive, perpetual right and license to use, reproduce, distribute, adapt, modify, and display all final work product produced pursuant to this Agreement. The City’s or other’s adaptation, modification or use of the final work products other than for the purposes of this Agreement shall be without liability to the Consultant. The provisions of this section shall survive the expiration or termination of this Agreement. 7. Record Maintenance: The Consultant shall maintain accounts and records, which properly reflect all direct and indirect costs expended and Work provided in the performance of this Agreement and retain such records for as long as may be required by applicable Washington State records retention laws, but in any event no less than six years after the termination of this Agreement. The Consultant agrees to provide access to and copies of any records related to this Agreement as required by the City to audit expenditures and charges and/or to comply with the Washington State Public Records Act (Chapter 42.56 RCW). The provisions of this section shall survive the expiration or termination of this Agreement. 8. Public Records Compliance: To the full extent the City determines necessary to comply with the Washington State Public Records Act, Consultant shall make a due diligent search of all records in its possession or control relating to this Agreement and the Work, including, but not limited to, e-mail, correspondence, notes, saved telephone messages, recordings, photos, or drawings and provide them to the City for production. In the event Consultant believes said records need to be protected from disclosure, it may, at Consultant’s own expense, seek judicial protection. Consultant shall indemnify, defend, and hold harmless the City for all costs, including attorneys’ fees, attendant to any claim or litigation related to a Public Records Act request for which Consultant has responsive records and for which Consultant has withheld records or information contained therein, or not provided them to the City in a timely manner. Consultant shall produce for distribution any and all records responsive to the Public Records Act request in a timely manner, unless those records are protected by court order. The provisions of this section shall survive the expiration or termination of this Agreement. 9. Independent Contractor Relationship: A. The Consultant is retained by the City only for the purposes and to the extent set forth in this Agreement. The nature of the relationship between the Consultant and the City during the period of the Work shall be that of an independent contractor, not employee. The Consultant, not the City, shall have the power to control and AGENDA ITEM #8. c) PAGE 4 OF 11 direct the details, manner or means of Work. Specifically, but not by means of limitation, the Consultant shall have no obligation to work any particular hours or particular schedule, unless otherwise indicated in the Scope of Work or where scheduling of attendance or performance is mutually arranged due to the nature of the Work. Consultant shall retain the right to designate the means of performing the Work covered by this agreement, and the Consultant shall be entitled to employ other workers at such compensation and such other conditions as it may deem proper, provided, however, that any contract so made by the Consultant is to be paid by it alone, and that employing such workers, it is acting individually and not as an agent for the City. B. The City shall not be responsible for withholding or otherwise deducting federal income tax or Social Security or contributing to the State Industrial Insurance Program, or otherwise assuming the duties of an employer with respect to Consultant or any employee of the Consultant. C. If the Consultant is a sole proprietorship or if this Agreement is with an individual, the Consultant agrees to notify the City and complete any required form if the Consultant retired under a State of Washington retirement system and agrees to indemnify any losses the City may sustain through the Consultant’s failure to do so. 10. Hold Harmless: The Consultant agrees to release, indemnify, defend, and hold harmless the City, elected officials, employees, officers, representatives, and volunteers from any and all claims, demands, actions, suits, causes of action, arbitrations, mediations, proceedings, judgments, awards, injuries, damages, liabilities, taxes, losses, fines, fees, penalties, expenses, attorney’s or attorneys’ fees, costs, and/or litigation expenses to or by any and all persons or entities, arising from, resulting from, or related to the negligent acts, errors or omissions of the Consultant in its performance of this Agreement or a breach of this Agreement by Consultant, except for that portion of the claims caused by the City’s sole negligence. Should a court of competent jurisdiction determine that this agreement is subject to RCW 4.24.115, (Validity of agreement to indemnify against liability for negligence relative to construction, alteration, improvement, etc., of structure or improvement attached to real estate…) then, in the event of liability for damages arising out of bodily injury to persons or damages to property caused by or resulting from the concurrent negligence of the Consultant and the City, its officers, officials, employees and volunteers, Consultant’s liability shall be only to the extent of Consultant’s negligence. It is further specifically and expressly understood that the indemnification provided in this Agreement constitute Consultant’s waiver of immunity under the Industrial Insurance Act, RCW Title 51, solely for the purposes of this indemnification. The Parties AGENDA ITEM #8. c) PAGE 5 OF 11 have mutually negotiated and agreed to this waiver. The provisions of this section shall survive the expiration or termination of this Agreement. 11. Gifts and Conflicts: The City’s Code of Ethics and Washington State law prohibit City employees from soliciting, accepting, or receiving any gift, gratuity or favor from any person, firm or corporation involved in a contract or transaction. To ensure compliance with the City’s Code of Ethics and state law, the Consultant shall not give a gift of any kind to City employees or officials. Consultant also confirms that Consultant does not have a business interest or a close family relationship with any City officer or employee who was, is, or will be involved in selecting the Consultant, negotiating or administering this Agreement, or evaluating the Consultant’s performance of the Work. 12. City of Renton Business License: The Consultant shall obtain a City of Renton Business License prior to performing any Work and maintain the business license in good standing throughout the term of this agreement with the City. Information regarding acquiring a city business license can be found at: http://www.rentonwa.gov/cms/One.aspx?portalId=7922741&pageId=9824882 Information regarding State business licensing requirements can be found at: http://dor.wa.gov/doing-business/register-my-business 13. Insurance: Consultant shall secure and maintain: A. Commercial general liability insurance in the minimum amounts of $1,000,000 for each occurrence/$2,000,000 aggregate for the Term of this Agreement. B. In the event that Work delivered pursuant to this Agreement either directly or indirectly involve or require Professional Services, Professional Liability, Errors and Omissions coverage shall be provided with minimum limits of $1,000,000 per occurrence. "Professional Services", for the purpose of this section, shall mean any Work provided by a licensed professional or Work that requires a professional standard of care. C. Workers’ compensation coverage, as required by the Industrial Insurance laws of the State of Washington, shall also be secured. D. Commercial Automobile Liability for owned, leased, hired or non-owned with minimum limits of $1,000,000 per occurrence combined single limit, if there will be any use of Consultant’s vehicles on the City’s Premises by or on behalf of the City, beyond normal commutes. AGENDA ITEM #8. c) PAGE 6 OF 11 E. Consultant shall name the City as an Additional Insured on its commercial general liability policy on a non-contributory primary basis. The City’s insurance policies shall not be a source for payment of any Consultant liability, nor shall the maintenance of any insurance required by this Agreement be construed to limit the liability of Consultant to the coverage provided by such insurance or otherwise limit the City’s recourse to any remedy available at law or in equity. F. Subject to the City’s review and acceptance, a certificate of insurance showing the proper endorsements, shall be delivered to the City before performing the Work. G. Consultant shall provide the City with written notice of any policy cancellation, within two (2) business days of their receipt of such notice. 14. Delays: Consultant is not responsible for delays caused by factors beyond the Consultant’s reasonable control. When such delays beyond the Consultant’s reasonable control occur, the City agrees the Consultant is not responsible for damages, nor shall the Consultant be deemed to be in default of the Agreement. 15. Successors and Assigns: Neither the City nor the Consultant shall assign, transfer or encumber any rights, duties or interests accruing from this Agreement without the written consent of the other. 16. Notices: Any notice required under this Agreement will be in writing, addressed to the appropriate party at the address which appears below (as modified in writing from time to time by such party), and given personally, by registered or certified mail, return receipt requested, by facsimile or by nationally recognized overnight courier service. Time period for notices shall be deemed to have commenced upon the date of receipt, EXCEPT facsimile delivery will be deemed to have commenced on the first business day following transmission. Email and telephone may be used for purposes of administering the Agreement, but should not be used to give any formal notice required by the Agreement. CITY OF RENTON Karl Hurst 1055 South Grady Way Renton, WA 98057 Phone: (425) 430-6975 khurst@rentonwa.gov Fax: (425) 430-6523 CONSULTANT David O’Malley 710 SW 34th Street Renton WA 98057-4816 Phone: 425-251-0833 ext. 385 domalley@dmsolutions.com AGENDA ITEM #8. c) PAGE 7 OF 11 17. Discrimination Prohibited: Except to the extent permitted by a bona fide occupational qualification, the Consultant agrees as follows: A. Consultant, and Consultant’s agents, employees, representatives, and volunteers with regard to the Work performed or to be performed under this Agreement, shall not discriminate on the basis of race, color, sex, religion, nationality, creed, marital status, sexual orientation or preference, age (except minimum age and retirement provisions), honorably discharged veteran or military status, or the presence of any sensory, mental or physical handicap, unless based upon a bona fide occupational qualification in relationship to hiring and employment, in employment or application for employment, the administration of the delivery of Work or any other benefits under this Agreement, or procurement of materials or supplies. B. The Consultant will take affirmative action to insure that applicants are employed and that employees are treated during employment without regard to their race, creed, color, national origin, sex, age, sexual orientation, physical, sensory or mental handicaps, or marital status. Such action shall include, but not be limited to the following employment, upgrading, demotion or transfer, recruitment or recruitment advertising, layoff or termination, rates of pay or other forms of compensation and selection for training. C. If the Consultant fails to comply with any of this Agreement’s non-discrimination provisions, the City shall have the right, at its option, to cancel the Agreement in whole or in part. D. The Consultant is responsible to be aware of and in compliance with all federal, state and local laws and regulations that may affect the satisfactory completion of the project, which includes but is not limited to fair labor laws, worker's compensation, and Title VI of the Federal Civil Rights Act of 1964, and will comply with City of Renton Council Resolution Number 4085. 18. Miscellaneous: The parties hereby acknowledge: A. The City is not responsible to train or provide training for Consultant. B. Consultant will not be reimbursed for job related expenses except to the extent specifically agreed within the attached exhibits. C. Consultant shall furnish all tools and/or materials necessary to perform the Work except to the extent specifically agreed within the attached exhibits. D. In the event special training, licensing, or certification is required for Consultant to provide Work he/she will acquire or maintain such at his/her own expense and, if Consultant employs, sub-contracts, or otherwise assigns the responsibility to AGENDA ITEM #8. c) PAGE 8 OF 11 perform the Work, said employee/sub-contractor/assignee will acquire and or maintain such training, licensing, or certification. E. This is a non-exclusive agreement and Consultant is free to provide his/her Work to other entities, so long as there is no interruption or interference with the provision of Work called for in this Agreement. F. Consultant is responsible for his/her own insurance, including, but not limited to health insurance. G. Consultant is responsible for his/her own Worker’s Compensation coverage as well as that for any persons employed by the Consultant. 19. Other Provisions: A. Approval Authority. Each individual executing this Agreement on behalf of the City and Consultant represents and warrants that such individuals are duly authorized to execute and deliver this Agreement on behalf of the City or Consultant. B. General Administration and Management. The City’s project manager is Karl Hurst or current Print/Mail Supervisor. In providing Work, Consultant shall coordinate with the City’s contract manager or his/her designee. C. Amendment and Modification. This Agreement may be amended only by an instrument in writing, duly executed by both Parties. D. Conflicts. In the event of any inconsistencies between Consultant proposals and this Agreement, the terms of this Agreement shall prevail. Any exhibits/attachments to this Agreement are incorporated by reference only to the extent of the purpose for which they are referenced within this Agreement. To the extent a Consultant prepared exhibit conflicts with the terms in the body of this Agreement or contains terms that are extraneous to the purpose for which it is referenced, the terms in the body of this Agreement shall prevail and the extraneous terms shall not be incorporated herein. E. Governing Law. This Agreement shall be made in and shall be governed by and interpreted in accordance with the laws of the State of Washington and the City of Renton. Consultant and all of the Consultant’s employees shall perform the Work in accordance with all applicable federal, state, county and city laws, codes and ordinances. F. Joint Drafting Effort. This Agreement shall be considered for all purposes as prepared by the joint efforts of the Parties and shall not be construed against one AGENDA ITEM #8. c) PAGE 9 OF 11 party or the other as a result of the preparation, substitution, submission or other event of negotiation, drafting or execution. G. Jurisdiction and Venue. Any lawsuit or legal action brought by any party to enforce or interpret this Agreement or any of its terms or covenants shall be brought in the King County Superior Court for the State of Washington at the Maleng Regional Justice Center in Kent, King County, Washington, or its replacement or successor. H. Severability. A court of competent jurisdiction’s determination that any provision or part of this Agreement is illegal or unenforceable shall not cancel or invalidate the remainder of this Agreement, which shall remain in full force and effect. I. Sole and Entire Agreement. This Agreement contains the entire agreement of the Parties and any representations or understandings, whether oral or written, not incorporated are excluded. J. Time is of the Essence. Time is of the essence of this Agreement and each and all of its provisions in which performance is a factor. Adherence to completion dates set forth in the description of the Work is essential to the Consultant’s performance of this Agreement. K. Third-Party Beneficiaries. Nothing in this Agreement is intended to, nor shall be construed to give any rights or benefits in the Agreement to anyone other than the Parties, and all duties and responsibilities undertaken pursuant to this Agreement will be for the sole and exclusive benefit of the Parties and no one else. L. Binding Effect. The Parties each bind themselves, their partners, successors, assigns, and legal representatives to the other party to this Agreement, and to the partners, successors, assigns, and legal representatives of such other party with respect to all covenants of the Agreement. M. Waivers. All waivers shall be in writing and signed by the waiving party. Either party’s failure to enforce any provision of this Agreement shall not be a waiver and shall not prevent either the City or Consultant from enforcing that provision or any other provision of this Agreement in the future. Waiver of breach of any provision of this Agreement shall not be deemed to be a waiver of any prior or subsequent breach unless it is expressly waived in writing. N. Counterparts. The Parties may execute this Agreement in any number of counterparts, each of which shall constitute an original, and all of which will together constitute this one Agreement. AGENDA ITEM #8. c) PAGE 10 OF 11 IN WITNESS WHEREOF, the Parties have voluntarily entered into this Agreement as of the date last signed by the Parties below. CITY OF RENTON By:_____________________________ CONSULTANT By:____________________________ Denis Law Mayor David O’Malley V.P. Communication Services _____________________________ Date _____________________________ Date Attest _____________________________ Jason A. Seth City Clerk Approved as to Legal Form _____________________________ Shane Moloney Renton City Attorney Contract Template Updated 04/10/2018 AGENDA ITEM #8. c) PAGE 11 OF 11 Exhibit A Scope of Work Diamond Marketing Solutions Group, Inc. (“Diamond”) and City of Renton (“Client”) are entering into a contract where Diamond will provide the following services commencing September 1, 2018 for a term of three years through August 31, 2021. 1. Metering $.05 per piece 2. Presorting $.02 per piece 3. Processing files for print $.03 per item Optional 4. Printing $.03 per image Optional 5. Mailing service (folding, inserting metering, sorting) $.04 per envelope Optional 6. Monthly Minimum $100.00 Diamond shall provide metering and presort services each weekday (excluding city holidays), and processed mail will be submitted by Diamond to the USPS on the same day received. City or its agent shall deliver mail to Diamond no later than 4pm daily. Diamond and Client both agree to these services and prices as outlined above. AGENDA ITEM #8. c) Complete year of Charged Mail Services (most recent) Date Billing Period Vendor Invoice#Amount Actual Postage Service Costs #Days Serv Pieces 7/10/2017 Jun-17 Postal Express P1706862 $10,432.86 $8,041.06 $2,391.80 22 14,222 8/7/2017 Jul-17 Postal Express P1707855 $8,328.68 $6,184.61 $2,144.07 20 10,566 9/7/2017 Aug-17 Postal Express P1708591 $9,553.16 $7,052.65 $2,500.51 23 12,903 10/6/2017 Sep-17 Postal Express P1709397 $9,578.67 $7,639.58 $1,939.09 20 12,902 11/6/2017 Oct-17 Postal Express P1710404 $9,102.59 $6,819.51 $2,283.08 21 11,609 12/20/2017 Nov-17 Postal Express P1711704 $8,951.80 $6,886.16 $2,065.64 19 12,723 1/2/2018 Dec-17 Postal Express P1712313 $9,533.71 $7,498.36 $2,035.35 19 13,758 154,299 12 month 1st Class Office mail pieces 2/7/2018 Jan-18 Postal Express P1801552 $9,667.19 $7,492.83 $2,174.36 20 13,256 3/2/2018 Feb-18 Postal Express P1802802 $11,418.76 $9,353.12 $2,065.64 19 16,522 4/4/2018 Mar-18 Postal Express P1803702 $9,300.77 $7,252.96 $2,047.81 22 12,689 5/8/2018 Apr-18 Postal Express P1804909 $8,907.08 $6,732.72 $2,174.36 20 11,589 6/11/2018 May-18 Postal Express P1805352 $9,188.51 $6,796.71 $2,391.80 22 11,560 $113,963.78 $87,750.27 Same year, Metering Service portion Separated Delivery Charges Date Billing Period Daily Rate Amount #Days Serv #Charged Days (from serv costs above - in future independent contractor to be determined 7/10/2017 Jun-17 $48.13 $1,058.86 22 22 $1,332.94 8/7/2017 Jul-17 $48.13 $962.60 20 20 $1,181.47 9/7/2017 Aug-17 $48.13 $1,106.99 23 23 $1,393.52 10/6/2017 Sep-17 $48.13 $818.21 20 17 $1,120.88 11/6/2017 Oct-17 $48.13 $1,010.73 21 21 $1,272.35 12/20/2017 Nov-17 $48.13 $914.47 19 19 $1,151.17 1/2/2018 Dec-17 $48.13 $914.47 19 19 $1,120.88 2/7/2018 Jan-18 $48.13 $962.60 20 20 $1,211.76 3/2/2018 Feb-18 $48.13 914.47 19 19 $1,151.17 4/4/2018 Mar-18 $48.13 $866.34 21 18 $1,181.47 5/8/2018 Apr-18 $48.13 $962.60 20 20 $1,211.76 6/11/2018 May-18 $48.13 $1,056.86 22 22 $1,334.94 $11,549.20 246 $14,664.31 Diamond Metering Contract Based on one year of past data above, a years cost for mail metering and postage was $99,299.47 In new contract all costs will be included in one piece rate at $0.07, multiplied by the same past year would be $10,800.93 for service and the actual postage ($87,750.27) to Total - $98,551.20 approx per year 3 years - $295,653.60 I forsee slightly more manageable postage costs in the future, even with postal increases. Office mail volumes have been slowly decreasing despite an uptick last year. See Exhibit D (mail trends). Another indicator that office mail numbers will decrease is is that we have been woking with Admin Services to automate utility late notices. These have historically been mailed as office mail, and mailing them as an automated mailing each month will take those quantities from the office mail totals. Approx 2000 pieces a month, which will be paid for on permit 20 (utility bills) and funded directly by Admin Services. The first mailing went out in July this year. Delivery Services (not in this contract) For delivery services - Verbal quotes with Thuder Dog were $16.00 am, and $25.00 pm, for $41.00 per service day. At 246 service days per year would be $10,086.00. Compare to past delivery costs above of $14,664.31 Yet to negotiate contract if needed. Need more comparables.AGENDA ITEM #8. c) 2016-2017 Mail Comparisons Category 2016 2017 Incr/Decr % Change Notes Bulk Mail (Permit 137) 327,815 298,779 -29,036 -8.9% 43 mailings 2016, 39 mailings 2017 1st Class (Office) Mail 141,544 155,073 13,529 9.6% Includes letters, flats, and parcels, outsourced for metering Utility Bills Mailed 264,216 254,196 -10,020 -3.8% Permit 20, 1st Class Inserting Equip Pieces 331,265 341,608 10,343 3.1% Many mail pieces (especially bulk) are prepared as self-mailers which are not processed through the inserting equipment. This practice helps keep costs down by eliminating envelopes. The increase in pieces processed through the inserter reflects the office mail increase. Maintain Fed Ex account for time sensitive/express mail, and lower costs for insured parcels. Watching rising outsource metering costs vs possible inhouse metering equipment. 2009 2010 2011 2012 2013 2014 2015 2016 2017 Bulk Mail (Permit 137) 271,925 257,789 249,089 284,274 299,910 303,367 299,584 327,815 298,779 1st Class (Office) Mail 195,081 180,788 169,027 151,354 152,842 146,145 145,336 141,544 155,073 Utility Bills Mailed 269,079 296,166 301,297 305,731 295,197 270,611 267,051 264,216 254,196 Inserting Equip Pieces 401,719 438,774 390,176 393,908 349,398 347,853 331,265 341,608 Mail Trends 0 50,000 100,000 150,000 200,000 250,000 300,000 350,000 400,000 450,000 500,000 2009 2010 2011 2012 2013 2014 2015 2016 2017 Bulk Mail (Permit 137)1st Class (Office) Mail Utility Bills Mailed Inserting Equip Pieces 0 50,000 100,000 150,000 200,000 250,000 300,000 350,000 400,000 450,000 500,000 2009 2010 2011 2012 2013 2014 2015 2016 2017 Bulk Mail (Permit 137) 1st Class (Office) Mail Utility Bills Mailed Inserting Equip Pieces AGENDA ITEM #8. c) AB - 2203 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Agreement between City of Renton and RRFA-Responsibilities for Developing Fire Station #15 RECOMMENDED ACTION: Council Concur DEPARTMENT: Executive STAFF CONTACT: Robert Harrison, Chief Administrative Officer EXT.: 6500 FISCAL IMPACT SUMMARY: City of Renton's responsibility for development costs shall not exceed the sum of $5,671,809, including applicable sales tax. In addition, the City's responsibility for Fire Station #15 furnishings and equipment (as shown in Exhibit C of the Agreement) shall not exceed $1,000,000, including applicable sales tax. These amounts will be dispersed from the General Government Capital Improvement Program fund. SUMMARY OF ACTION: In 2016, voters approved the Regional Renton Fire Authority Plan ("Plan"). The Plan approved the creation of the RRFA and committed the City and RRFA to certain cost-sharing arrangements. The Plan requires the City to pay for up to $5,671,809 for a new fire station, referred to as Fire Station #15. This agreement outlines the responsibilities and requirements of each party with regards to the development of Fire Station #15. EXHIBITS: A. Agreement STAFF RECOMMENDATION: Authorize the Mayor and City Clerk to execute the agreement with Renton Regional Fire Authority clarifying responsibilities for the development of Fire Station #15. AGENDA ITEM #8. d) AGREEMENTBETWEENTHECITYOFRENTONANDTHERENTONREGIONALFIREAUTHORITYCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#15THISAGREEMENTdatedthe________dayof_________,2018,isbetweentheCityofRenton,aWashingtonmunicipalcorporation(the“City”),andtheRentonRegionalFireAuthority,aWashingtonmunicipalcorporation(“RRFA”)(collectively,theCityandtheRRFAarethe“Parties”).RECITALS1.In2016,votersapprovedtheRegionalFireAuthorityPlan(“thePlan”).ThePlanapprovedthecreationoftheRRFAandcommittedtheCityandRRFAtocertaincostsharingarrangements.ThePlanrequirestheCitytobuildtheRRFAanewfirestation,referredtoasFireStation15.Withregardtocostsharing,thePlanprovidesasfollows:1.1.ThecostofdevelopingofFireStation15,includingallcostssuchassurvey,design,permit,constructionandanyassociatedactivitiesrequiredtobringthestationtooperationalstatus,inanamountnottoexceed$5.5million.Thecostisbasedona2015estimateandshallbeadjustedbytheSeattleAreaConstructionCostindexaspublishedbyEngineeringNewsRecord(ENR.COM)annuallythereafteruntiltheprojectconstructionbidisawarded.1.2.ThecostoffurnishingandequippingFireStation15isnottoexceed$1million.2.TheCityhasawardedthebidforFireStation15.TheRRFAapprovedtheplansforFireStation15inadvanceofthebidbeingawarded.TheCityandtheRRFAdesiretoenterintothisAgreementforthepurposesofsettingforththeresponsibilitiesandrequirementsofthePartieswithregardtoDevelopmentofFireStation#15.NOW,THEREFORE,inconsiderationofthemutualpromisesherein,thePartiesagreeasfollows:AGREEMENTI.ADOPTIONOFRECITALSTheforegoingrecitalsareadoptedandincorporatedhereinastermsofthisAgreement.Il.SPECIFICTERMSOFTHISAGREEMENTA.Property.TheCityownsanundividedparcelcommonlyknownas1404N30th5,Renton,WA(the“Property”),aslegallydescribedinExhibitA,whichisattachedandincorporatedhereinbyreference.TheCitywillbeconstructingFireStation15onthesoutherlyportionoftheAGREEMENTCRIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page1of13AGENDA ITEM #8. d) parcelandaCityownedwaterreservoirandrelatedutilityprojectonthenortherlyportionoftheparcel.PriortotransferofFireStation15totheRRFA,theCitywillcompleteasubdivisionofthepropertytoretainaportionofthepropertyforCitypurposesandtransfertotheRRFAonlythatportionofthepropertynecessarytosupportFireStation15.EasementswillbereservedtoallowtheRRFAandCitytoshareuseofaportionofthepropertyforcompatiblepurposes.B.Project-FireStation15.TheCitywillbeconstructingFireStation15onthesoutherlyportionoftheProperty(the“Project”)andaCityownedwaterreservoirandrelatedutilityprojectonthenortherlyportionoftheProperty.TheProjectwillbecompletedintwophases.ThefirstphaseoftheProjectwillincludeconstructionofthebuildingandthefrontdrivewaysufficienttoallowinitialoperationofFireStation15.Thefirstphasewillnotprovideaccesstoarearparkinglotorreargaragedoors.ThesecondphaseoftheProject,includingthepavingfortherearparkinglotcurbingandwestdriveway,RFFAparkinglotstriping,andassociatedlightingandlandscapingwillbecompletedinconjunctionwiththeCity’swaterutilityproject.ThecurrentSitePlanandSiteSequencingPlanfortheProjectisattachedandincorporatedhereinforreferencepurposesasExhibitB.Area1,aslabeledontheSiteSequencingPlan,willbedevelopedintheProject’sfirstphasebytheCity’sFacilitiesDivisionintheCommunityServicesDepartment.Area2,aslabeledontheSiteSequencingPlan,willbecompletedinthesecondphasebytheCity’sUtilitiesDivisionofthePublicWorksDepartmentinconjunctionwithitswaterreservoirproject.TheCityandRRFAcollaboratedinthedesignofFireStation15,includingtheSiteSequencingPlan.C.CityCosts.1.TheCitywillinitiallypaythecostsofdevelopingFireStation15,includingbutnotlimitedtoallplanning,site,groundwork,andbuildingcostsincludingsurvey,design,permit,constructionandanyassociatedactivitiesrequiredtobringthestationtooperationalstatusandsuchthatFireStation15andthesubdividedportionofthepropertymaybetransferredtotheRRFA’sownership(“DevelopmentCosts”).ThecontemplatedDevelopmentCostsincludebutarenotlimitedtothoseitemsdescribedintheattachedExhibitC,whichisincorporatedhereinbythisreference.CostsofdevelopingthesecondphaseoftheProject,constructedaspartoftheCity’swaterreservoirprojectasdescribedaboveandgenerallydepictedasoccurringinArea2intheSiteSequencingPlan,willnotcountasDevelopmentCosts,unlessotherwisespecifiedherein.AGREEMENTCL4RIFYINGTHEPARTIEsRESPONSIBILITIESFORDEvELoPINGFIRESTATION#1502-01-2018Page2of13AGENDA ITEM #8. d) 2.TheCity’sultimateresponsibilityforDevelopmentCostsshallnotexceedthesumof$5,671,809,includingapplicablesalestax(“City’sMaximumDevelopmentCosts”).AnyDevelopmentCostsexceedingtheCity’sMaximumDevelopmentCostsshallbereimbursedbytheRRFAassetforthherein.TheCityshallusereasonableeffortstoobtainRRFAinputpriortomakingdecisionsthatgenerateRRFACosts.IfthetotalDevelopmentCostsarelessthantheCity’sMaximumDevelopmentCosts,theCityshallretainsuchsavingsandtheCityhasnoobligationtosharethosesavingswiththeRRFA.3.TheRRFAshallhavetherighttoattendallregularlyscheduledconstructionmeetings.TheCityshallnotifytheRRFArepresentativebyemailofanynon-regularlyscheduledmeetingsatwhichchangestotheplansaretobediscussedsothatRRFApersonnelhaveanopportunitytoattendsuchmeetings.4.SeparatefromDevelopmentCosts,theCitywillpayuptoonemilliondollars($1,000,000),includingapplicablesalestax,tofurnishandequipFireStation15(“City’sMaximumFurnishingCosts”).TheCity’spaymentmaybethroughdirectpurchasesorreimbursementtotheRRFA.FurnishingsshallbeselectedorapprovedinwritinginadvancebytheRRFAandmayincludefurniture,fixtures,orotherequipmenttobeusedinFireStation15(“FF&E”).ThecontemplatedFF&ECostsincludebutarenotlimitedtothosedescribedintheattachedExhibitC.5.IfthetotalFF&EcostsarelessthantheCity’sMaximumFurnishingCosts,theCityshallremittheremainderofthe$1,000,000toRRFA.TheCitywillnotpayfororadvanceanyfurnishingcoststhatcumulativelyexceedtheCity’sMaximumFurnishingCosts.D.RRFACosts.1.Exceptforasotherwiseprovidedherein,theRRFAagreestopayfororreimbursetheCityforallDevelopmentCoststhatexceedtheCity’sMaximumDevelopmentCosts.ThisspecificallyincludesanyDevelopmentCoststhatariseoutofchangeordersorotherDevelopmentCoststhatmayhavebeenunexpectedorunplannedatthetimeFireStationwasdesignedorputoutforbid.AsDevelopmentCostsareincurredthatexceedtheCity’sMaximumDevelopmentCosts,theCitywillinvoicetheRRFAandtheRRFAwillpaysuchinvoiceswithin45daysofreceipt.2.TheRRFAissolelyresponsibleforallFF&EcoststhatexceedtheCity’sMaximumFurnishingCosts.E.SharedDevelopmentCosts1.Thecostofparkinglotlightfixturesthatwillbepurchasedaspartofthephase1CommunityServicesProjectandinstalledbythewaterutilityaspartofitsprojectshallbechargeableasDevelopmentCostsforpurposesofdeterminingtheCity’sMaximumAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page3of13AGENDA ITEM #8. d) DevelopmentCosts.However,installationofsuchlightingshallnotbechargeableasDevelopmentCosts.2.AnycostsaddedtotheCitywaterutility’sreservoirprojectattherequestoftheRRFAorforthesolebenefitoftheRRFA,beyondthescopeoftheCity’sprojectsiteplansfortheprojectassetforthinattachedExhibitB,shallbepaidforbytheRRFA,within45daysofreceiptofinvoicefromtheCity,unlessotherwiseagreedbytheparties.E.PropertyTransferandOccupation.1.TheCitywilltransfertitletoFireStation15andtheunderlyingsubdividedpropertyonlyafterallCitycostsexceedingtheCity’sMaximumCostsarereimbursedandthepropertyhasbeensubdivided.2.UponcompletionofthefirstphaseoftheProject,theCityintendstoprovidetheRRFAatemporarylicensetooccupyFireStation15providedatemporaryoccupancypermithasbeenissuedandtheRRFAiscurrentonallreimbursementobligationsherein.TheRRFAwillberesponsibleforinsuringFireStation15andallcontentsthereinuponitbeinggivenalicensetooccupythestation.Duringthetemporarylicenseperiod,theRRFAwillnothaveaccesstoArea2intheSiteSequencingPlan.TheCitywillcoordinatewiththeRRFAtoprovideagreedtemporaryparkingsolutions,whichmayincludeaddingdedicatedon-streetparking,andmodifyingthepreviouslyapproveddevelopmentplanstodelayonsitelandscapingandconstructtemporaryparkinginplaceofsuchlandscaping.Costsincurredtoprovideagreedtemporaryparkingsolutionsandrestoration/installationoflandscapinginplaceoftemporaryparkingshallcounttowardstheCity’sMaximumCosts.Citywillpayforthecostofsuchagreedtemporaryparkingsolutionsupto,butnottoexceed,theCity’sMaximumDevelopmentCosts.3.TheCityintendstotransferownershipofFireStation15totheRRFAaftertheProjectandtheCity’scoordinatedwaterreservoirprojectiscompleteandthePropertyhasbeensubdivided.TransferofownershiptotheRRFAshallbebyquitclaimdeedwithnowarrantiesandwitheasementsreserved,orjointownershipagreementsnegotiated,asnecessarytosupporttheRRFAandCity’scontinuedcoordinatedjointuseofArea2,aslabeledintheSiteSequencingPlan.AsaconditionofpropertytransferandupontheRRFA’sacceptanceoftheproperty,theRRFAwillreleasetheCityfromallongoingliabilityandresponsibilitytoRRFAwithrespecttothedevelopmentofFireStation15ortheongoingmaintenancethereof.4.TheRRFAmaychoosetoobtainandpayforabuyers’titlepolicypriortoacceptingtransferoftheproperty.5.TheCityagreestocleantheexteriorofStation15attheconclusionofthePhase2attheCity’scost.AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page4of13AGENDA ITEM #8. d) Ill.GENERALTERMSA.ThisAgreementmayonlybeamendedinwriting,andanyamendmentshallbecomeeffectiveonlywhenthegoverningbodyofeachpartyhasapprovedawrittenamendmentoraddendumtothisAgreement.B.ThisAgreementshallremainineffectuntilallprojectsarecomplete,thesubdivisionofthepropertyisfinalized,andtheCityhastransferownershipofFireStation15andpropertywitheasementstoRRFAwithfullRRFAreleasetotheCity,andtheRRFAhasfullypaidforanycostsdueandowingtotheCity.C.TimeisoftheessenceforeachandallofthisAgreement’sprovisionsinwhichperformanceisafactor.D.IfeitherpattyfailstoreimbursetheotherpartybythetimerequiredinthisAgreement,interestontheoverdueamountsshallaccrueandbepaidatarateof2.5%perannum.E.Eachpartyagreestocomplywithalllocal,federal,andstatelaws,rules,andregulationsthatarenoweffectiveorinthefuturebecomeapplicabletothisAgreement.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.Nolawsuitmaybefileduntilthecomplainingprovidesnolessthan60dayswrittennoticeofitsintenttofilealawsuitandonlyafterattemptingingoodfaithtonegotiatearesolutionandallowtheotherpartytocuretheperceiveddefauIt.F.ThefailureofeitherpartytoinsistuponstrictperformanceofanyofthecovenantsandagreementscontainedinthisAgreement,ortoexerciseanyoptionconferredbythisAgreementinoneormoreinstancesshallnotbeconstruedtobeawaiverorrelinquishmentofthosecovenants,agreements,oroptions,andthesameshallbeandremaininfullforceandeffect.G.IfanysectionofthisAgreementisadjudicatedtobeinvalid,suchactionshallnotaffectthevalidityofanysectionnotsoadjudicated.H.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.AGREEMENTCIRIFvINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page5of13AGENDA ITEM #8. d) IV.INDEMNIFICATIONANDHOLDHARMLESS/INSURANCEA.Eachpartyagreestodefend,indemnify,andholdharmlesstheotherpartyandeachofitsemployees,officials,agents,andvolunteersfromanyandalllosses,claims,liabilities,lawsuits,orlegaljudgmentsarisingoutofitsbreachofthis’Agreementoranynegligentorwillfullytortiousactionsorinactionsbytheperformingpartyoranyofitsemployees,officials,agents,orvolunteers,whileactingwithinthescopeofthedutiesrequiredbythisAgreement.ThisprovisionshallsurvivetheexpirationofthisAgreement.ThisprovisionshallalsosurviveandremainineffectintheeventthatacourtorotherentitywithjurisdictiondeterminesthatthisAgreementoranyportionthereofisnotenforceable.B.Itisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedhereinconstituteseachparty’swaiverofimmunityunderindustrialinsurance,Title51RCW,solelytocarryoutthepurposesofthisindemnificationclause.Thepartiesfurtheracknowledgethattheyhavemutuallynegotiatedthiswaiver.C.Insurance.Eachpartyshallcarryandmaintaininsurancecoverageasdescribedbelow.CoveragesshallbewrittenwithaninsurancecarrieradmittedintheStateofWashington.General.Automobile,andDirector&OfficerLiabilityInsurance:Coveragefordamagescausedresultinginpersonalinjury,propertydamageoradvertisingliabilityshallbeprovided.Coverageshallbeinanamountnotlessthanfivemilliondollars($5,000,000)perOccurrence.Theinsurancepoliciesofeachpartyshallnametheotherpartyanditsofficials,officers,employees,andvolunteers,whoareactingwithinthescopeofthisAgreementasadditionalinsuredsforanyandallactionstakenbyeachparty,itsofficials,officers,employees,andvolunteersinthescopeoftheirdutiespursuanttothisAgreement.V.NOTICEAllcommunications,includingnotices,regardingthisAgreementshallbesenttotheParties’representativesattheaddresseslistedbelow:TheCity’srepresentativeshallbeandnoticesshallbesentto:RobertHarrison,ChiefAdministrativeOfficer1055GradyAvenueSouthRenton,WA98057425.430.6500TheRRFA’srepresentativeshallbeandnoticesshallbesentto:FireChief24611116thAveSE.AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page6of13AGENDA ITEM #8. d) Renton,WA98030425.430.7000Anywrittennoticeshallbecomeeffectiveupon(a)personalserviceor(b)three(3)businessdaysafterthedateofmailingbyregisteredorcertifiedmailandfirst-classmail,andshallbedeemedsufficientlygivenifsenttotheaddressstatedinthisAgreement,ortosuchotheraddressasmaybespecifiedinwritingbyaparty.Eitherpartymaychangeitsrepresentativesbynotifyingtheotherinwriting.XII.ENTIREAGREEMENTThePartiesagreethatthisAgreementisthecompleteexpressionofthetermsheretoandanyoralrepresentationsorunderstandingsnotincorporatedhereinareexcluded.BothPartiesrecognizethattimeisoftheessenceintheperformanceoftheprovisionsofthisAgreement.Waiverofanydefaultshallnotbedeemedtobeawaiverofanysubsequentdefault.XIII.COUNTERPARTSThisAgreementmaybeexecutedinoneormorecounterparts,eachofwhichshallbedeemedanoriginal,butallofwhichtogethershallconstituteoneandthesameinstrument.INWITNESS,thePartiesbelowexecutethisAgreement,whichshallbecomeeffectiveonthelastdateenteredbelow.RENTONREGIONALFIREAUTHORITYBy:Its:FireChiefDated:APPROVEDASTOFORM:BrianSnureAttorneyforRRFAAGREEMENTCLARIFYINGTHEPARTIESRESPoNSIBILITIEsFORDEvELoPINGFIRESTATION#1502-01-2018Page7of13AGENDA ITEM #8. d) CITYOFRENTONBy:DenisLawIts:MayorDated:_________AttestJasonSethRentonCityClerkAPPROVEDASTOFORM:ShaneMoloney,CityAttorneyAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page8Of13AGENDA ITEM #8. d) EXHIBITALEGALDESCRIPTION(OFENTIREPROPERTY)TRACT38OFHILLMAN’SLAKEWASHINGTONGARDENOFEDENADDITIONTOSEATTLENO.1,ACCORDINGTOTHEPLATTHEREOFRECORDEDINVOLUME11OFPLATS,PAGE63,RECORDSOFKINGCOUNTY,WASHINGTON;EXCEPTTHEEAST100FEETTHEREOF;SITUATEINTHECITYOFRENTON,COUNTYOFKING,STATEOFWASHINGTONKingCountyAssessor’sTaxParcelNo.3342103245AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page9of13AGENDA ITEM #8. d) EXHIBITB1.Constructionlimits,spotelevations,gradesandsiteutilitiesindicatedforreferenceonlySeeCivildrawings2.Pavingindicatedforreferenceonly.SeeCivilandLandscapedrawings.3.RefertoCivildrawingsforpavementscoringpattems&requirements.ProvideexpansionandcontroljointsperCivilplans4.Landscapingindicatedforreferenceonly.SeeLandscapedrawings.5.Electricalsiteutilitiesdescribedforreferenceonly.SeeElectricaldrawings.6.ComplywithCilyofRentonrequirementsforallWorkinROW.7.Provideconstructionfenceatlimitsofconstructiontosecuresite.Minimumfenceheightshallbesicfeet.Providegatesasnecessary.6.FieldverifyallrelevantexistingconditionsanddimensionspriortothestartofWorfc.NotifyArchitectimmediatelyofanydiscrepancies.9.ProtectallexistingconditionstoremainonsiteandadjacenttoWorkarea.NotifyArchitectofanydamagetoexistingcondtionstoremainandrestoreorreplacetooriginalcondition10.ConfirmallundergroundutilitylocationspriortothestartofWorkandprotectallexistingconditionstoremain.11.Confirmlocationsofadjacentoverheadutilitesandprotectallexistingconditionstoremain.12.Coordinatesequencingwithdrawingsfromalltrades.AllworkshowninArea1isinthecontractRefertoeachtradeforworkinArea2thatisinthecontract.NoworkinArea3isinthecontract.RESERVOIRIL3IEOEHETLPE0CLTE‘FivEFiOHTRpeoprnnPruriNo1Lil.5TOP—I‘A1C2,•r”mA’,PARCEL,iiFiRE/ryEAlTl.Cl—‘3342103245TruvIZONE:CNI-‘.Ai6T.IENCLCVSVEII‘CIR1NlI.sIvrvovwsa)‘rnEpiGxInp,—‘vourvvsov.1Esrn,,j,_..•/II/(Frvnn.jurovwsnsnTve’—,“JI/iAM1U.J:LiNEiZANE‘El//,————NIIrvrv.SEE3-.covcvrrrwNiNTEsvNcrCIViLAl02.uneiPvsEviLsisoIrrvivoorn.norCIVIL————BFIRESTATION15—vrwrovcrCovCvErEI—FrELEVATIA5212e=e-n’‘4pvoprvnyovennsr-ILINEAITINiELECTRICALMETERI••PvTIOvEEELECT-,I\0-0CONCRETELOCATEEUILEINOAT/PAD.SEECIVIL‘IAvIDivnrvsrCniovIir—-FENCEI..-A102O7OEECIAIL——,IN/ACCESS—SASMETER.—L6.SEEiS/A102—_i_.rvvvoo—souIEISSLSE_________tt;E11/=_j______/EDERACK57-----iE4voAownErmoNSlOELXwvroevnrcen-—“I____________FIREHASRANTr:/--WlCSRARRANATSOATH-SPAIN.PROPERTYLI5ESEECIVILROWCL0NORTH30THSTREETCientPmjectNn:CAC-17-046SiteSequencingPlanNFKjiJSoals:l”=20’-O’1SitePlanNAl.0lSCab1’=20-0’SSWArchfteots17001PlsleofNoDateDecnmber22,2017A1.O1Inn,-113/4’SiteNoteslW-II3/4”111ARCHITECTSSCHREIBERSTARLINGWHITEHEAD901FIFTHAVEA3l0OSEATTLE,WA90164206-602-0300SSWARCHITECTS(OHi=-.SitePlanLegend4199SJSflDOJIhwonian—.—PROPERTYLINEE.EXISTINGTOPOLINES-SEESURVEYUTILITIES-SEECIVILNON-PERMEABLECONCRETEPAVING-SEECIVILFPERMEABLECONCRETEPAVING-SEECIVILFJASPHALTPAVING-SEECIVILSiteSequencingPlanLegendAREASEPARATIONLINESAREA1:FIRESTATION15AREAOFWORKAREA2:WORKSCOPESHAREDBETWEENFIRESTATION15&RESERVOIRAREA3:(NIC)RESERVOIRPROJECT1-NORTH30THSTREET:.Wi.FireStation15ContractDocumentsSitePlansAGENDA ITEM #8. d) EXHIBITC1.ExamplesofDevelopmentCostsAttributabletowardstheCity’sMaximumDevelopmentCosts($5,671,809total)ProfessionalServices:ArchitectCivilEngineerLandscapeArchitectCostEstimatingSignageCommissioningMiscellaneous:LandUsePermittingMeetingsandPresentationsConstructionAdministrationSiteStructuralGeotechnica)RecordDrawingsReimbursableExpensesTestingandInspectionsOtherDevelopmentCosts:ConstructionHVACandotherfixturesnecessarytooperatebuildingProjectManagement(includingCitystaffassignedtoproject)PublicArtPermits,BuildingPermits,CivilPlanCheckPrintingInstalledSignageProjectredesignandconstructionrelatedtoaccommodationoftemporaryparkingduringPhase2Miscellaneousinstalleditems:DishwasherRangeHoodRangeCompressorFireExtinguishersFireExtinguisherCabinetsAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEvELoPINGFIRESTATION#15O2-O12O18Page110113AGENDA ITEM #8. d) GarbageDisposalHoseReelsMarkerboardsRollerShadesSoapDispensersTackboardsWaterHeaterWallMirrorParkinglotlightfixtures2.ExamplesofFF&E:($1,000,000total)Furniture:TablesChairsCouchesBeds/rnattressesDressersTelevisionsLampsAppliances:Washingmachine/dryerRefrigeratorMicrowaveDryerCabinet,GearExtractorFireproofCabinetHoseDryingRackPull-UpBarSoapContainerIThardwarethatisnotfixedtothebuilding:*ComputersMonitorsPrintersTelephonesRacksServersSwitchesAlertingAGREEMENTCRIFvINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page12of13AGENDA ITEM #8. d) *Note:ITServicesforRRFAarecurrentlycoveredunderILACAG-16-116betweentheCityandtheRRFA,Exhibit2,section4.b.“UniqueSupportServiceRequests”andsection5.“AdditionalStaffServiceCost.”litheRRFAisgoingtorequireITservicesandsupportforFS15therewillbeadditionalsupportandservicescoststhatwillneedtobeaddressedinILACAG-16-116andnotaspartofthe“project”costassociatedwiththisagreement.Fitnessequipmentincludinganycostsassociatedwithdedicatedcircuitelectricalrequirements.AEDequipmentforthefacility.Smoke&carbonmonoxidedetectors.FireEngine/truck.AGREEMENTCRIFvINGTHEPARTIESREsPoNsIBILITIEsFORDEVELOPINGFIRESTATION#1502-01-2018Page13of13AGENDA ITEM #8. d) AB - 2201 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Ratification of the Second Addendum to the Indemnification Agreement CAG-18-150 with The Boeing Company for Occupation of a Portion of the Renton Municipal Airport’s Taxiway “B” RECOMMENDED ACTION: Council Concur DEPARTMENT: Public Works Administration STAFF CONTACT: Gregg Zimmerman, Public Works Department Administrator EXT.: 7311 FISCAL IMPACT SUMMARY: Approval of the Second Addendum to the Indemnification Agreement CAG-18-150 with The Boeing Company has no fiscal impact. Should Boeing exercise the portion of the Second Addendum permitting expanded operating hours of the Airport tower, Boeing will reimburse the city and Federal Aviation Administration (FAA) for any costs incurred to extend the tower’s operating hours. SUMMARY OF ACTION: On August 6, 2018 Council ratified the City's Indemnification Agreement CAG -18-150 and the First Addendum to the agreement with The Boeing Company. The agreement allows Boeing to occupy a portion of the Renton Municipal Airport’s Taxiway “B” for airplane storage for up to 90 days. The First Addendum to the agreement outlines parameters to allow Boeing personnel to provide appropriate security on Taxiway “B” at times during which airplanes are stored on the taxiway. After entry into the agreement and first addendum, the parties identified and negotiated additional terms to facilitate administration of the agreement. Subject to objection by the FAA or air traffic control, the attached Second Addendum to the Indemnification Agreement authorizes Boeing’s 737 airplanes to depart from the Airport without the need or requirement to move its parked airplanes. The Second Addendum establishes additional criteria regarding the temporary closure and utilization by Boeing of a portion of Taxiway “B.” Key provisions of the Second Addendum include: 1. Substitution of Exhibit A with Exhibit A-1, providing an updated layout of the affected area and parking positions. 2. Detailed criteria for departures and arrivals of Boeing and other aircraft while airplanes are parked on the taxiway. 3. Acknowledgment of potential closure of the runway to aircraft with a wingspan exceeding 79 feet or approach speeds greater than 120 knots when the Airport tower is not staffed. 4. The city will provide Boeing at least 115 minutes notice that tenants or transient operators will depart or land aircraft with a wingspan exceeding 79 feet or approach speeds greater than 120 knots. Boeing will move parked aircraft and equipment outside of the runway object free area before departure or landing of the aircraft. AGENDA ITEM #8. e) 5. Boeing will install steel plates under 737 airplanes parked on the taxiway to minimize or avoid damage to the asphalt, and the parties will exchange pre-use assessments of the pavement's condition to assure Boeing pays for any damage arising out of its use. 6. Boeing will participate in one or more public open house meetings for airport tenants, subtenants and anyone with an Airport interest to discuss the Taxiway “B” closure. Boeing will coordinate with the City through a formal complaint process to accommodate other airport users that are affected by the taxiway closure. The Addendum also provides that if the FAA recommends or requires the hours of the air traffic control tower to be expanded as a result of the taxiway closure, Boeing will pa y the costs of the extended hours. EXHIBITS: A. Second Addendum to Indemnification Agreement CAG-18-150 B. Layout of Airport with Taxiway Parking and B1s (Labeled as Exhibit A -1) STAFF RECOMMENDATION: Ratify the Second Addendum to the Indemnification Agreement CAG-18-150 with The Boeing Company. AGENDA ITEM #8. e) SECONDADDENDUMTOINDEMNIFICATIONAGREEMENTTHISSECONDADDENDUM(‘Addendum’),madeonthelastdatewrittenbelow,amendstheIndemnificationAgreementmadebyandbetweenTheBoeingCompany,aDelawarecorporation(‘Boeing),andCityofRenton,aWashingtonmunicipalcorporation(“Renton”),datedJuly27,2018(asamendedbytheFirstAddendum,the‘Agreement”).Forandinconsiderationofthemutualbenefitstobederivedandothervaluableconsiderationthesufficiencyofwhichisherebyacknowledged,thepartiesherebyagreeasfollows.1.ExhibitAtotheAgreementshallbereplacedwithExhibitA-I,attachedandincorporatedbythisreference.2.TheAgreement’sdefinitionofthe“Property”isherebyamendedtomeanthatportionofTaxiway“B”locatedattheRentonMunicipalAirportdepictedinExhibitA-i.3.SubjecttoobjectionbytheFAAortheFAAcontractedAirporttowerpersonnel,BoeingaircraftareauthorizedtodepartfromtheAirportwithouttheneedorrequirementforBoeingtomoveanyofits737aircraftparkedwithintheRunwayObjectFreeAreaontheProperty.BoeingacknowledgesthattheAirporttowermaynotformally“clear”BoeingaircraftfortakeoffundersuchconditionsandthatBoeinganditspilotswilldeparttheAirportattheirownrisk.NotwithstandingtheexpectationthatBoeingaircraftmaydeparttheAirportwhileitsownafrcraftareparkedwithintheRunwayObjectFreeAreaatitsonrisk,pilotsofBoeingaircraft)illcommunicatewiththetowerandfollowallinstructionsand1ordersissuedbyAirporttowerand/orAirportmanagement.4.BoeingunderstandsthatRentonmayclosetheAirportrunwaytoaircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots,includingBoeingaircraft,duringhoursinwhichtheAirporttowerisnotstaffed.IftheFAArequiresorrecommendsexpandedtowerhoursinordertoavoidorminimizerunwayclosurestoaircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots,Boeingagreestocontractwiththetowermanagementcompany(SercoInc.)topaythecostofsuchexpandedoperationand/orreimbursetheCityandFAAforanycoststhoseentitiesincurtoextendthetower’soperatinghours.5.BoeingwillmoveallofitsaircraftandotherpropertyandequipmentparkedonthePropertyoutoftheRunwayObjectFreeAreapriortoitlandingBoeing737sorotheraircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots.6.RentonwillprovideBoeingatleast115minutes’noticethattenantsortransientoperatorswilldepartorlandaircraftwithawingspanlargerthan79feetoranapproachspeedgreaterthan120knotsattheAirport.BoeingwillprovideRentonadesignatedmonitoredphonenumbertoprovidesuchnotificationswithaworkingvoicemailforRentontoleaveamessageifthephoneisnotanswered.Renton’sleavingsuchmessageormakingdirectcontactwithBoeingpersonnelwhoanswerthatnumberwillinitiatethenoticeperiod.Boeingwill,withinthenoticeperiod,temporarilyremoveitsparkedaircraftandotherpropertyoutofthe400footRunwayObjectRentonMunicipalAirport-TheBoeingCompany-SecondAddendumtoIndemnIficationAgreement—Page1AGENDA ITEM #8. e) FreeAreatoaccommodatesuchtenantsortransientoperators.BoeingunderstandsthatitsfailuretotimelymoveitsaircraftoutoftheRunwayObjectFreeAreamaydelayorpreventaircraftfromdepartingorarrivingandcreateahazardforenrouteaircraft.Accordingly,intheeventofBoeing’sfailuretotimelyremoveparkedaircraft,Boeing’srighttoparkaircraftonthePropertyshallbeimmediatelysuspendeduntilBoeinghasassuredRentonthefailurewillnotberepeatedandRentongiveswrittenauthorizationtoBoeingforittoresumeparkingaircraftontheProperty.7.Paragraph1(d)oftheAgreementisamendedtoreadasfollows:“Boeingagreestotemporarilyinstallsteelplatesunder737aircraftparkedontheProperty,inorderminimizeimpactstothetaxiwaysurface.BoeingshallnotmakeanyotherimprovementsoralterationstothePropertywithoutwrittenauthorizationfromRenton.Priortoinstallingsuchplates,BoeingshallchalkofftheareasaircraftwillbeparkedandallowRentonanopportunitytoinspecttheconditionoftheexistingpavementconditions.BoeingandRentonshalleachprovidetotheotheracopyofallinformationeachhasorobtainsabouttheProperty’spavementconditions.BoeingshallholdRentonandthePropertyharmlessfromandagainstanyliensofcontractors,subcontractors,orotherpersonssupplyinggoods,services,equipment,materials,orlabortooronbehalfofBoeingattheProperty.AttherequestofRenton,Boeingshalldischargeanysuchliens.”8.Paragraph2oftheFirstAddendumtotheAgreementisamendedtoreadasfollows:“BoeingacknowledesthatanypersonsonthePropertymaybewithintheRunwayObjectFreeAreaandwhatwoulcotherwisebeadesignatedmovementareaifthetaxiwaywaslnotclosed.Accordingly,allpersonnelandoperatorsofnon-pilotedvehiclesshallmonitortheairtrafficcontrolgroundcontrolfrequencyandremainwithinanybarriersmarkingtheclosedareaofthetaxiway.AnypilotorotherpersonnelwishingtoexittheclosedareaofthetaxiwayandenteranactivemovementareaoftheAirportshallcoordinatewithairtrafficcontrolandmonitorradioforairtraffic.Boeingshalltrainandcontrolallpersonnelandvehiclestocomplywiththerequirementsofthisparagraph.9.Boeingwillparticipateinoneormorepublicopen-housemeetingsforAirporttenants,subtenants,transientoperators,andanyonewithanAirportinterest,tobeco-hostedbytheCityofRenton,Boeing,andtheAirporttowertodiscussAirportTaxiwayBclosure.Rentonwillcreateaformalcomplaintsubmittalprocess.RentonmaytenderanycomplaintsreceivedtoBoeing,atRenton’ssolediscretion.BoeingwillprovideawritteninitialresponsetoRentonwithinonebusinessdayofreceiptofeachtenderedcomplaintwithanestimateofwhenaformalresponsewillbeprovided;BoeingwillprovideawrittenformalresponsetoRentonwithin10daysofreceiptofeachtenderedcomplaint.Inadditiontoprovidingaresponse,BoeingwillreasonablyandexpedientlyaccommodatelegitimateconcernsraisedineachtenderedcomplainttotheextentsuchcomplaintsarisefromBoeing’suseoftheProperty.BoeingwillprovideaplantoRentonforeachplannedaccommodationandwillnotifyRentonifBoeingdeclinestoaccommodateonthebasisthataccommodationwouldnotbereasonableorthattheconcernisnotlegitimateorboth.TheprovisionsofthisparagraphareintendedtosupplementtheindemnificationprovisionsoftheAgreementandshallnotbeconstruedtolimitRentonMurncipalAirport-TheBoeingCompany.SecondAddendumtondemnfcationAgreement—Page2AGENDA ITEM #8. e) inanywaysuchindemnificationprovisions.10.BoeingshallpaytoRentontheleaseholdexcisetaxasestablishedbyRCWchapter82.29A,asamended,oranyreplacementthereof,whichtaxshallbeinadditiontothemonthlyfeesetforthinSection3oftheAgreementandotherchargespayableundertheAgreementandshallbepaidatthesametimethemonthlyfeeisdue.IftheStateofWashingtonoranyothergovernmentalauthorityhavingjurisdictionthereovershallhereafterlevyorimposeanysimilartaxorchargeonthisAgreementortheProperty,thenBoeingshallpaysuchtaxorchargewhendue.SuchtaxorchargeshallbeinadditiontothemonthlyfeeandotherchargespayableundertheAgreement.AsmodifiedbythisAddendum,theAgreementcontinuesinfullforceandeffect.ThisAddendumisexecutedbyBoeingandRentonasofthedateswrittenbelow.TheBoeingCompanyCityofRentonBy:_______________By:___________________________JeffreyNunnDenisLawItsDirectorofPlanning&ealEstateItsMayorDateSigned:/iô)iSDateSigned:____________________Attest:__________________________________JasonSeth,CityClerkApprovedastoForm:____________________ShaneMoloney,CityAttorneyRentonMuncipoIAirport-ToeBoeingcompanySecondAddendumtoIndemnificationAgreement—Page3AGENDA ITEM #8. e) inanywaysuchindemnificationprovisions.10.BoeingshallpaytoRentontheleaseholdexcisetaxasestablishedbyRCWchapter82.29A,asamended,oranyreplacementthereof,whichtaxshallbeinadditiontothemonthlyfeesetforthInSection3oftheAgreementandotherchargespayableundertheAgreementandshallbepaidatthesametimethemonthlyfeeIsdue.IftheStateofWashingtonoranyothergovernmentalauthorityhavingjurisdictionthereovershallhereafterlevyorimposeanysimilartaxorchargeonthisAgreementortheProperty,thenBoeingshallpaysuchtaxorchargewhendue.SuchtaxorchargeshallbeinadditiontothemonthlyfeeandotherchargespayableundertheAgreement.AsmodifiedbythisAddendum,theAgreementcontinuesInfuilforceandeffect.ThisAddendumIsexecutedbyBoeingandRentonasofthedateswrittenbelow.TheBoeingCompanyCityaRenonBy:_________________By:JeffreyNunnDenisLawItsDirectorofPlanning&RealEstateItsMayorDateSigned:_____________DateSigned:_________________Attest:sonSeth,CityClerkApprovedastoForm:ShaneMoloney,CityAttorneyReritonMunIcipiAirport-TheBoeingCompany.SecondAddendumtoIndemnificationAgreement—Page3AGENDA ITEM #8. e) Supply Chain &Operations Facilities &Asset Management Proposed Process:Exhibit A-i Layout of Airport wI Taxiway Parking &BI ‘s Taxiway Barrier ____ I Taxiway B limited to fourTaxiwayParkingPositionI1TaxiwayFireLaneparkingpositions,to I I Runway Area support clearing taxiway Standard Parking Position _____ within two hours I I Hold Short Line (Includes Solid Red Line) -- —-v-’-__ __ 4•_A --A A - ‘/TiAA _— - - D — -‘—r .-- Data Owner Data as of 0811012018Copyntht‘Rong AI ights t1 AGENDA ITEM #8. e) AB - 2196 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Agreement with Northwest Hydraulic Consultants, Inc. for the Annual Cedar River Sediment Survey and Analysis RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: Utility Systems Division STAFF CONTACT: Joseph Farah, Surface Water Utility Engineer EXT.: 7205 FISCAL IMPACT SUMMARY: The Cedar River Gravel Removal Project and all subsequent post-dredging mitigation, monitoring and reporting work, including sediment surveying and monitoring, are entirely funded by the King County Flood Control District Capital Improvement Project budget ($13,171,131) per CAG-13-009 Addendum #1-16. The adjusted 2018 project budget is $3,197,816. There is sufficient funding in the 2018 Surfac e Water Utility Capital Improvement Program budget (427.475193) for the agreement. SUMMARY OF ACTION: In 2016, the Surface Water Utility completed maintenance dredging of the lower 1.25 miles of the Cedar River, from the mouth at Lake Washington to the Williams Avenue South bridge. Ongoing sediment deposition along the lower river gradually reduces conveyance capacity and reduces flood protection over time. As part of the city’s agreement with the U.S. Army Corps of Engineers (following construction of t he levees and floodwalls and the initial dredging project in 1998) the city is responsible for monitoring sediment levels in order to: • Understand and characterize deposition rates throughout a dredging cycle. • Evaluate how close the river bed is getting to the “maximum bed profile,” and if reached, would require a new maintenance dredge project. • Determine the flow based upon which Boeing would need to raise the South Boeing Bridge. This flow is updated annually and a new rating curve is established and sent to Boeing. The Surface Water Utility evaluated the statements of qualifications of 10 consultant firms on the Municipal Research and Services Center (MRSC) roster that offered services in basin modeling hydrology and hydraulics, sediment investigation and analysis and stream sediment and substrate analyses. Northwest Hydraulic Consultants, Inc. scored the highest and was selected to perform the sediment survey and analysis from 2018 to 2022. EXHIBITS: A. Agreement STAFF RECOMMENDATION: Execute the agreement with Northwest Hydraulic Consultants, Inc. in the amount of $132,377 for the Annual Cedar River Sediment Survey and Analysis. AGENDA ITEM #8. f) THISAGREEMENT,datedJuly27,2018,isbyandbetweentheCityofRenton(the“City”),aWashingtonmunicipalcorporation,andNorthwestHydraulicConsultants(“Consultant”),aWashingtoncorporation.TheCityandtheConsultantarereferredtocollectivelyinthisAgreementasthe“Parties.”OncefullyexecutedbytheParties,thisAgreementiseffectiveasofthelastdatesignedbybothparties.1.ScopeofWork:Consultantagreestoprovidesurveying,hydraulicmodeling,andreportingasspecifiedinExhibitA,whichisattachedandincorporatedhereinandmayhereinafterbereferredtoasthe“Work.”2.ChangesinScopeofWork:TheCity,withoutinvalidatingthisAgreement,mayorderchangestotheWorkconsistingofadditions,deletionsormodifications.AnysuchchangestotheWorkshallbeorderedbytheCityinwritingandtheCompensationshallbeequitablyadjustedconsistentwiththeratessetforthinExhibitBorasotherwisemutuallyagreedbytheParties.3.TimeofPerformance:ConsultantshallcommenceperformanceoftheAgreementpursuanttotheschedule(s)setforthinExhibitC.AllWorkshallbeperformedbynolaterthanMarch31,2023.4.Compensation:A.Amount.TotalcompensationtoConsultantforWorkprovidedpursuanttothisAgreementshallnotexceed$132,377,plusanyapplicablestateandlocalsalestaxes.CompensationshallbepaidbaseduponWorkactuallyperformedaccordingtotherate(s)oramountsspecifiedinExhibitB.TheConsultantagreesthatanyhourlyorflatratechargedbyitforitsWorkshallremainlockedatthenegotiatedrate(s)unlessotherwiseagreedtoinwritingorprovidedinExhibitB.Exceptasspecificallyprovidedherein,theConsultantshallbesolelyresponsibleforpaymentofanytaxesimposedasaresultoftheperformanceandpaymentofthisAgreement.B.MethodofPayment.OnamonthlyornolessthanquarterlybasisduringanyquarterinwhichWorkisperformed,theConsultantshallsubmitavoucherorinvoiceinaformspecifiedbytheCity,includingadescriptionofwhatWorkhasbeenAGREEMENTFORANNUALCEDARRIVERSEDIMENTSURVEYANDANALYSISAGENDA ITEM #8. f) performed,thenameofthepersonnelperformingsuchWork,andanyhourlylaborchargerateforsuchpersonnel.TheConsultantshallalsosubmitafinalbilluponcompletionofallWork.PaymentshallbemadebytheCityforWorkperformedwithinthirty(30)calendardaysafterreceiptandapprovalbytheappropriateCityrepresentativeofthevoucherorinvoice.IftheConsultant’sperformancedoesnotmeettherequirementsofthisAgreement,theConsultantwillcorrectormodifyitsperformancetocomplywiththeAgreement.TheCitymaywithholdpaymentforworkthatdoesnotmeettherequirementsofthisAgreement.C.EffectofPayment.PaymentforanypartoftheWorkshallnotconstituteawaiverbytheCityofanyremediesitmayhaveagainsttheConsultantforfailureoftheConsultanttoperformtheWorkorforanybreachofthisAgreementbytheConsultant.D.Non-AppropriationofFunds.IfsufficientfundsarenotappropriatedorallocatedforpaymentunderthisAgreementforanyfuturefiscalperiod,theCityshallnotbeobligatedtomakepaymentsforWorkoramountsincurredaftertheendofthecurrentfiscalperiod,andthisAgreementwillterminateuponthecompletionofallremainingWorkforwhichfundsareallocated.NopenaltyorexpenseshallaccruetotheCityintheeventthisprovisionapplies.5.Termination:A.TheCityreservestherighttoterminatethisAgreementatanytime,withorwithoutcausebygivingten(10)calendardays’noticetotheConsultantinwriting.Intheeventofsuchterminationorsuspension,allfinishedorunfinisheddocuments,data,studies,worksheets,modelsandreports,orothermaterialpreparedbytheConsultantpursuanttothisAgreementshallbesubmittedtotheCity,ifanyarerequiredaspartoftheWork.B.IntheeventthisAgreementisterminatedbytheCity,theConsultantshallbeentitledtopaymentforallhoursworkedtotheeffectivedateoftermination,lessallpaymentspreviouslymade.IftheAgreementisterminatedbytheCityafterpartialperformanceofWorkforwhichtheagreedcompensationisafixedfee,theCityshallpaytheConsultantanequitableshareofthefixedfee.ThisprovisionshallnotpreventtheCityfromseekinganylegalremediesitmayhavefortheviolationornonperformanceofanyoftheprovisionsofthisAgreementandsuchchargesduetotheCityshallbedeductedfromthefinalpaymentduetheConsultant.NopaymentshallbemadebytheCityforanyexpensesincurredorworkdonefollowingtheeffectivedateofterminationunlessauthorizedinadvanceinwritingbytheCity.6.WarrantiesAndRightToUseWorkProduct:ConsultantrepresentsandwarrantsthatConsultantwillperformallWorkidentifiedinthisAgreementinaprofessionaland0PAGE2OF10AGENDA ITEM #8. f) workmanlikemannerandinaccordancewithallreasonableandprofessionalstandardsandlaws.Compliancewithprofessionalstandardsincludes,asapplicable,performingtheWorkincompliancewithapplicableCitystandardsorguidelines(e.g.designcriteriaandStandardPlansforRoad,BridgeandMunicipalConstruction).Professionalengineersshallcertifyengineeringplans,specifications,plats,andreports,asapplicable,pursuanttoRCW18.43.070.ConsultantfurtherrepresentsandwarrantsthatallfinalworkproductcreatedforanddeliveredtotheCitypursuanttothisAgreementshallbetheoriginalworkoftheConsultantandfreefromanyintellectualpropertyencumbrancewhichwouldrestricttheCityfromusingtheworkproduct.ConsultantgrantstotheCityanon-exclusive,perpetualrightandlicensetouse,reproduce,distribute,adapt,modify,anddisplayallfinalworkproductproducedpursuanttothisAgreement.TheCity’sorother’sadaptation,modificationoruseofthefinalworkproductsotherthanforthepurposesofthisAgreementshallbewithoutliabilitytotheConsultant.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.7.RecordMaintenance:TheConsultantshallmaintainaccountsandrecords,whichproperlyreflectalldirectandindirectcostsexpendedandWorkprovidedintheperformanceofthisAgreementandretainsuchrecordsforaslongasmayberequiredbyapplicableWashingtonStaterecordsretentionlaws,butinanyeventnolessthansixyearsaftertheterminationofthisAgreement.TheConsultantagreestoprovideaccesstoandcopiesofanyrecordsrelatedtothisAgreementasrequiredbytheCitytoauditexpendituresandchargesand/ortocomplywiththeWashingtonStatePublicRecordsAct(Chapter42.56RCW).TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.8.PublicRecordsCompliance:TothefullextenttheCitydeterminesnecessarytocomplywiththeWashingtonStatePublicRecordsAct,ConsultantshallmakeaduediligentsearchofallrecordsinitspossessionorcontrolrelatingtothisAgreementandtheWork,including,butnotlimitedto,e-mail,correspondence,notes,savedtelephonemessages,recordings,photos,ordrawingsandprovidethemtotheCityforproduction.IntheeventConsultantbelievessaidrecordsneedtobeprotectedfromdisclosure,itmay,atConsultant’sownexpense,seekjudicialprotection.Consultantshallindemnify,defend,andholdharmlesstheCityforallcosts,includingattorneys’fees,attendanttoanyclaimorlitigationrelatedtoaPublicRecordsActrequestforwhichConsultanthasresponsiverecordsandforwhichConsultanthaswithheldrecordsorinformationcontainedtherein,ornotprovidedthemtotheCityinatimelymanner.ConsultantshallproducefordistributionanyandallrecordsresponsivetothePublicRecordsActrequestinatimelymanner,unlessthoserecordsareprotectedbycourtorder.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.9.IndependentContractorRelationship:0PAGE3OF10AGENDA ITEM #8. f) A.TheConsultantisretainedbytheCityonlyforthepurposesandtotheextentsetforthinthisAgreement.ThenatureoftherelationshipbetweentheConsultantandtheCityduringtheperiodoftheWorkshallbethatofanindependentcontractor,notemployee.TheConsultant,nottheCity,shallhavethepowertocontrolanddirectthedetails,mannerormeansofWork.Specifically,butnotbymeansoflimitation,theConsultantshallhavenoobligationtoworkanyparticularhoursorparticularschedule,unlessotherwiseindicatedintheScopeofWorkorwhereschedulingofattendanceorperformanceismutuallyarrangedduetothenatureoftheWork.ConsultantshallretaintherighttodesignatethemeansofperformingtheWorkcoveredbythisagreement,andtheConsultantshallbeentitledtoemployotherworkersatsuchcompensationandsuchotherconditionsasitmaydeemproper,provided,however,thatanycontractsomadebytheConsultantistobepaidbyitalone,andthatemployingsuchworkers,itisactingindividuallyandnotasanagentfortheCity.B.TheCityshallnotberesponsibleforwithholdingorotherwisedeductingfederalincometaxorSocialSecurityorcontributingtotheStateIndustrialInsuranceProgram,orotherwiseassumingthedutiesofanemployerwithrespecttoConsultantoranyemployeeoftheConsultant.C.IftheConsultantisasoleproprietorshiporifthisAgreementiswithanindividual,theConsultantagreestonotifytheCityandcompleteanyrequiredformiftheConsultantretiredunderaStateofWashingtonretirementsystemandagreestoindemnifyanylossestheCitymaysustainthroughtheConsultant’sfailuretodoso.10.HoldHarmless:TheConsultantagreestorelease,indemnify,defend,andholdharmlesstheCity,electedofficials,employees,officers,representatives,andvolunteersfromanyandallclaims,demands,actions,suits,causesofaction,arbitrations,mediations,proceedings,judgments,awards,injuries,damages,liabilities,taxes,losses,fines,fees,penalties,expenses,attorney’sorattorneys’fees,costs,and/orlitigationexpensestoorbyanyandallpersonsorentities,arisingfrom,resultingfrom,orrelatedtothenegligentacts,errorsoromissionsoftheConsultantinitsperformanceofthisAgreementorabreachofthisAgreementbyConsultant,exceptforthatportionoftheclaimscausedbytheCity’ssolenegligence.ShouldacourtofcompetentjurisdictiondeterminethatthisagreementissubjecttoRCW4.24.115,(Validityofagreementtoindemnifyagainstliabilityfornegligencerelativetoconstruction,alteration,improvement,etc.,ofstructureorimprovementattachedtorealestate...)then,intheeventofliabilityfordamagesarisingoutofbodilyinjurytopersonsordamagestopropertycausedbyorresultingfromtheconcurrentnegligenceoftheConsultantandtheCity,itsofficers,officials,employeesandvolunteers,Consultant’sliabilityshallbeonlytotheextentofConsultant’snegligence.0PAGE4OF10AGENDA ITEM #8. f) ItisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedinthisAgreementconstituteConsultant’swaiverofimmunityundertheIndustrialInsuranceAct,RCWTitle51,solelyforthepurposesofthisindemnification.ThePartieshavemutuallynegotiatedandagreedtothiswaiver.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.11.GiftsandConflicts:TheCity’sCodeofEthicsandWashingtonStatelawprohibitCityemployeesfromsoliciting,accepting,orreceivinganygift,gratuityorfavorfromanyperson,firmorcorporationinvolvedinacontractortransaction.ToensurecompliancewiththeCity’sCodeofEthicsandstatelaw,theConsultantshallnotgiveagiftofanykindtoCityemployeesorofficials.ConsultantalsoconfirmsthatConsultantdoesnothaveabusinessinterestoraclosefamilyrelationshipwithanyCityofficeroremployeewhowas,is,orwillbeinvolvedinselectingtheConsultant,negotiatingoradministeringthisAgreement,orevaluatingtheConsultant’sperformanceoftheWork.12.CityofRentonBusinessLicense:TheConsultantshallobtainaCityofRentonBusinessLicensepriortoperforminganyWorkandmaintainthebusinesslicenseingoodstandingthroughoutthetermofthisagreementwiththeCity.Informationregardingacquiringacitybusinesslicensecanbefoundat:http://www.rentonwa.gov/cms/One.aspx?portalld=7922741&pageld=9824882InformationregardingStatebusinesslicensingrequirementscanbefoundat:http://dor.wa.gov/doing-business/register-my-business13.Insurance:Consultantshallsecureandmaintain:A.Commercialgeneralliabilityinsuranceintheminimumamountsof$1,000,000foreachoccurrence/$2,000,000aggregatefortheTermofthisAgreement.B.IntheeventthatWorkdeliveredpursuanttothisAgreementeitherdirectlyorindirectlyinvolveorrequireProfessionalServices,ProfessionalLiability,ErrorsandOmissionscoverageshallbeprovidedwithminimumlimitsof$1,000,000peroccurrence.“ProfessionalServices”,forthepurposeofthissection,shallmeananyWorkprovidedbyalicensedprofessionalorWorkthatrequiresaprofessionalstandardofcare.C.Workers’compensationcoverage,asrequiredbytheIndustrialInsurancelawsoftheStateofWashington,shallalsobesecured.D.CommercialAutomobileLiabilityforowned,leased,hiredornon-owned,leased,hiredornon-owned,withminimumlimitsof$1,000,000peroccurrencecombined0PAGE5OF10AGENDA ITEM #8. f) singlelimit,iftherewillbeanyuseofConsultant’svehiclesontheCity’sPremisesbyoronbehalfoftheCity,beyondnormalcommutes.E.ConsultantshallnametheCityasanAdditionalInsuredonitscommercialgeneralliabilitypolicyonanon-contributoryprimarybasis.TheCity’sinsurancepoliciesshallnotbeasourceforpaymentofanyConsultantliability,norshallthemaintenanceofanyinsurancerequiredbythisAgreementbeconstruedtolimittheliabilityofConsultanttothecoverageprovidedbysuchinsuranceorotherwiselimittheCity’srecoursetoanyremedyavailableatlaworinequity.F.SubjecttotheCity’sreviewandacceptance,acertificateofinsuranceshowingtheproperendorsements,shallbedeliveredtotheCitybeforeperformingtheWork.G.ConsultantshallprovidetheCitywithwrittennoticeofanypolicycancellation,withintwo(2)businessdaysoftheirreceiptofsuchnotice.14.Delays:ConsultantisnotresponsiblefordelayscausedbyfactorsbeyondtheConsultant’sreasonablecontrol.WhensuchdelaysbeyondtheConsultant’sreasonablecontroloccur,theCityagreestheConsultantisnotresponsiblefordamages,norshalltheConsultantbedeemedtobeindefaultoftheAgreement.15.SuccessorsandAssigns:NeithertheCitynortheConsultantshallassign,transferorencumberanyrights,dutiesorinterestsaccruingfromthisAgreementwithoutthewrittenconsentoftheother.16.Notices:AnynoticerequitedunderthisAgreementwillbeinwriting,addressedtotheappropriatepartyattheaddresswhichappearsbelow(asmodifiedinwritingfromtimetotimebysuchparty),andgivenpersonally,byregisteredorcertifiedmail,returnreceiptrequested,byfacsimileorbynationallyrecognizedovernightcourierservice.Timeperiodfornoticesshallbedeemedtohavecommenceduponthedateofreceipt,EXCEPTfacsimiledeliverywillbedeemedtohavecommencedonthefirstbusinessdayfollowingtransmission.EmailandtelephonemaybeusedforpurposesofadministeringtheAgreement,butshouldnotbeusedtogiveanyformalnoticerequiredbytheAgreement.CITYOFRENTONCONSULTANTJosephFarahErikRowland1055SouthGradyWay12787GatewayDriveSouthRenton,WA98057Seattle,WA98168Phone:(425)430-7205Phone:(206)241-6000jfarah@rentonwa.goverowland@nhcweb.comFax:(425)430-7241Fax:(425)439-24200PAGE6OF10AGENDA ITEM #8. f) 17.DiscriminationProhibited:Excepttotheextentpermittedbyabonafideoccupationalqualification,theConsultantagreesasfollows:A.Consultant,andConsultant’sagents,employees,representatives,andvolunteerswithregardtotheWorkperformedortobeperformedunderthisAgreement,shallnotdiscriminateonthebasisofrace,color,sex,religion,nationality,creed,maritalstatus,sexualorientationorpreference,age(exceptminimumageandretirementprovisions),honorablydischargedveteranormilitarystatus,orthepresenceofanysensory,mentalorphysicalhandicap,unlessbaseduponabonafideoccupationalqualificationinrelationshiptohiringandemployment,inemploymentorapplicationforemployment,theadministrationofthedeliveryofWorkoranyotherbenefitsunderthisAgreement,orprocurementofmaterialsorsupplies.B.TheConsultantwilltakeaffirmativeactiontoinsurethatapplicantsareemployedandthatemployeesaretreatedduringemploymentwithoutregardtotheirrace,creed,color,nationalorigin,sex,age,sexualorientation,physical,sensoryormentalhandicaps,ormaritalstatus.Suchactionshallinclude,butnotbelimitedtothefollowingemployment,upgrading,demotionortransfer,recruitmentorrecruitmentadvertising,layoffortermination,ratesofpayorotherformsofcompensationandselectionfortraining.C.litheConsultantfailstocomplywithanyofthisAgreement’snon-discriminationprovisions,theCityshallhavetheright,atitsoption,tocanceltheAgreementinwholeorinpart.D.TheConsultantisresponsibletobeawareofandincompliancewithallfederal,stateandlocallawsandregulationsthatmayaffectthesatisfactorycompletionoftheproject,whichincludesbutisnotlimitedtofairlaborlaws,worker’scompensation,andTitleVIoftheFederalCivilRightsActof1964,andwillcomplywithCityofRentonCouncilResolutionNumber4085.18.Miscellaneous:Thepartiesherebyacknowledge:A.TheCityisnotresponsibletotrainorprovidetrainingforConsultant.B.Consultantwillnotbereimbursedforjobrelatedexpensesexcepttotheextentspecificallyagreedwithintheattachedexhibits.C.Consultantshallfurnishalltoolsand/ormaterialsnecessarytoperformtheWorkexcepttotheextentspecificallyagreedwithintheattachedexhibits.D.Intheeventspecialtraining,licensing,orcertificationisrequiredforConsultanttoprovideWorkhe/shewillacquireormaintainsuchathis/herownexpenseand,if0PAGE70F1OAGENDA ITEM #8. f) Consultantemploys,sub-contracts,orotherwiseassignstheresponsibilitytoperformtheWork,saidemployee/sub-contractor/assigneewillacquireandormaintainsuchtraining,hcensing,orcertification.E.Thisisanon-exclusiveagreementandConsultantisfreetoprovidehis/herWorktootherentities,solongasthereisnointerruptionorinterferencewiththeprovisionofWorkcalledforinthisAgreement.F.Consultantisresponsibleforhis/herowninsurance,including,butnotlimitedtohealthinsurance.G.Consultantisresponsibleforhis/herownWorker’sCompensationcoverageaswellasthatforanypersonsemployedbytheConsultant.19.OtherProvisions:A.ApprovalAuthority.EachindividualexecutingthisAgreementonbehalfoftheCityandConsultantrepresentsandwarrantsthatsuchindividualsaredulyauthorizedtoexecuteanddeliverthisAgreementonbehalfoftheCityorConsultant.B.GeneralAdministrationandManagement.TheCity’sprojectmanagerisJosephFarah,SurfaceWaterUtilityEngineer.InprovidingWork,ConsultantshallcoordinatewiththeCity’scontractmanagerorhis/herdesignee.C.AmendmentandModification.ThisAgreementmaybeamendedonlybyaninstrumentinwriting,dulyexecutedbybothParties.D.Conflicts.IntheeventofanyinconsistenciesbetweenConsultantproposalsandthisAgreement,thetermsofthisAgreementshallprevail.Anyexhibits/attachmentstothisAgreementareincorporatedbyreferenceonlytotheextentofthepurposeforwhichtheyarereferencedwithinthisAgreement.TotheextentaConsultantpreparedexhibitconflictswiththetermsinthebodyofthisAgreementorcontainstermsthatareextraneoustothepurposeforwhichitisreferenced,thetermsinthebodyofthisAgreementshallprevailandtheextraneoustermsshallnotbeincorporatedherein.E.GoverningLaw.ThisAgreementshallbemadeinandshallbegovernedbyandinterpretedinaccordancewiththe‘awsoftheStateofWashingtonandtheCityofRenton.ConsultantandalloftheConsultant’semployeesshallperformtheWorkinaccordancewithallapplicablefederat,state,countyandcitylaws,codesandordinances.F.JointDraftingEffort.ThisAgreementshallbeconsideredforallpurposesaspreparedbythejointeffortsofthePattiesandshallnotbeconstruedagainstone0PAGE8OF10AGENDA ITEM #8. f) partyortheotherasaresultofthepreparation,substitution,submissionorothereventofnegotiation,draftingorexecution.G.JurisdictionandVenue.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.H.Severability.Acourtofcompetentjurisdiction’sdeterminationthatanyprovisionorpartofthisAgreementisillegalorunenforceableshallnotcancelorinvalidatetheremainderofthisAgreement,whichshallremaininfullforceandeffect.SoleandEntireAgreement.ThisAgreementcontainstheentireagreementofthePartiesandanyrepresentationsorunderstandings,whetheroralorwritten,notincorporatedareexcluded.J.TimeisoftheEssence.TimeisoftheessenceofthisAgreementandeachandallofitsprovisionsinwhichperformanceisafactor.AdherencetocompletiondatessetforthinthedescriptionoftheWorkisessentialtotheConsultant’sperformanceofthisAgreement.Consultant,however,willnotbeheldresponsiblefordelayscausedbyfailureoftheCityofRentonoritsagentstoprovidedirectionandinformation,orreviewofinterimproducts.K.Third-PartyBeneficiaries.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.L.BindingEffect.ThePartieseachbindthemselves,theirpartners,successors,assigns,andlegalrepresentativestotheotherpartytothisAgreement,andtothepartners,successors,assigns,andlegalrepresentativesofsuchotherpartywithrespecttoallcovenantsoftheAgreement.M.Waivers.Allwaiversshallbeinwritingandsignedbythewaivingparty.Eitherparty’sfailuretoenforceanyprovisionofthisAgreementshallnotbeawaiverandshallnotpreventeithertheCityorConsultantfromenforcingthatprovisionoranyotherprovisionofthisAgreementinthefuture.WaiverofbreachofanyprovisionofthisAgreementshallnotbedeemedtobeawaiverofanypriororsubsequentbreachunlessitisexpresslywaivedinwriting.0PAGE9OF10AGENDA ITEM #8. f) N.Counterparts.ThePartiesmayexecutethisAgreementinanynumberofcounterparts,eachofwhichshallconstituteanoriginal,andallofwhichwilltogetherconstitutethisoneAgreement.INWITNESSWHEREOF,thePartieshavevoluntarilyenteredintothisAgreementasofthedatelastsignedbythePartiesbelow.CITYOFRENTONCONSULTANTBy:______________________________By:_________________DenisLawErikRowlandMayorPrincipal-in-ChargeDateDateAttestJasonA.SethCityClerkApprovedastoLegalFormShaneMoloneyRentonCityAttorneyNon-standard08/03/18clb(473)0PAGE10OF10AGENDA ITEM #8. f) nbcnorthwesthydraulicconsultantsNHCRef.No.P02004153July25,2018CityofRentonPublicWorks—SurfaceWaterUtility1055SouthGradyWay—5thFloorRenton,WA98057Attention:JosephFarah,P.E.Viaemail:JFarah@Rentonwa.govRe:INTRODUCTION12787GatewayDriveSouthISeattle,WA9816$I206.241.6000Iwww.nhcweb.comExhibitA2018-2022CedarRiverSedimentSurveysTheCityofRentonDepartmentofPublicWorksSurfaceWaterUtility(City)hasaskedNorthwestHydraulicConsultants(NHC)toprepareascopeofworkandbudgetestimatetoprovideannualchannelsurvey,hydraulicmodeling,andsedimentationanalysisservices,relatedtothemonitoringeffortneededaspartoftheCedarRiverMaintenanceDredgingProject.ThefollowingscopeofworkandtheattachedcostestimatehavebeenpreparedinresponsetotheCity’srequest.ThepurposeofthisstudyistomonitoranddocumentsedimentaccumulationwithinthelowertwomilesoftheCedarRiverasitpassesthroughtheCityofRenton.In2016,theCitydredgedthelower1.3milesoftheCedarRiver.AspartoftheCedarRiverSection205FloodHazardReductionproject,theCityisrequiredtomonitorsedimentlevelswithinthelowerCedarRiver,inordertodeterminewhenmaintenancedredgingbecomesnecessary.ThefollowingscopeofworkoutlinesservicestobeconductedbyNHCannuallyoverthenextfiveyears(2018-2022).Task1—Cross-SectionSurveysNHCwillsurveyapproximately40channelcross-sectionsbeginningattheNorthBoeingBridge(RM0.0)andextendingupstreamtoRM2.1.Cross-sectionlocationswillbethesameasthoseestablishedduringprevioussurveys.Bothendsofeachcross-sectionwillextendtothetopoftheexistingbank,berm,orfloodwall.NHCwillpost-processthesurveypointstocreatecross-sectionviewsateachlocation.EachsectionwillbesurveyedatthelocationsmonumentedeitherbyPACEin1999orNHC(insubsequentyears)andateachbridge.SCOPEOFWORKwaterresourcespecialistsAGENDA ITEM #8. f) ExhibitAiilicNHCwillusetotalstationequipmenttosurveycross-sections.Existingverticalbenchmarkswillbereoccupiedtomaintainconsistencywithpastsurveys.Cross-sectionssurveyswillbereferencedtoknownhorizonalandverticaldatums,WAStatePlaneNorth-NAD83andNAVD1988,respectively.Itisassumedcross-sectionsatbridgefaceswillbesurveyedwithatotalstationratherthansoundingsfrombridgerails,aswasperformedpriorto2017.Task2—UpdateHEC-RASModelNHCwillupdatetheexistingHEC-RASmodelofthestudyreachusingnewlysurveyedcross-sectionsfromTask1.Themodelwillbeusedtoestimatethe2-,10-,25-,and100-yearwatersurfaceprofilesandcorrespondingleveefreeboardelevations.Beginningin2018,newlycomputedfloodfrequencydischargesandmodifiedallowableaveragebedelevationswillbeprovidedtoNHCbytheCityandusedinthehydraulicandfreeboardanalysis.Task3—SedimentAnalysisTohelptheCitymonitorsedimentaccumulationwithinthedredgedreach(downstreamofWilliamsAvenue5),NHCwillusethecurrentyear’ssurveyeddata(fromTask1),andthepreviousyear’ssurveydatato:1)estimatethechangeinsedimentvolume,2)determineaveragebedelevations,and3)calculatetheremainingstoragecapacity.RemainingstoragevolumewillbecomputedbydeterminingthedifferencebetweentheallowablebedestablishedbytheCityandmodifiedaveragebedelevationscalculatedinTask2.Task4—SouthBoeingBridgeAnalysisandMemoNHCwillusetheHEC-RASmodeltocreateastage-dischargeratingcurveattheupstreamfaceoftheSouthBoeingBridge.AsecondratingcurvewillbeplottedonthisfigurethatrepresentstheLandsburgstreamgage.Theratingcurvedatawillbepresentedinbothgraphicalandtabularformats.NHCwillusethemodelresultstoestimatethedischargesattheSouthBoeingBridgeandattheLandsburggagethatproduceawatersurfaceelevationthat:1)touchesthebridgelowchord,and2)isonefootbelowthelowchord.ThisinformationwillbesummarizedinamemorandumthattheCitycandistributetokeyfloodprotectionpartners.Task5—ChannelSurveyReportingAbriefreportwillbepreparedinwhicheachofthetaskitemsaresummarizedanddocumentedwithsupportingtablesandfigures.Keyelementsofthereportwillinclude:•Plotsofthecurrentandpreviousyear’saveragebedprofilescomparedtheestablishedallowablebedelevationprofile,andthe2016post-dredgeprofile.•Resultsanddiscussionofsedimentanalysisandaccumulationrates.•SouthBoeingBridgefloodstageanalysisandmemo.•ResultsfromtheHEC-RASmodel,includingplotsof100-yearwaterlevelsandadiscussionofremainingfreeboardalongthefloodcontrolprojectandbridges,andotherfloodingconcerns.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f) nbcExhibitANHCwillelectronicallytransmitthereportandsupportingdata(e.g.HEC-RASmodel,photos,...)totheCity.UpontherequestoftheCity,one(1)hardcopywouldbeprovided.Task6—ProjectManagementNHCwillcoordinatethesurveywiththeCityandensurethattheprojectiscompletedontimeandwithinbudget.InvoiceswillbesentmonthlyandNHC’sprojectmanagerwillbeavailabletotheCityforprojectupdates.CLOSURENHCappreciatesthisopportunitytoprovidecontinuedservicetotheCityaspartoftheCedarRiverMaintenanceDredgeProject.DISCLAIMERThisdocumenthasbeenpreparedbyNorthwestHydraulicConsultantsInc.inaccordancewithgenerallyacceptedengineeringpracticesandisintendedfortheexclusiveuseandbenefitoftheCityofRentonandtheirauthorizedrepresentativesforspecificapplicationtotheCedarRiverMaintenanceDredgingProjectinRenton,Washington.Thecontentsofthisdocumentarenottoberelieduponorused,inwholeorinpart,byorforthebenefitofotherswithoutspecificwrittenauthorizationfromNorthwestHydraulicConsultantsInc.Nootherwarranty,expressedorimplied,ismade.NorthwestHydraulicConsultantsInc.anditsofficers,directors,employees,andagentsassumenoresponsibilityfortherelianceuponthisdocumentoranyofitscontentsbyanypartiesotherthantheCityofRenton.Sincerely,NorthwestHydraulicConsultantsInc.PeterBrooks,P.E.ErikRowland,P.E.Sr.EngineerPrincipalProjectManagerPrincipal-in-ChargeAttachments:ExhibitB—BudgetExhibitC—Schedule2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f) ExhibitB—Budget2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018nbcNorthwestHydraulicConsultantsInc.12787GatewayDriveS.Seattle,WA98168Tel.(206)241-6000Fax(206)439-2420EstimateofProfessionalServicesPreparedfor:CityofRentonProject:2018-2022CedarRiverSedimentSurveysDate:07/2512018Project#:P02004153PreparedBy:PeterBrooks!ErikRowlandDirectExpenseDetailTflT1nierrrpPRtImrcCostSummaryeudgetestimateIoncurrentyear(2010)YearTask20182019202020212022TotalCedarRiverSedimentSurvey$24934$25,682$26,452$27,246$28,063$132,377Budgetestimatesincluding3%annualescalationafter2018.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityGISSr.Doc.contactTASKDESCRIPTIONPa.Sr.Eng.IEng.IJr.Eng.AnalystSpclst.Admin.TotalsTask1Cross-SectionSurvey1.1SL.rvey24848$11,8391.2PostProcessing2105$1,881Task2UpdateHEC-RASModel128$1.43fTask3SedimentAnatis3.1Cross-SectionCompadson/VolumeCalctiations14164$3,0143.2SedimentProBes2—42$975Task4SouthBoeingBndgeAnalysis&Memo1241$1125Task5ChannelSurveyReporting46844$3688Task6ProjectManagement221TotalHoursandDirectSalaryCost(DSC)9.022.048.098.015.05.01.0LaborRate($/hr)240.28185.24135.83103.0995.87101.81136.67TOTALLABORCOSTI$23,957UnitsMileage0545527TotalStation5150$750Reproduction540$200Rate50.!jICost.TotalLabor$2395TotalDirectEspertses..-TOTALCOrAGENDA ITEM #8. f) nbcSCHEDULEOFSTANDARDCHARGES(Effective1ian2018)LaborFeeRateCategory($US/hour)PrinUpal240.28PrindpalT3223.71Sr.ProjectEngineer/Saenfist200.00Sr.Engineer1185.24Sr.Engineer/Sdentist2156.52Engineer1135.83Scientist1121.69Engineer/Sdentist2111.66Jr.Engineer103.09GISSpedalist130.23GISAnalyst95.87Sr.EngineeringTechnician131.90Sr.LaboratoryTechnician100.00LaboratoryTechnician75.32Sr.ContractAdministrator136.67Sr.TechnicalEditor135.00Sr.DocumentProduction/flnanceSpecialist101.81DocumentProductionSpecialist80.00HandlingChargesIFeesPhotocopies$/sheetB&W81hx11$010MarkuponSubconsultants10%B&W11x17$0.15MarkuponReimbutsables10%Color81Axli$1.00MarkuponTravel/Subsistence.lO%Colorlix17$2.00Plotting$/sheetPlots,bond,lix17$2.00Plots,bond,Dsize$4.00Plots,oversize(runningfoot).$2.00LaborcostssubjecttoannualescalationadjustmentinOctobertoreflectcostoflivingandmeritsalaryincreases.Refertoseparateschedulesforfieldandlaboratoryequipmentcharges.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f) nbcExhibitC—Schedule2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018NHCwillperformthecross-sectionsurveysduringlowwaterinAugustand/orSeptember.FivecopiesofthesummaryreportincludingsurveydataforthisreachalongwiththesedimentvolumeinformationwillbeprovidedtotheCitybyOctober31ofthecurrentyear.Allworkandrevisionswillbecompletedbeforethefinalprojectcloseoutdateattheendofthecurrentcalendaryear.FinalinvoicesshallbeprovidedbyorbeforeDecember31stoftheyearthattheworkwasperformed.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f) AB - 2197 City Council Regular Meeting - 20 Aug 2018 SUBJECT/TITLE: Water Quality Grant Agreement WQC-2017-Renton-00002 with the Department of Ecology for the Heather Downs Detention Pond Water Quality Retrofit Project RECOMMENDED ACTION: Refer to Utilities Committee DEPARTMENT: Utility Systems Division STAFF CONTACT: Ron Straka, Surface Water Utility Engineering Manager EXT.: 7248 FISCAL IMPACT SUMMARY: The grant agreement provides $93,000 of grant funding into the approved 2018 Surface Water Utility Capital Improvement Program budget for the Heather Downs Detention Pond Water Quality Retrofit Project (425.475511). The grant funding for this project was included in the city’s second quarter budget adjustment. The grant requires $31,000 of matching funds for a total grant agreement amount of $124,000. There is sufficient funding in the project budget for the required matching funds. SUMMARY OF ACTION: The City of Renton has been awarded $93,000 in grant funds from the State of Washington Department of Ecology for the Heather Downs Detention Pond Water Quality Retrofit Project. This project will improve water quality in Maplewood Creek, tributary to the Cedar River, through design of a combined detention pond and wetpond at Union Avenue SE and SE 4th Street. This project will provide treatment for total suspended solid (TSS) and will reduce flows to Maplewood Creek by increasing stormwater infiltration and providing stormwater detention. The Ecology grant includes the preparation of State En vironmental Policy Act (SEPA) and cultural resource review requirements, development of an Inadvertent Discovery Plan (IDP), development of a project design report and construction plans and specifications that will allow the future construction of the project to treat stormwater runoff in the Heather Downs residential neighborhood. The project design and preparation of the construction plans and specifications will be completed prior to the grant agreement expiration date of December 31, 2020. EXHIBITS: A. Agreement B. Vicinity Map STAFF RECOMMENDATION: Authorize the Mayor to execute the Water Quality Grant Agreement WQC-2017-Renton-00002 with the Department of Ecology to accept $93,000 in grant funds for the Heather Downs Detention Pond Water Quality Retrofit Project. AGENDA ITEM #8. g) Agreement No. WQC-2017-Renton-00002 WATER QUALITY COMBINED FINANCIAL ASSISTANCE AGREEMENT BETWEEN THE STATE OF WASHINGTON DEPARTMENT OF ECOLOGY AND CITY OF RENTON This is a binding Agreement entered into by and between the state of Washington, Department of Ecology, hereinafter referred to as “ECOLOGY,” and City of Renton, hereinafter referred to as the “RECIPIENT,” to carry out with the provided funds activities described herein. Heather Downs Detention Pond Water Quality Retrofit Project GENERAL INFORMATION Project Title: Total Cost: Total Eligible Cost: Ecology Share: Recipient Share: The Effective Date of this Agreement is: The Expiration Date of this Agreement is no later than: Project Type: Project Short Description: This project will improve water quality in Maplewood Creek, tributary to the Cedar River, through design of a combined detention and wetpond at Union Avenue SE and SE 4th Street in the city of Renton. This project will provide treatment for total suspended solids (TSS) and will also reduce flows to Maplewood Creek by increasing stormwater infiltration and/or providing stormwater detention. Project Long Description: Stormwater runoff from approximately 30 acres of predominately impervious area including driveways, streets, building roofs, and other impervious areas collects in catch basins and pipes and flows to Heather Downs detention pond. The pond currently provides no treatment for stormwater runoff. Stormwater runoff contains various mixtures of hydrocarbons, oils, metals and sediments and can ultimately impair downstream waterbodies. The pond discharges to Maplewood Creek, a tributary to the Cedar River, and ultimately Lake Washington. The Cedar River is a 303(d) listed water body for temperature, pH, fecal coliform and ammonia. $124,000.00 $124,000.00 $93,000.00 $31,000.00 01/01/2018 12/31/2020 Stormwater Facility AGENDA ITEM #8. g) Page 2 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton The RECIPIENT will complete the planning and design work needed to convert the existing detention pond located at Union Ave SE and SE 4th Street in the city of Renton into a combined detention and wetpond facility. The water quality retrofits will reduce water quality problems in Maplewood Creek and the Cedar River by providing basic water quality treatment prior to discharging into the river. The pond will consist of two treatment cells and will provide both water quality treatment through dead storage in the wetpool and flow control through live storage above the wetpool, which will reduce peak flows to the outfall system, and reduce erosion and gullying downstream of the pond. Overall Goal: This project will help protect and restore water quality in Washington by reducing stormwater impacts from existing infrastructure and development. Version 10/30/2015 AGENDA ITEM #8. g) Page 3 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT INFORMATION Organization Name: Federal Tax ID: DUNS Number: Mailing Address: Physical Address: Contacts Organization Email: City of Renton 91-6001271 949697221 Renton City Hall, 5th Floor, 1055 South Grady Way Renton, WA 98057-3232 Renton City Hall, 5th Floor 1055 South Grady Way Renton, Washington 98057-3232 Ken Srilofung Surface Water Utility Engineer 3 - Project Manager 1055 South Grady Way, 5th Floor Renton, Washington 98057 Email: ksrilofung@rentonwa.gov Phone: (425) 430-7247 Authorized Signatory Ken Srilofung Surface Water Utility Engineer 3 - Project Manager 1055 South Grady Way, 5th Floor Renton, Washington 98057 Email: ksrilofung@rentonwa.gov Phone: (425) 430-7247 Billing Contact Project Manager Authorized Signatory Denis W Law Mayor 1055 S. Grady Way Renton, Washington 98057 Email: dlaw@rentonwa.gov Phone: (425) 430-6500 phintz@rentonwa.gov Version 10/30/2015 AGENDA ITEM #8. g) Page 4 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Contacts Project Manager Financial Manager Technical Advisor Melisa Snoeberger 3190 - 160th Ave SE Bellevue, Washington 98008-5452 Email: msno461@ecy.wa.gov Phone: (425) 649-7047 Frances Carver PO Box 47600 Olympia, Washington 98504-7600 Email: fcar461@ecy.wa.gov Phone: (360) 407-6564 Amanda Heye PO Box 47600 Olympia, Washington 98504-7600 Email: ahey461@ecy.wa.gov Phone: (360) 407-6457 ECOLOGY INFORMATION Mailing Address: Physical Address: Department of Ecology Water Quality PO BOX 47600 Olympia, WA 98504-7600 Water Quality 300 Desmond Drive SE Lacey, WA 98503 Version 10/30/2015 AGENDA ITEM #8. g) Page 5 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton AUTHORIZING SIGNATURES RECIPIENT agrees to furnish the necessary personnel, equipment, materials, services, and otherwise do all things necessary for or incidental to the performance of work as set forth in this Agreement. RECIPIENT acknowledges that they had the opportunity to review the entire Agreement, including all the terms and conditions of this Agreement, Scope of Work, attachments, and incorporated or referenced documents, as well as all applicable laws, statutes, rules, regulations, and guidelines mentioned in this Agreement. Furthermore, the RECIPIENT has read, understood, and accepts all requirements contained within this Agreement. This Agreement contains the entire understanding between the parties, and there are no other understandings or representations other than as set forth, or incorporated by reference, herein. No subsequent modifications or amendments to this agreement will be of any force or effect unless in writing, signed by authorized representatives of the RECIPIENT and ECOLOGY and made a part of this agreement. ECOLOGY and RECIPIENT may change their respective staff contacts without the concurrence of either party. This Agreement shall be subject to the written approval of Ecology’s authorized representative and shall not be binding until so approved. The signatories to this Agreement represent that they have the authority to execute this Agreement and bind their respective organizations to this Agreement. IN WITNESS WHEREOF: the parties hereto, having read this Agreement in its entirety, including all attachments, do agree in each and every particular and have thus set their hands hereunto. Washington State Department of Ecology Water Quality Date Date City of Renton Heather R. Bartlett Mayor Denis W Law By:By: Template Approved to Form by Attorney General's Office Program Manager Version 10/30/2015 AGENDA ITEM #8. g) Page 6 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Clerk Date Jason A. Seth Attorney Date Shane Moloney Version 10/30/2015 AGENDA ITEM #8. g) Page 7 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SCOPE OF WORK Task Number:1 Task Cost: $12,400.00 Task Title:Project Administration/Management Task Description: A. The RECIPIENT shall carry out all work necessary to meet ECOLOGY grant or loan administration requirements. Responsibilities include, but are not limited to: maintenance of project records; submittal of requests for reimbursement and corresponding backup documentation; progress reports; and a recipient closeout report (including photos). B. The RECIPIENT shall maintain documentation demonstrating compliance with applicable procurement, contracting, and interlocal agreement requirements; application for, receipt of, and compliance with all required permits, licenses, easements, or property rights necessary for the project; and submittal of required performance items. C. The RECIPIENT shall manage the project. Efforts include, but are not limited to: conducting, coordinating, and scheduling project activities and assuring quality control. Every effort will be made to maintain effective communication with the RECIPIENT's designees; ECOLOGY; all affected local, state, or federal jurisdictions; and any interested individuals or groups. The RECIPIENT shall carry out this project in accordance with any completion dates outlined in this agreement. Task Goal Statement: Properly managed and fully documented project that meets ECOLOGY’s grant or loan administrative requirements. Task Expected Outcome: * Timely and complete submittal of requests for reimbursement, quarterly progress reports, and RECIPIENT closeout report. * Properly maintained project documentation Recipient Task Coordinator: Ken Srilofung Deliverables Project Administration/Management Number Description Due Date 1.1 Quarterly Progress Reports 1.2 Recipient Closeout Report 1.3 Project Outcome Summary Report Version 10/30/2015 AGENDA ITEM #8. g) Page 8 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SCOPE OF WORK Task Number:2 Task Cost: $111,600.00 Task Title:Design Plans and Specs, Environmental Review Task Description: The RECIPIENT shall ensure the following items are completed and provide the associated deliverables to ECOLOGY The RECIPIENT must approve all materials prior to submitting them to ECOLOGY for acceptance. A.The RECIPIENT will coordinate the preparation and submittal of State Environmental Policy Act (SEPA) documentation. B.The RECIPIENT is responsible for application of, receipt of, and compliance with all required local, state, tribal and federal permits, licenses, easements, or property rights necessary for the project. C.The RECIPIENT will comply with Executive Order (05-05) cultural resources review requirements. To initiate cultural resources review the RECIPIENT will: 1.Submit an ECOLOGY 05-05/106 Form, or a cultural resources survey or assessment completed by a licensed archaeologist to ECOLOGY. All submitted materials must conform to the Washington State Standards for Cultural Resource Reporting (DAHP February 2014). 2.Develop and submit an Inadvertent Discovery Plan (IDP) to ECOLOGY. The RECIPIENT will ensure that all contractors and subcontractors have a copy of the completed IDP prior to and while working on-site. An IDP template may be found on the ECOLOGY website. Ground disturbing work (including geotechnical investigations) completed prior to receiving written notice to proceed from ECOLOGY shall not be eligible for reimbursement. D.The RECIPIENT will develop a project Design Report. Projects must be designed in accordance with the Stormwater Management Manual for Eastern Washington, Stormwater Management Manual for Western Washington, or equivalent manual. Project must be reviewed and accepted in writing by ECOLOGY to be eligible for reimbursement. The RECIPIENT will upload a digital copy of the items listed below to EAGL for review. Reduce design figures to 11x17 inches in size and ensure they are legible. 1.Design Report. For a complete list of required design report elements refer to the ECOLOGY website. The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology Design Report Acceptance Letter prior to proceeding to 90 Percent design. 2.90 Percent Design Package. At a minimum, this package must include 90 percent plans, specifications, engineer’s opinion of cost which includes a schedule of eligible costs, and project construction schedule. For current bid inserts and specifications refer to the ECOLOGY website. Version 10/30/2015 AGENDA ITEM #8. g) Page 9 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology 90 Percent Design Acceptance Letter prior to proceeding Final Design. 3.The RECIPIENT will upload a digital copy of the Final Bid Package to EAGL for review and acceptance prior to advertising the project. The Final Bid Package includes: project plans, specifications, engineer’s opinion of cost including a schedule of eligible costs, and project construction schedule. Task Goal Statement: The RECIPIENT will complete all design, environmental review, and permitting tasks and respond to ECOLOGY comments in a timely manner. Task Expected Outcome: The project will meet the requirements set forth by the State Environmental Policy Act, cultural resource protection requirements, ECOLOGY water quality facility design standards, and all other applicable federal, state and local laws and regulations. The project will produce a bid ready set of plans and specifications that will allow the the construction of an aesthetically pleasing, low cost, and effective solution to treat stormwater in the Heather Downs residential neighborhood. Version 10/30/2015 AGENDA ITEM #8. g) Page 10 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Recipient Task Coordinator: Ken Srilofung Deliverables Design Plans and Specs, Environmental Review Number Description Due Date 2.1 Copy of SEPA determination documentation. Upload to EAGL and notify ECOLOGY when upload is complete. 2.2 Submit ECOLOGY 05-05/106 Form and any supplemental cultural resources documentation including Cultural Resource surveys directly to the Ecology Project Manager. Upload the Final Determination Letter to EAGL. 2.3 Inadvertent Discovery Plan. Upload to EAGL and notify ECOLOGY when upload is complete. 2.4 Design Report. Upload to EAGL and notify ECOLOGY when upload is complete. 2.5 Responses to ECOLOGY Design Report comments. Upload to EAGL and notify ECOLOGY when upload is complete. 2.6 Ecology Design Report Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. 2.7 90 Percent Design Package. Upload to EAGL and notify ECOLOGY when upload is complete. 2.8 Responses to ECOLOGY 90 Percent Design Plan comments. Upload to EAGL and notify ECOLOGY when upload is complete. 2.9 Ecology 90 Percent Design Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. 2.10 List of permits acquired, and environmental review documents. Upload to EAGL and notify ECOLOGY when upload is complete. 2.11 Final Bid Package. Upload to EAGL and notify ECOLOGY when upload is complete. 2.12 Ecology Final Bid Package Acceptance Letter. Upload to EAGL and notify ECOLOGY when upload is complete. Version 10/30/2015 AGENDA ITEM #8. g) Page 11 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton BUDGET Funding Distribution EG180582 NOTE: The above funding distribution number is used to identify this specific agreement and budget on payment remittances and may be referenced on other communications from ECOLOGY. Your agreement may have multiple funding distribution numbers to identify each budget. Title: State SFAP - SFY17 100% Environmental Legacy Stewardship Account (ELSA) - State Type: Funding Source %: Description: Approved Indirect Costs Rate: Recipient Match %: InKind Interlocal Allowed: InKind Other Allowed: Is this Funding Distribution used to match a federal grant? No Approved State Indirect Rate: 0% 25% No No Funding Title: Funding Source: Funding Expiration Date: Funding Type: Funding Effective Date: SFAP 01/01/2018 12/31/2020 Grant SFAP Task Total Project Administration/Management 12,400.00$ Design Plans and Specs, Environmental Review 111,600.00$ 124,000.00$Total: Version 10/30/2015 AGENDA ITEM #8. g) Page 12 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Funding Distribution Summary Recipient / Ecology Share Recipient Share Ecology Share TotalRecipient Match %Funding Distribution Name $$$%93,000.00 124,000.0031,000.0025.00SFAP Total $$31,000.00 93,000.00 $124,000.00 AGREEMENT SPECIFIC TERMS AND CONDITIONS N/A SPECIAL TERMS AND CONDITIONS SECTION 1: DEFINITIONS Unless otherwise provided, the following terms will have the respective meanings for all purposes of this agreement: “Administration Charge” means a charge established in accordance with Chapter 90.50A RCW and Chapter 173-98 WAC, to be used to pay Ecology’s cost to administer the State Revolving Fund by placing a percentage of the interest earned in an Administrative Charge Account. “Administrative Requirements” means the effective edition of ECOLOGY's Administrative Requirements for Recipients of Ecology Grants and Loans at the signing of this agreement. “Annual Debt Service” for any calendar year means for any applicable bonds or loans including the loan, all interest plus all principal due on such bonds or loans in such year. “Average Annual Debt Service” means, at the time of calculation, the sum of the Annual Debt Service for the remaining years of the loan to the last scheduled maturity of the loan divided by the number of those years. “Centennial Clean Water Program” means the state program funded from various state sources. “Contract Documents” means the contract between the RECIPIENT and the construction contractor for construction of the project. “Cost Effective Analysis” means a comparison of the relative cost-efficiencies of two or more potential ways of solving a water quality problem as described in Chapter 173-98-730 WAC. “Defease” or “Defeasance” means the setting aside in escrow or other special fund or account of sufficient investments and money dedicated to pay all principal of and interest on all or a portion of an obligation as it comes due. “Effective Date” means the earliest date on which eligible costs may be incurred. “Effective Interest Rate” means the total interest rate established by Ecology that includes the Administrative Charge. Version 10/30/2015 AGENDA ITEM #8. g) Page 13 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Estimated Loan Amount” means the initial amount of funds loaned to the RECIPIENT. “Estimated Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the Estimated Loan Amount. “Equivalency” means projects designated by ECOLOGY to meet additional federal requirements. “Final Accrued Interest” means the interest accrued beginning with the first disbursement of funds to the RECIPIENT through such time as the loan is officially closed out and a final loan repayment schedule is issued. “Final Loan Amount” means all principal of and interest on the loan from the Project Start Date through the Project Completion Date. “Final Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the Final Loan Amount. “Forgivable Principal” means the portion of a loan that is not required to be paid back by the borrower. “General Obligation Debt” means an obligation of the RECIPIENT secured by annual ad valorem taxes levied by the RECIPIENT and by the full faith, credit, and resources of the RECIPIENT. “General Obligation Payable from Special Assessments Debt” means an obligation of the RECIPIENT secured by a valid general obligation of the Recipient payable from special assessments to be imposed within the constitutional and statutory tax limitations provided by law without a vote of the electors of the RECIPIENT on all of the taxable property within the boundaries of the RECIPIENT. “Gross Revenue” means all of the earnings and revenues received by the RECIPIENT from the maintenance and operation of the Utility and all earnings from the investment of money on deposit in the Loan Fund, except (i) Utility Local Improvement Districts (ULID) Assessments, (ii) government grants, (iii) RECIPIENT taxes, (iv) principal proceeds of bonds and other obligations, or (v) earnings or proceeds (A) from any investments in a trust, Defeasance, or escrow fund created to Defease or refund Utility obligations or (B) in an obligation redemption fund or account other than the Loan Fund until commingled with other earnings and revenues of the Utility or (C) held in a special account for the purpose of paying a rebate to the United States Government under the Internal Revenue Code. “Guidelines” means the ECOLOGY's Funding Guidelines that that correlate to the State Fiscal Year in which the project is funded. “Initiation of Operation Date” means the actual date the Water Pollution Control Facility financed with proceeds of the loan begins to operate for its intended purpose. “Loan” means the Washington State Water Pollution Control Revolving Fund Loan or Centennial Clean Water Fund (Centennial) Loan made pursuant to this loan agreement. “Loan Amount” means either an Estimated Loan Amount or a Final Loan Amount, as applicable. Version 10/30/2015 AGENDA ITEM #8. g) Page 14 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Loan Fund” means the special fund of that name created by ordinance or resolution of the RECIPIENT for the repayment of the principal of and interest on the loan. “Loan Security” means the mechanism by which the RECIPIENT pledges to repay the loan. “Loan Term” means the repayment period of the loan. “Maintenance and Operation Expense” means all reasonable expenses incurred by the RECIPIENT in causing the Utility to be operated and maintained in good repair, working order, and condition including payments to other parties, but will not include any depreciation or RECIPIENT levied taxes or payments to the RECIPIENT in lieu of taxes. “Net Revenue” means the Gross Revenue less the Maintenance and Operation Expense. “Original Engineer’s Estimate” means the engineer’s estimate of construction costs included with bid documents. “Principal and Interest Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name created in the loan fund to be first used to repay the principal of and interest on the loan. “Project” means the project described in this agreement. “Project Completion Date” means the date specified in the agreement on which the Scope of Work will be fully completed. “Project Schedule” means that schedule for the project specified in the agreement. “Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name created in the loan fund to secure the payment of the principal of and interest on the loan. “Revenue-Secured Debt” means an obligation of the RECIPIENT secured by a pledge of the revenue of a utility and one not a general obligation of the RECIPIENT. “Risk-Based Determination” means an approach to sub-recipient monitoring and oversight based on risk factors associated to a RECIPIENT or project. “Scope of Work” means the tasks and activities constituting the project. “Section 319” means the section of the Clean Water Act that provides funding to address nonpoint sources of water pollution. “Senior Lien Obligations” means all revenue bonds and other obligations of the RECIPIENT outstanding on the date of execution of this loan agreement (or subsequently issued on a parity therewith, including refunding obligations) or issued after the date of execution of this loan agreement having a claim or lien on the Gross Revenue of the Utility prior and superior to the claim or lien of the loan, subject only to Maintenance and Operation Expense. “State Water Pollution Control Revolving Fund (Revolving Fund)” means the water pollution control revolving fund established by Chapter 90.50A.020 RCW. Version 10/30/2015 AGENDA ITEM #8. g) Page 15 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton “Termination Date” means the effective date of ECOLOGY’s termination of the agreement. “Termination Payment Date” means the date on which the RECIPIENT is required to repay to ECOLOGY any outstanding balance of the loan and all accrued interest. “Total Eligible Project Cost” means the sum of all costs associated with a water quality project that have been determined to be eligible for ECOLOGY grant or loan funding. “Total Project Cost” means the sum of all costs associated with a water quality project, including costs that are not eligible for ECOLOGY grant or loan funding. “ULID” means any utility local improvement district of the RECIPIENT created for the acquisition or construction of additions to and extensions and betterments of the Utility. “ULID Assessments” means all assessments levied and collected in any ULID. Such assessments are pledged to be paid into the Loan Fund (less any prepaid assessments permitted by law to be paid into a construction fund or account). ULID Assessments will include principal installments and any interest or penalties which may be due. “Utility” means the sewer system, stormwater system, or the combined water and sewer system of the RECIPIENT, the Net Revenue of which is pledged to pay and secure the loan. SECTION 2: THE FOLLOWING CONDITIONS APPLY TO ALL RECIPIENTS OF WATER QUALITY COMBINED FINANCIAL ASSISTANCE FUNDING. The Water Quality Financial Assistance Funding Guidelines are included in this agreement by reference and are available on ECOLOGY’s Water Quality Program website. A. Architectural and Engineering Services: The RECIPIENT certifies by signing this agreement that the requirements of Chapter 39.80 RCW, “Contracts for Architectural and Engineering Services,” have been, or shall be, met in procuring qualified architectural/engineering services. The RECIPIENT shall identify and separate eligible and ineligible costs in the final architectural/engineering services contract and submit a copy of the contract to ECOLOGY. B. Best Management Practices (BMP) Implementation: If the RECIPIENT installs BMPs that are not approved by ECOLOGY prior to installation, the RECIPIENT assumes the risk that part or all of the reimbursement for that activity may be delayed or ineligible. For more details regarding BMP Implementation, please reference the Water Quality Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website. C. Cultural Resources: The RECIPIENT shall: 1) The RECIPIENT shall comply with all applicable federal, state and local environmental laws, statutes, regulations, executive orders, and permits. 2) The RECIPIENT shall comply with Ecology’s Archaeological Resource and Historic Property review process. The RECIPIENT agrees that in no case shall construction activities, ground disturbance, or excavation of any kind, begin until provisions of this process are complied with. The RECIPIENT is responsible for developing a complete Inadvertent Discovery Plan (IDP). The IDP must be immediately available upon request by any party. The IDP must be readily available and be implemented to address any discovery. The RECIPIENT shall implement the procedures in Version 10/30/2015 AGENDA ITEM #8. g) Page 16 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton the IDP, and immediately notify ECOLOGY, the Department of Archeology and Historic Preservation (DAHP), and tribal representatives, if human remains, cultural, or archeological resources are discovered in the course of ground disturbing activities. For more details regarding requirements under this provision, please reference the Water Quality Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website. D. Electronic Fund Transfers: The RECIPIENT must register as a statewide vendor in order to receive payment reimbursement. Washington State’s Department of Enterprise Services (DES) issues all payments. DES maintains a central vendor file for Washington State agency use to process vendor payments. The RECIPIENT can complete the registration process online at: http://des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. This registration process allows the RECIPIENT to sign up for direct deposit payments, also known as electronic fund transfers (EFT). If the RECIPIENT has questions about the vendor registration process or setting up direct deposit payments contact DES Payee Help Desk at (360) 664-7779 or payeehelpdesk@des.wa.gov. E. Equipment Purchase: Equipment not included in the scope of work or the Ecology approved construction plans and specifications, must be pre-approved by ECOLOGY’s project manager before purchase. F. Funding Recognition: The RECIPIENT must inform the public about ECOLOGY or any EPA (see Section 3.B for Section 319 funded or Section 5.E for SRF funded projects) funding participation in this project through the use of project signs, acknowledgement in published materials, reports, the news media, websites, or other public announcements. Projects addressing site-specific locations must utilize appropriately sized and weather-resistant signs. Sign logos are available from ECOLOGY’s Financial Manager upon request. G. Growth Management Planning: The RECIPIENT certifies by signing this agreement that it is in compliance with the requirements of Chapter 36.70A RCW, “Growth Management Planning by Selected Counties and Cities.” If the status of compliance changes, either through RECIPIENT or legislative action, the RECIPIENT shall notify ECOLOGY in writing of this change within 30 days. H. Interlocal: The RECIPIENT certifies by signing this agreement that all negotiated interlocal agreements necessary for the project are, or shall be, consistent with the terms of this agreement and Chapter 39.34 RCW, “Interlocal Cooperation Act.” The RECIPIENT shall submit a copy of each interlocal agreement necessary for the project to ECOLOGY upon request. I. Lobbying and Litigation: Costs incurred for the purposes of lobbying or litigation are not eligible for funding under this agreement. J. Post Project Assessment Survey: The RECIPIENT agrees to participate in a brief survey regarding the key project results or water quality project outcomes and the status of long-term environmental results or goals from the project approximately three years after project completion. A representative from ECOLOGY’s Water Quality Program may contact the RECIPIENT to request this data. ECOLOGY may also conduct site interviews and inspections, and may otherwise evaluate the project, as part of this assessment. K. Project Status Evaluation: ECOLOGY may evaluate the status of this project 18 months from the effective date of this agreement. ECOLOGY’s Project Manager and Financial Manager will meet with the RECIPIENT to review spending trends, completion of outcome measures, and overall project administration and performance. If the RECIPIENT fails to make satisfactory progress toward achieving project outcomes, ECOLOGY may change the scope of work, reduce grant funds, or increase oversight measures. Version 10/30/2015 AGENDA ITEM #8. g) Page 17 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton L. Technical Assistance: Technical assistance for agriculture activities provided under the terms of this agreement shall be consistent with the current U.S. Natural Resource Conservation Service (“NRCS”) Field Office Technical Guide for Washington State. However, ECOLOGY may accept as eligible technical assistance, proposed practices, or project designs that do not meet these standards if approved in writing by the NRCS and ECOLOGY. SECTION 3: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND ONLY CENTENNIAL CLEAN WATER FUNDED PROJECTS BEING USED TO MATCH SECTION 319 FUNDS. The RECIPIENT must submit the following documents to ECOLOGY before this agreement is signed by ECOLOGY: 1. Federal Funding Accountability and Transparency Act (FFATA) Form, available on the Water Quality Program website. 2. Clean Water Act Section 319 Initial Data Reporting Sheet or the “Section 319 Initial Data Reporting” form in EAGL. A. Data Reporting: The RECIPIENT must complete the “Section 319 Initial Data Reporting” form in EAGL before this agreement can be signed by Ecology. This form is used to gather general information about the project. B. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the RECIPIENT shall provide signage that informs the public that the project is funded by EPA. The signage shall contain the EPA logo and follow usage requirements available at http://www2.epa.gov/stylebook/using-epa-seal-and-logo. To obtain the appropriate EPA logo or seal graphic file, the RECIPIENT may sent a request to their Ecology’s Financial Manager. To increase public awareness of projects serving communities where English is not the predominant language, RECIPIENTS are encouraged to provide their outreach strategies communication in non-English languages. Translation costs for this purpose are allowable, provided the costs are reasonable. The RECIPIENT shall use the following paragraph in all reports, documents, and signage developed under this agreement: “This project has been funded wholly or in part by the United States Environmental Protection Agency under an assistance agreement to the Washington State Department of Ecology. The contents of this document do not necessarily reflect the views and policies of the Environmental Protection Agency, nor does the mention of trade names or commercial products constitute endorsement or recommendation for use.” C. Load Reduction Reporting: The RECIPIENT shall complete the “Section 319 Annual Load Reduction Reporting” form in EAGL by January 15 of each year and at project close-out. ECOLOGY may hold reimbursements until the RECIPIENT has completed the form. This form is used to gather information on pollutant load reductions for each best management practice (BMP) installed as a part of this project. D. Time Extension: The RECIPIENT may request a one-time extension for up to 12 months. However, the time extension cannot exceed the time limitation established in EPA’s assistance agreement. In the event a time extension is requested and approved by ECOLOGY, the RECIPIENT must complete all eligible work performed under this agreement by the expiration date. Version 10/30/2015 AGENDA ITEM #8. g) Page 18 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton SECTION 4: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND STATE REVOLVING FUND (SRF) LOAN FUNDED PROJECTS ONLY. A. Accounting Standards: The RECIPIENT shall maintain accurate records and accounts for the project (PROJECT Records) in accordance with Generally Accepted Accounting Principles (GAAP) as issued by the Governmental Accounting Standards Board (GASB), including standards related to the reporting of infrastructure assets or in accordance with the standards in Chapter 43.09.200 RCW “Local Government Accounting – Uniform System of Accounting”. B. Audit Requirements: In accordance with 2 CFR 200.501(a), the RECIPIENT agrees to obtain a single audit from an independent auditor, if their organization expends $750,000 or more in total Federal funds in their fiscal year. The RECIPIENT must submit the form SF-SAC and a Single Audit Report Package within 9 months of the end of the fiscal year or 30 days after receiving the report from an independent auditor. The SF-SAC and a Single Audit Report Package MUST be submitted using the Federal Audit Clearinghouse’s Internet Data Entry System available at: https://harvester.census.gov/fac/collect/ddeindex.html. For complete information on how to accomplish the single audit submissions, go to the Federal Audit Clearinghouse Web site: http://harvester.census.gov/fac/. C. Archaeological Resources and Historic Properties (Section 106): See Section 2.C of the terms and conditions of this agreement, the RECIPIENT shall comply with the additional requirements under section 106 of the National Historic Preservation Act (NHPA, 36 CFR 800). D. Consultant Cap: The RECIPIENT shall ensure that loan or grant funds provided under this agreement to reimburse for costs incurred by individual consultants (excluding overhead) is limited to the maximum daily rate for Level IV of the Executive Schedule (formerly GS-18), to be adjusted annually. The Executive Schedule can be found at: https://www.opm.gov/policy-data-oversight/pay-leave/salaries-wages/. This limit applies to consultation services of designated individuals with specialized skills who are paid at a daily or hourly rate. This rate does not include transportation and subsistence costs for travel performed. Contracts for services awarded using the procurement requirements in Subpart D of 2 CFR 200 are not affected by this limitation unless the terms of the contract provide the RECIPIENT with responsibility for the selection, direction, and control of the individuals who shall be providing services under the contract at an hourly or daily rate of compensation. See 2 CFR 1500.9 for additional information. E. Data Universal Numbering System (DUNS) and Central Contractor Registration (CCR) Requirements: RECIPIENTs shall have a DUNS number. Unless exempted from this requirement under 2 CFR 25.110, the RECIPIENT must ensure that the organization’s information in the System for Award Management (SAM), https://www.sam.gov, is kept current through project closeout. This requires that the RECIPIENT reviews and updates the information at least annually after the initial registration, and more frequently if information changes. F. Disadvantaged Business Enterprise (DBE): General Compliance, 40 CFR, Part 33. The RECIPIENT agrees to comply with the requirements of the Environmental Protection Agency’s Program for Utilization of Small, Minority, and Women’s Business Enterprises (MBE/WBE) 40CFR, Part 33 in procurement under this agreement. Six Good Faith Efforts, 40 CFR, Part 33, Subpart C. The RECIPIENT agrees to make the following good faith efforts whenever procuring construction, equipment, services and supplies under this agreement. Records documenting compliance with the following six good faith efforts shall be retained: 1) Ensure Disadvantaged Business Enterprises are made aware of contracting opportunities to the fullest extent practicable through outreach and recruitment activities. For Indian Tribal, State and Local and Government Version 10/30/2015 AGENDA ITEM #8. g) Page 19 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENTs, this shall include placing Disadvantaged Business Enterprises on solicitation lists and soliciting them whenever they are potential sources. 2) Make information on forthcoming opportunities available to Disadvantaged Business Enterprises and arrange time frames for contracts and establish delivery schedules, where the requirements permit, in a way that encourages and facilitates participation by Disadvantaged Business Enterprises in the competitive process. This includes, whenever possible, posting solicitations for bids or proposals for a minimum of thirty (30) calendar days before the bid or proposal closing date. 3) Consider in the contracting process whether firms competing for large contracts could subcontract with Disadvantaged Business Enterprises. For Indian Tribal, and State and Local Government RECIPIENTs, this shall include dividing total requirements when economically feasible into smaller tasks or quantities to permit maximum participation by Disadvantaged Business Enterprises in the competitive process. 4) Encourage contracting with a consortium of Disadvantaged Business Enterprises when a contract is too large for one of these firms to handle individually. 5) Use services and assistance of the Small Business Administration and the Minority Business Development Agency of the Department of Commerce. 6) If the prime contractor awards subcontracts, require the prime contractor to take the five good faith efforts steps in paragraphs 1 through 5 above. The RECIPIENT agrees to submit ECOLOGY’s Contractor Participation Report Form D with each payment request. Contract Administration Provisions, 40 CFR, Section 33.302. The RECIPIENT agrees to comply with the contract administration provisions of 40 CFR, Section 33.302. Non-discrimination Provision. The RECIPIENT shall not discriminate on the basis of race, color, national origin or sex in the performance of this agreement. The RECIPIENT shall carry out applicable requirements of 40 CFR Part 33 in the award and administration of contracts awarded under EPA financial assistance agreements. Failure by the RECIPIENT to carry out these requirements is a material breach of this agreement which may result in the termination of this contract or other legally available remedies. This does not preclude the RECIPIENT from enacting broader nondiscrimination protections. The RECIPIENT shall comply with all federal and state nondiscrimination laws, including, but not limited to Title VI and VII of the Civil Rights Act of 1964, Section 504 of the Rehabilitation Act of 1973, Title IX of the Education Amendments of 1972, the Age Discrimination Act of 1975, and Chapter 49.60 RCW, Washington’s Law Against Discrimination, and 42 U.S.C. 12101 et seq, the Americans with Disabilities Act (ADA). In the event of the RECIPIENT’s noncompliance or refusal to comply with any applicable nondiscrimination law, regulation, or policy, this agreement may be rescinded, canceled, or terminated in whole or in part, and the RECIPIENT may be declared ineligible for further funding from ECOLOGY. The RECIPIENT shall, however, be given a reasonable time in which to cure this noncompliance. The RECIPIENT shall include the following terms and conditions in contracts with all contractors, subcontractors, Version 10/30/2015 AGENDA ITEM #8. g) Page 20 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton engineers, vendors, and any other entity for work or services pertaining to this agreement. “The Contractor will not discriminate on the basis of race, color, national origin or sex in the performance of this Contract. The Contractor will carry out applicable requirements of 40 CFR Part 33 in the award and administration of contracts awarded under Environmental Protection Agency financial agreements. Failure by the Contractor to carry out these requirements is a material breach of this Contract which may result in termination of this Contract or other legally available remedies.” Bidder List, 40 CFR, Section 33.501(b) and (c). The RECIPIENT agrees to create and maintain a bidders list. The bidders list shall include the following information for all firms that bid or quote on prime contracts, or bid or quote subcontracts, including both MBE/WBEs and non-MBE/WBEs. 1. Entity's name with point of contact 2. Entity's mailing address, telephone number, and e-mail address 3. The procurement on which the entity bid or quoted, and when 4. Entity's status as an MBE/WBE or non-MBE/WBE G. Electronic and information Technology (EIT) Accessibility: RECIPIENTs shall ensure that loan funds provided under this agreement for costs in the development or purchase of EIT systems or products provide individuals with disabilities reasonable accommodations and an equal and effective opportunity to benefit from or participate in a program, including those offered through electronic and information technology as per Section 504 of the Rehabilitation Act, codified in 40 CFR Part 7. Systems or products funded under this agreement must be designed to meet the diverse needs of users without barriers or diminished function or quality. Systems shall include usability features or functions that accommodate the needs of persons with disabilities, including those who use assistive technology. H. Hotel-Motel Fire Safety Act: The RECIPIENT shall ensure that all space for conferences, meetings, conventions or training seminars funded in whole or in part with federal funds complies with the protection and control guidelines of the Hotel and Motel Fire Safety Act (15 USC 2225a, PL 101-391, as amended). Recipients may search the Hotel-Motel National Master List at http://www.usfa.dhs.gov/applications/hotel/ to see if a property is in compliance, or to find other information about the Act. Pursuant to 15 USC 2225a. I. Trafficking In Persons: The RECIPIENT and RECIPIENT employees that are private entities shall not engage in forms of trafficking in persons during the period of time this agreement is effective. This includes, but is not limited to the procurement of a commercial sex act or forced labor. The RECIPIENT shall notify ECOLOGY immediately of any information received from any source alleging a violation under this provision. SECTION 5: THE FOLLOWING CONDITIONS APPLY TO STATE REVOLVING FUND (SRF) LOAN FUNDED PROJECTS ONLY. The RECIPIENT must submit the following documents/forms to ECOLOGY before this agreement is signed by ECOLOGY: 1. Opinion of RECIPIENT’s Legal Council 2. Authorizing Ordinance or Resolution 3. Federal Funding Accountability and Transparency Act (FFATA) Form 4. CWSRF Federal Reporting Information form available in EAGL Version 10/30/2015 AGENDA ITEM #8. g) Page 21 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton 5. Fiscal Sustainability Plan Certification (only required if the project includes construction of a wastewater or stormwater facility construction) A. Alteration and Eligibility of Project: During the term of this agreement, the RECIPIENT (1) shall not materially alter the design or structural character of the project without the prior written approval of ECOLOGY and (2) shall take no action which would adversely affect the eligibility of the project as defined by applicable funding program rules and state statutes, or which would cause a violation of any covenant, condition, or provision herein. B. American Iron and Steel (Buy American): This loan provision applies to projects for the construction, alteration, maintenance, or repair of a “treatment works” as defined in the Federal Water Pollution Control Act (33 USC 1381 et seq.) The RECIPIENT shall ensure that all iron and steel products used in the project are produced in the United States. Iron and Steel products means the following products made primarily of iron or steel: lined or unlined pipes and fittings, manhole covers and other municipal castings, hydrants, tanks, flanges, pipe clamps and restraints, valves, structural steel, reinforced precast concrete, and construction materials. The RECIPIENT may request waiver from this requirement from the Administrator of the Environmental Protection Agency. The RECIPIENT must coordinate all waiver requests through ECOLOGY. This provision does not apply if the engineering plans and specifications for the project were approved by ECOLOGY prior to January 17, 2014. ECOLOGY reserves the right to request documentation of RECIPIENT’S compliance with this provision. C. Authority of RECIPIENT: This agreement is authorized by the Constitution and laws of the state of Washington, including the RECIPIENT’s authority, and by the RECIPIENT pursuant to the authorizing ordinance or resolution. The RECIPIENT shall submit a copy of the authorizing ordinance or resolution to the ECOLOGY Financial Manager before this agreement shall be signed by ECOLOGY. D. Fiscal Sustainability Plan Certification: The RECIPIENT shall submit a completed Fiscal Sustainability Plan Certification before this agreement is signed by ECOLOGY. The Fiscal Sustainability Plan Certification is available from the ECOLOGY Financial Manager or on the Water Quality Program website. E. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the RECIPIENT agrees to comply with the EPA SRF Signage Guidance in order to enhance public awareness of EPA assistance agreements nationwide. The signage guidance can be found at: http://www.ecy.wa.gov/programs/wq/funding/FundPrgms/CWSRF/SignageGuidanceJune2015.pdf. F. Free Service: The RECIPIENT shall not furnish utility service to any customer free of charge if providing that free service affects the RECIPIENT's ability to meet the obligations of this agreement. G. Insurance: The RECIPIENT shall at all times carry fire and extended coverage, public liability, and property damage, and such other forms of insurance with responsible insurers and with policies payable to the RECIPIENT on such of the buildings, equipment, works, plants, facilities, and properties of the Utility as are ordinarily carried by municipal or privately-owned utilities engaged in the operation of like systems, and against such claims for damages as are ordinarily carried by municipal or privately-owned utilities engaged in the operation of like systems, or it shall self-insure or participate in an insurance pool or pools with reserves adequate, in the reasonable judgment of the RECIPIENT, to protect it against loss. H. Loan Interest Rate and Terms: This loan agreement shall remain in effect until the date of final repayment of the loan, unless terminated earlier according to the provisions herein. Version 10/30/2015 AGENDA ITEM #8. g) Page 22 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton When the Project Completion Date has occurred, ECOLOGY and the RECIPIENT shall execute an amendment to this loan agreement which details the final loan amount (Final Loan Amount), and ECOLOGY shall prepare a final loan repayment schedule. The Final Loan Amount shall be the combined total of actual disbursements made on the loan and all accrued interest to the computation date. The Estimated Loan Amount and the Final Loan Amount (in either case, as applicable, a “Loan Amount”) shall bear interest based on the interest rate identified in this agreement as the “Effective Interest Rate,” per annum, calculated on the basis of a 365 day year. Interest on the Estimated Loan Amount shall accrue from and be compounded monthly based on the date that each payment is mailed to the RECIPIENT. The Final Loan Amount shall be repaid in equal installments semiannually over the term of this loan “Loan Term” as outlined in this agreement. I. Loan Repayment: Sources of Loan Repayment 1. Nature of RECIPIENT's Obligation. The obligation of the RECIPIENT to repay the loan from the sources identified below and to perform and observe all of the other agreements and obligations on its part contained herein shall be absolute and unconditional, and shall not be subject to diminution by setoff, counterclaim, or abatement of any kind. To secure the repayment of the loan from ECOLOGY, the RECIPIENT agrees to comply with all of the covenants, agreements, and attachments contained herein. 2. For General Obligation. This loan is a General Obligation Debt of the RECIPIENT. 3. For General Obligation Payable from Special Assessments. This loan is a General Obligation Debt of the RECIPIENT payable from special assessments to be imposed within the constitutional and statutory tax limitations provided by law without a vote of the electors of the RECIPIENT on all of the taxable property within the boundaries of the RECIPIENT. 4. For Revenue-Secured: Lien Position. This loan is a Revenue-Secured Debt of the RECIPIENT’s Utility. This loan shall constitute a lien and charge upon the Net Revenue junior and subordinate to the lien and charge upon such Net Revenue of any Senior Lien Obligations. In addition, if this loan is also secured by Utility Local Improvement Districts (ULID) Assessments, this loan shall constitute a lien upon ULID Assessments in the ULID prior and superior to any other charges whatsoever. 5. Other Sources of Repayment. The RECIPIENT may repay any portion of the loan from any funds legally available to it. 6. Defeasance of the Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT shall not be entitled to, and shall not affect, an economic Defeasance of the loan. The RECIPIENT shall not advance refund the loan. If the RECIPIENT defeases or advance refunds the loan, it shall be required to use the proceeds thereof immediately upon their receipt, together with other available RECIPIENT funds, to repay both of the following: (i) The Loan Amount with interest (ii) Any other obligations of the RECIPIENT to ECOLOGY under this agreement, unless in its sole discretion ECOLOGY finds that repayment from those additional sources would not be in the public interest. Version 10/30/2015 AGENDA ITEM #8. g) Page 23 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Failure to repay the Loan Amount plus interest within the time specified in ECOLOGY’s notice to make such repayment shall incur Late Charges and shall be treated as a Loan Default. 7. Refinancing or Early Repayment of the Project. So long as ECOLOGY shall hold this loan, the RECIPIENT shall give ECOLOGY thirty days written notice if the RECIPIENT intends to refinance or make early repayment of the loan. Method and Conditions on Repayments 1. Semiannual Payments. Notwithstanding any other provision of this agreement, the first semiannual payment of principal and interest on this loan shall be due and payable no later than one year after the project completion date or initiation of operation date, whichever comes first. Thereafter, equal payments shall be due every six months. If the due date for any semiannual payment falls on a Saturday, Sunday, or designated holiday for Washington State agencies, the payment shall be due on the next business day for Washington State agencies. Payments shall be mailed to: Department of Ecology Cashiering Unit P.O. Box 47611 Olympia WA 98504-7611 In lieu of mailing payments, electronic fund transfers can be arranged by working with ECOLOGY’s Financial Manager. No change to the amount of the semiannual principal and interest payments shall be made without a formal amendment to this agreement. The RECIPIENT shall continue to make semiannual payments based on this agreement until the amendment is effective, at which time the RECIPIENT’s payments shall be made pursuant to the amended agreement. 2. Late Charges. If any amount of the Final Loan Amount or any other amount owed to ECOLOGY pursuant to this agreement remains unpaid after it becomes due and payable, ECOLOGY may assess a late charge. The late charge shall be one percent per month on the past due amount starting on the date the debt becomes past due and until it is paid in full. 3. Repayment Limitations. Repayment of the loan is subject to the following additional limitations, among others: those on defeasance, refinancing and advance refunding, termination, and default and recovery of payments. 4. Prepayment of Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT may prepay the entire unpaid principal balance of and accrued interest on the loan or any portion of the remaining unpaid principal balance of the Loan Amount. Any prepayments on the loan shall be applied first to any accrued interest due and then to the outstanding principal balance of the Loan Amount. If the RECIPIENT elects to prepay the entire remaining unpaid balance and accrued interest, the RECIPIENT shall first contact ECOLOGY’s Revenue/Receivable Manager of the Fiscal Office. Version 10/30/2015 AGENDA ITEM #8. g) Page 24 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton J. Loan Security Due Regard: For loans secured with a Revenue Obligation: The RECIPIENT shall exercise due regard for Maintenance and Operation Expense and the debt service requirements of the Senior Lien Obligations and any other outstanding obligations pledging the Gross Revenue of the Utility, and it has not obligated itself to set aside and pay into the loan Fund a greater amount of the Gross Revenue of the Utility than, in its judgment, shall be available over and above such Maintenance and Operation Expense and those debt service requirements. Where collecting adequate gross utility revenue requires connecting additional users, the RECIPIENT shall require the sewer system connections necessary to meet debt obligations and expected operation and maintenance expenses. Levy and Collection of Taxes (if used to secure the repayment of the loan): For so long as the loan is outstanding, the RECIPIENT irrevocably pledges to include in its budget and levy taxes annually within the constitutional and statutory tax limitations provided by law without a vote of its electors on all of the taxable property within the boundaries of the RECIPIENT in an amount sufficient, together with other money legally available and to be used therefore, to pay when due the principal of and interest on the loan, and the full faith, credit and resources of the RECIPIENT are pledged irrevocably for the annual levy and collection of those taxes and the prompt payment of that principal and interest. Not an Excess Indebtedness: For loans secured with a general obligation pledge or a general obligation pledge on special assessments: The RECIPIENT agrees that this agreement and the loan to be made do not create an indebtedness of the RECIPIENT in excess of any constitutional or statutory limitations. Pledge of Net Revenue and ULID Assessments in the ULID (if used to secure the repayment of this loan): For so long as the loan is outstanding, the RECIPIENT irrevocably pledges the Net Revenue of the Utility, including applicable ULID Assessments in the ULID, to pay when due the principal of and interest on the loan. Reserve Requirement: For loans that are Revenue-Secured Debt with terms greater than five years, the RECIPIENT must accumulate a reserve for the loan equivalent to at least the Average Annual Debt Service on the loan during the first five years of the repayment period of the loan. This amount shall be deposited in a Reserve Account in the Loan Fund in approximately equal annual payments commencing within one year after the initiation of operation or the project completion date, whichever comes first. “Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, an account of that name created in the Loan Fund to secure the payment of the principal and interest on the loan. The amount on deposit in the Reserve Account may be applied by the RECIPIENT (1) to make, in part or in full, the final repayment to ECOLOGY of the loan amount or, (2) if not so applied, for any other lawful purpose of the RECIPIENT once the Loan Amount, plus interest and any other amounts owing to ECOLOGY, have been paid in full. Utility Local Improvement District (ULID) Assessment Collection (if used to secure the repayment of the loan): All ULID Assessments in the ULID shall be paid into the loan Fund and used to pay the principal of and interest on the loan. The ULID Assessments in the ULID may be deposited into the Reserve Account to satisfy a Reserve Requirement if a Reserve Requirement is applicable. K. Maintenance and Operation of a Funded Utility: The RECIPIENT shall at all times maintain and keep a funded Utility in good repair, working order and condition and also shall at all times operate the Utility and the business in an efficient manner and at a reasonable cost. L. Opinion of RECIPIENT’s Legal Counsel: The RECIPIENT must submit an “Opinion of Legal Counsel to the Version 10/30/2015 AGENDA ITEM #8. g) Page 25 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT” to ECOLOGY before this agreement shall be signed. ECOLOGY will provide the form. M. Prevailing Wage (Davis-Bacon Act): The RECIPIENT agrees, by signing this agreement, to comply with the Davis-Bacon Act prevailing wage requirements. This applies to the construction, alteration, and repair of treatment works carried out in whole or in part with assistance made available by the State Revolving Fund as authorized by Section 513, title VI of the Federal Water Pollution Control Act (33 U.S.C. 1372). Laborers and mechanics employed by contractors and subcontractors shall be paid wages not less often than once a week and at rates not less than those prevailing on projects of a character similar in the locality as determined by the Secretary of Labor. The RECIPIENT shall obtain the wage determination for the area in which the project is located prior to issuing requests for bids, proposals, quotes or other methods for soliciting contracts (solicitation). These wage determinations shall be incorporated into solicitations and any subsequent contracts. The RECIPIENT shall ensure that the required EPA contract language regarding Davis-Bacon Wages is in all contracts and sub contracts in excess of $2,000. The RECIPIENT shall maintain records sufficient to document compliance with the Davis-Bacon Act, and make such records available for review upon request. The RECIPIENT also agrees, by signing this agreement, to comply with State Prevailing Wages on Public Works, Chapter 39.12 RCW, as applicable. Compliance may include the determination whether the project involves “public work” and inclusion of the applicable prevailing wage rates in the bid specifications and contracts. The RECIPIENT agrees to maintain records sufficient to evidence compliance with Chapter 39.12 RCW, and make such records available for review upon request. N. Litigation; Authority: No litigation is now pending, or to the RECIPIENT’s knowledge, threatened, seeking to restrain, or enjoin: (i) the execution of this agreement; or (ii) the fixing or collection of the revenues, rates, and charges or the formation of the ULID and the levy and collection of ULID Assessments therein pledged to pay the principal of and interest on the loan (for revenue secured lien obligations); or (iii) the levy and collection of the taxes pledged to pay the principal of and interest on the loan (for general obligation-secured loans and general obligation payable from special-assessment-secured loans); or (iv) in any manner questioning the proceedings and authority under which the agreement, the loan, or the project are authorized. Neither the corporate existence or boundaries of the RECIPIENT nor the title of its present officers to their respective offices is being contested. No authority or proceeding for the execution of this agreement has been repealed, revoked, or rescinded. O. Representations and Warranties: The RECIPIENT represents and warrants to ECOLOGY as follows: Application: Material Information. All information and materials submitted by the RECIPIENT to ECOLOGY in connection with its loan application were, when made, and are, as of the date the RECIPIENT signs this agreement, true and correct. There is no material adverse information relating to the RECIPIENT, the project, the loan, or this agreement known to the RECIPIENT which has not been disclosed in writing to ECOLOGY. Existence; Authority. It is a duly formed and legally existing municipal corporation or political subdivision of the Version 10/30/2015 AGENDA ITEM #8. g) Page 26 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton state of Washington or a federally recognized Indian Tribe. It has full corporate power and authority to execute, deliver, and perform all of its obligations under this agreement and to undertake the project identified herein. Certification. Each payment request shall constitute a certification by the RECIPIENT to the effect that all representations and warranties made in this loan agreement remain true as of the date of the request and that no adverse developments, affecting the financial condition of the RECIPIENT or its ability to complete the project or to repay the principal of or interest on the loan, have occurred since the date of this loan agreement. Any changes in the RECIPIENT’s financial condition shall be disclosed in writing to ECOLOGY by the RECIPIENT in its request for payment. P. Sale or Disposition of Utility: The RECIPIENT shall not sell, transfer, or otherwise dispose of any of the works, plant, properties, facilities, or other part of the Utility or any real or personal property comprising a part of the Utility unless: 1. The facilities or property transferred are not material to the operation of the Utility, or have become unserviceable, inadequate, obsolete, or unfit to be used in the operation of the Utility or are no longer necessary, material, or useful to the operation of the Utility; or 2. The aggregate depreciated cost value of the facilities or property being transferred in any fiscal year comprises no more than three percent of the total assets of the Utility; or 3. The RECIPIENT receives from the transferee an amount equal to an amount which will be in the same proportion to the net amount of Senior Lien Obligations and this LOAN then outstanding (defined as the total amount outstanding less the amount of cash and investments in the bond and loan funds securing such debt) as the Gross Revenue of the Utility from the portion of the Utility sold or disposed of for the preceding year bears to the total Gross Revenue for that period. 4. Expressed written agreement by the DEPARTMENT. The proceeds of any transfer under this paragraph must be used (1) to redeem promptly, or irrevocably set aside for the redemption of, Senior Lien Obligations and to redeem promptly the loan, and (2) to provide for part of the cost of additions to and betterments and extensions of the Utility. Q. Sewer-Use Ordinance or Resolution: If not already in existence, the RECIPIENT shall adopt and shall enforce a sewer-use ordinance or resolution. Such ordinance or resolution shall be submitted to ECOLOGY upon request. The sewer use ordinance must include provisions to: 1) Prohibit the introduction of toxic or hazardous wastes into the RECIPIENT’s sewer system. 2) Prohibit inflow of stormwater. 3) Require that new sewers and connections be properly designed and constructed. R. Termination and Default: Termination and Default Events 1. For Insufficient ECOLOGY or RECIPIENT Funds. ECOLOGY may terminate this loan agreement for insufficient ECOLOGY or RECIPIENT funds. Version 10/30/2015 AGENDA ITEM #8. g) Page 27 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton 2. For Failure to Commence Work. ECOLOGY may terminate this loan agreement for failure of the RECIPIENT to commence project work. 3. Past Due Payments. The RECIPIENT shall be in default of its obligations under this loan agreement when any loan repayment becomes 60 days past due. 4. Other Cause. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance in full by the RECIPIENT of all of its obligations under this loan agreement. The RECIPIENT shall be in default of its obligations under this loan agreement if, in the opinion of ECOLOGY, the RECIPIENT has unjustifiably failed to perform any obligation required of it by this loan agreement. Procedures for Termination. If this loan agreement is terminated prior to project completion, ECOLOGY shall provide to the RECIPIENT a written notice of termination at least five working days prior to the effective date of termination (the “Termination Date”). The written notice of termination by the ECOLOGY shall specify the Termination Date and, when applicable, the date by which the RECIPIENT must repay any outstanding balance of the loan and all accrued interest (the “Termination Payment Date”). Termination and Default Remedies No Further Payments. On and after the Termination Date, or in the event of a default event, ECOLOGY may, at its sole discretion, withdraw the loan and make no further payments under this agreement. Repayment Demand. In response to an ECOLOGY initiated termination event, or in response to a loan default event, ECOLOGY may at its sole discretion demand that the RECIPIENT repay the outstanding balance of the Loan Amount and all accrued interest. Interest after Repayment Demand. From the time that ECOLOGY demands repayment of funds, amounts owed by the RECIPIENT to ECOLOGY shall accrue additional interest at the rate of one percent per month, or fraction thereof. Accelerate Repayments. In the event of a default, ECOLOGY may, in its sole discretion, declare the principal of and interest on the loan immediately due and payable, subject to the prior lien and charge of any outstanding Senior Lien Obligation upon the Net Revenue. That is, the loan is not subject to acceleration so long as any Senior Lien Obligations are outstanding. Repayments not made immediately upon such acceleration will incur Late Charges. Late Charges. All amounts due to ECOLOGY and not paid by the RECIPIENT by the Termination Payment Date or after acceleration following a default event, as applicable, shall incur late charges. Intercept State Funds. In the event of a default event and in accordance with Chapter 90.50A.060 RCW, “Defaults,” any state funds otherwise due to the RECIPIENT may, at ECOLOGY’s sole discretion, be withheld and applied to the repayment of the loan. Property to ECOLOGY. In the event of a default event and at the option of ECOLOGY, any personal property (equipment) acquired under this agreement may, in ECOLOGY’s sole discretion, become ECOLOGY’s property. In that circumstance, ECOLOGY shall reduce the RECIPIENT’s liability to repay money by an amount reflecting the fair value of such property. Version 10/30/2015 AGENDA ITEM #8. g) Page 28 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton Documents and Materials. If this agreement is terminated, all finished or unfinished documents, data studies, surveys, drawings, maps, models, photographs, and reports or other materials prepared by the RECIPIENT shall, at the option of ECOLOGY, become ECOLOGY property. The RECIPIENT shall be entitled to receive just and equitable compensation for any satisfactory work completed on such documents and other materials. Collection and Enforcement Actions. In the event of a default event, the state of Washington reserves the right to take any actions it deems necessary to collect the amounts due, or to become due, or to enforce the performance and observance of any obligation by the RECIPIENT, under this agreement. Fees and Expenses. In any action to enforce the provisions of this agreement, reasonable fees and expenses of attorneys and other reasonable expenses (including, without limitation, the reasonably allocated costs of legal staff) shall be awarded to the prevailing party as that term is defined in Chapter 4.84.330 RCW. Damages. Notwithstanding ECOLOGY’s exercise of any or all of the termination or default remedies provided in this agreement, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by ECOLOGY and/or the state of Washington because of any breach of this agreement by the RECIPIENT. ECOLOGY may withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from the RECIPIENT is determined. S. User-Charge System: The RECIPIENT certifies that it has the legal authority to establish and implement a user-charge system and shall adopt a system of user-charges to assure that each user of the utility shall pay its proportionate share of the cost of operation and maintenance, including replacement during the design life of the project. In addition, the RECIPIENT shall regularly evaluate the user-charge system, at least annually, to ensure the system provides adequate revenues necessary to operate and maintain the utility, to establish a reserve to pay for replacement, to establish the required Loan Reserve Account, and to repay the loan. WATER QUALITY COMBINED FINANCIAL ASSISTANCE TERMS AND CONDITIONS LAST UPDATED ON 10/04/2016 GENERAL FEDERAL CONDITIONS If a portion or all of the funds for this agreement are provided through federal funding sources or this agreement is used to match a federal grant award, the following terms and conditions apply to you. A. CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY EXCLUSION: 1.The RECIPIENT/CONTRACTOR, by signing this agreement, certifies that it is not suspended, debarred, proposed for debarment, declared ineligible or otherwise excluded from contracting with the federal government, or from receiving contracts paid for with federal funds. If the RECIPIENT/CONTRACTOR is unable to certify to the statements contained in the certification, they must provide an explanation as to why they cannot. 2.The RECIPIENT/CONTRACTOR shall provide immediate written notice to ECOLOGY if at any time the RECIPIENT/CONTRACTOR learns that its certification was erroneous when submitted or had become erroneous by reason of changed circumstances. 3.The terms covered transaction, debarred, suspended, ineligible, lower tier covered transaction, participant, Version 10/30/2015 AGENDA ITEM #8. g) Page 29 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton person, primary covered transaction, principal, proposal, and voluntarily excluded, as used in this clause, have the meaning set out in the Definitions and Coverage sections of rules implementing Executive Order 12549. You may contact ECOLOGY for assistance in obtaining a copy of those regulations. 4.The RECIPIENT/CONTRACTOR agrees it shall not knowingly enter into any lower tier covered transaction with a person who is proposed for debarment under the applicable Code of Federal Regulations, debarred, suspended, declared ineligible, or voluntarily excluded from participation in this covered transaction. 5.The RECIPIENT/CONTRACTOR further agrees by signing this agreement, that it will include this clause titled “CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY EXCLUSION” without modification in all lower tier covered transactions and in all solicitations for lower tier covered transactions. 6.Pursuant to 2CFR180.330, the RECIPIENT/CONTRACTOR is responsible for ensuring that any lower tier covered transaction complies with certification of suspension and debarment requirements. 7.RECIPIENT/CONTRACTOR acknowledges that failing to disclose the information required in the Code of Federal Regulations may result in the delay or negation of this funding agreement, or pursuance of legal remedies, including suspension and debarment. 8.RECIPIENT/CONTRACTOR agrees to keep proof in its agreement file, that it, and all lower tier recipients or contractors, are not suspended or debarred, and will make this proof available to ECOLOGY before requests for reimbursements will be approved for payment. RECIPIENT/CONTRACTOR must run a search in <http://www.sam.gov> and print a copy of completed searches to document proof of compliance. B. FEDERAL FUNDING ACCOUNTABILITY AND TRANSPARENCY ACT (FFATA) REPORTING REQUIREMENTS: CONTRACTOR/RECIPIENT must complete the FFATA Data Collection Form (ECY 070-395) and return it with the signed agreement to ECOLOGY. Any CONTRACTOR/RECIPIENT that meets each of the criteria below must report compensation for its five top executives using the FFATA Data Collection Form. ·Receives more than $25,000 in federal funds under this award. ·Receives more than 80 percent of its annual gross revenues from federal funds. ·Receives more than $25,000,000 in annual federal funds. Ecology will not pay any invoices until it has received a completed and signed FFATA Data Collection Form. Ecology is required to report the FFATA information for federally funded agreements, including the required DUNS number, at www.fsrs.gov <http://www.fsrs.gov/> within 30 days of agreement signature. The FFATA information will be available to the public at www.usaspending.gov <http://www.usaspending.gov/>. For more details on FFATA requirements, see www.fsrs.gov <http://www.fsrs.gov/>. Version 10/30/2015 AGENDA ITEM #8. g) Page 30 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton GENERAL TERMS AND CONDITIONS Pertaining to Grant and Loan Agreements With the state of Washington, Department of Ecology GENERAL TERMS AND CONDITIONS AS OF LAST UPDATED 1/22/2018 VERSION 1.ADMINISTRATIVE REQUIREMENTS a)RECIPIENT shall follow the "Administrative Requirements for Recipients of Ecology Grants and Loans – EAGL Edition." (https://fortress.wa.gov/ecy/publications/SummaryPages/1701004.html) b)RECIPIENT shall complete all activities funded by this Agreement and be fully responsible for the proper management of all funds and resources made available under this Agreement. c)RECIPIENT agrees to take complete responsibility for all actions taken under this Agreement, including ensuring all subgrantees and contractors comply with the terms and conditions of this Agreement. ECOLOGY reserves the right to request proof of compliance by subgrantees and contractors. d)RECIPIENT’s activities under this Agreement shall be subject to the review and approval by ECOLOGY for the extent and character of all work and services. 2.AMENDMENTS AND MODIFICATIONS This Agreement may be altered, amended, or waived only by a written amendment executed by both parties. No subsequent modification(s) or amendment(s) of this Agreement will be of any force or effect unless in writing and signed by authorized representatives of both parties. ECOLOGY and the RECIPIENT may change their respective staff contacts and administrative information without the concurrence of either party. 3.ARCHAEOLOGICAL AND CULTURAL RESOURCES RECIPIENT shall take reasonable action to avoid, minimize, or mitigate adverse effects to archeological and historic resources. The RECIPIENT must agree to hold harmless the State of Washington in relation to any claim related to historical or cultural artifacts discovered, disturbed, or damaged due to the RECIPIENT’s project funded under this Agreement. RECIPIENT shall: a)Contact the ECOLOGY Program issuing the grant or loan to discuss any Cultural Resources requirements for their project: •For capital construction projects or land acquisitions for capital construction projects, if required, comply with Governor Executive Order 05-05, Archaeology and Cultural Resources. •For projects with any federal involvement, if required, comply with the National Historic Preservation Act. •Any cultural resources federal or state requirements must be completed prior to the start of any work on the project site. b)If required by the ECOLOGY Program, submit an Inadvertent Discovery Plan (IDP) to ECOLOGY prior to implementing any project that involves ground disturbing activities. ECOLOGY will provide the IDP form. RECIPIENT shall: •Keep the IDP at the project site. •Make the IDP readily available to anyone working at the project site. •Discuss the IDP with staff and contractors working at the project site. •Implement the IDP when cultural resources or human remains are found at the project site. c)If any archeological or historic resources are found while conducting work under this Agreement: •Immediately stop work and notify the ECOLOGY Program, the Department of Archaeology and Historic Preservation at (360) 586-3064, any affected Tribe, and the local government. d)If any human remains are found while conducting work under this Agreement: Version 10/30/2015 AGENDA ITEM #8. g) Page 31 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton •Immediately stop work and notify the local Law Enforcement Agency or Medical Examiner/Coroner’s Office, and then the ECOLOGY Program. e)Comply with RCW 27.53, RCW 27.44.055, and RCW 68.50.645, and all other applicable local, state, and federal laws protecting cultural resources and human remains. 4.ASSIGNMENT No right or claim of the RECIPIENT arising under this Agreement shall be transferred or assigned by the RECIPIENT. 5.COMMUNICATION RECIPIENT shall make every effort to maintain effective communications with the RECIPIENT's designees, ECOLOGY, all affected local, state, or federal jurisdictions, and any interested individuals or groups. 6.COMPENSATION a)Any work performed prior to effective date of this Agreement will be at the sole expense and risk of the RECIPIENT. ECOLOGY must sign the Agreement before any payment requests can be submitted. b)Payments will be made on a reimbursable basis for approved and completed work as specified in this Agreement. c)RECIPIENT is responsible to determine if costs are eligible. Any questions regarding eligibility should be clarified with ECOLOGY prior to incurring costs. Costs that are conditionally eligible require approval by ECOLOGY prior to expenditure. d)RECIPIENT shall not invoice more than once per month unless agreed on by ECOLOGY. e)ECOLOGY will not process payment requests without the proper reimbursement forms, Progress Report and supporting documentation. ECOLOGY will provide instructions for submitting payment requests. f)ECOLOGY will pay the RECIPIENT thirty (30) days after receipt of a properly completed request for payment. g)RECIPIENT will receive payment through Washington State Department of Enterprise Services’ Statewide Payee Desk. RECIPIENT must register as a payee by submitting a Statewide Payee Registration form and an IRS W-9 form at the website, http://www.des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. For any questions about the vendor registration process contact the Statewide Payee Help Desk at (360) 407-8180 or email payeehelpdesk@watech.wa.gov. h)ECOLOGY may, at its sole discretion, withhold payments claimed by the RECIPIENT if the RECIPIENT fails to satisfactorily comply with any term or condition of this Agreement. i)Monies withheld by ECOLOGY may be paid to the RECIPIENT when the work described herein, or a portion thereof, has been completed if, at ECOLOGY's sole discretion, such payment is reasonable and approved according to this Agreement, as appropriate, or upon completion of an audit as specified herein. j)RECIPIENT must submit within thirty (30) days after the expiration date of this Agreement, all financial, performance, and other reports required by this agreement. Failure to comply may result in delayed reimbursement. 7.COMPLIANCE WITH ALL LAWS RECIPIENT agrees to comply fully with all applicable federal, state and local laws, orders, regulations, and permits related to this Agreement, including but not limited to: a)RECIPIENT agrees to comply with all applicable laws, regulations, and policies of the United States and the State of Washington which affect wages and job safety. b)RECIPIENT agrees to be bound by all applicable federal and state laws, regulations, and policies against discrimination. c)RECIPIENT certifies full compliance with all applicable state industrial insurance requirements. d)RECIPIENT agrees to secure and provide assurance to ECOLOGY that all the necessary approvals and permits required by authorities having jurisdiction over the project are obtained. RECIPIENT must include time in their project timeline for the permit and approval processes. Version 10/30/2015 AGENDA ITEM #8. g) Page 32 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton ECOLOGY shall have the right to immediately terminate for cause this Agreement as provided herein if the RECIPIENT fails to comply with above requirements. If any provision of this Agreement violates any statute or rule of law of the state of Washington, it is considered modified to conform to that statute or rule of law. 8.CONFLICT OF INTEREST RECIPIENT and ECOLOGY agree that any officer, member, agent, or employee, who exercises any function or responsibility in the review, approval, or carrying out of this Agreement, shall not have any personal or financial interest, direct or indirect, nor affect the interest of any corporation, partnership, or association in which he/she is a part, in this Agreement or the proceeds thereof. 9.CONTRACTING FOR GOODS AND SERVICES RECIPIENT may contract to buy goods or services related to its performance under this Agreement. RECIPIENT shall award all contracts for construction, purchase of goods, equipment, services, and professional architectural and engineering services through a competitive process, if required by State law. RECIPIENT is required to follow procurement procedures that ensure legal, fair, and open competition. RECIPIENT must have a standard procurement process or follow current state procurement procedures. RECIPIENT may be required to provide written certification that they have followed their standard procurement procedures and applicable state law in awarding contracts under this Agreement. ECOLOGY reserves the right to inspect and request copies of all procurement documentation, and review procurement practices related to this Agreement. Any costs incurred as a result of procurement practices not in compliance with state procurement law or the RECIPIENT's normal procedures may be disallowed at ECOLOGY’s sole discretion. 10.DISPUTES When there is a dispute with regard to the extent and character of the work, or any other matter related to this Agreement the determination of ECOLOGY will govern, although the RECIPIENT shall have the right to appeal decisions as provided for below: a)RECIPIENT notifies the funding program of an appeal request. b)Appeal request must be in writing and state the disputed issue(s). c)RECIPIENT has the opportunity to be heard and offer evidence in support of its appeal. d)ECOLOGY reviews the RECIPIENT’s appeal. e)ECOLOGY sends a written answer within ten (10) business days, unless more time is needed, after concluding the review. The decision of ECOLOGY from an appeal will be final and conclusive, unless within thirty (30) days from the date of such decision, the RECIPIENT furnishes to the Director of ECOLOGY a written appeal. The decision of the Director or duly authorized representative will be final and conclusive. The parties agree that this dispute process will precede any action in a judicial or quasi-judicial tribunal. Appeals of the Director's decision will be brought in the Superior Court of Thurston County. Review of the Director’s decision will not be taken to Environmental and Land Use Hearings Office. Pending final decision of a dispute, the RECIPIENT agrees to proceed diligently with the performance of this Agreement and in accordance with the decision rendered. Nothing in this Agreement will be construed to limit the parties’ choice of another mutually acceptable method, in addition to the dispute resolution procedure outlined above. 11.ENVIRONMENTAL DATA STANDARDS a)RECIPIENT shall prepare a Quality Assurance Project Plan (QAPP) for a project that collects or uses environmental measurement data. RECIPIENTS unsure about whether a QAPP is required for their project shall contact Version 10/30/2015 AGENDA ITEM #8. g) Page 33 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton the ECOLOGY Program issuing the grant or loan. If a QAPP is required, the RECIPIENT shall: •Use ECOLOGY’s QAPP Template/Checklist provided by the ECOLOGY, unless ECOLOGY Quality Assurance (QA) officer or the Program QA coordinator instructs otherwise. •Follow ECOLOGY’s Guidelines for Preparing Quality Assurance Project Plans for Environmental Studies, July 2004 (Ecology Publication No. 04-03-030). •Submit the QAPP to ECOLOGY for review and approval before the start of the work. b)RECIPIENT shall submit environmental data that was collected on a project to ECOLOGY using the Environmental Information Management system (EIM), unless the ECOLOGY Program instructs otherwise. The RECIPIENT must confirm with ECOLOGY that complete and correct data was successfully loaded into EIM, find instructions at: http://www.ecy.wa.gov/eim. c)RECIPIENT shall follow ECOLOGY’s data standards when Geographic Information System (GIS) data is collected and processed. Guidelines for Creating and Accessing GIS Data are available at: https://ecology.wa.gov/Research-Data/Data-resources/Geographic-Information-Systems-GIS/Standards. RECIPIENT, when requested by ECOLOGY, shall provide copies to ECOLOGY of all final GIS data layers, imagery, related tables, raw data collection files, map products, and all metadata and project documentation. 12.GOVERNING LAW This Agreement will be governed by the laws of the State of Washington, and the venue of any action brought hereunder will be in the Superior Court of Thurston County. 13.INDEMNIFICATION ECOLOGY will in no way be held responsible for payment of salaries, consultant's fees, and other costs related to the project described herein, except as provided in the Scope of Work. To the extent that the Constitution and laws of the State of Washington permit, each party will indemnify and hold the other harmless from and against any liability for any or all injuries to persons or property arising from the negligent act or omission of that party or that party's agents or employees arising out of this Agreement. 14.INDEPENDENT STATUS The employees, volunteers, or agents of each party who are engaged in the performance of this Agreement will continue to be employees, volunteers, or agents of that party and will not for any purpose be employees, volunteers, or agents of the other party. 15.KICKBACKS RECIPIENT is prohibited from inducing by any means any person employed or otherwise involved in this Agreement to give up any part of the compensation to which he/she is otherwise entitled to or receive any fee, commission, or gift in return for award of a subcontract hereunder. 16.MINORITY AND WOMEN’S BUSINESS ENTERPRISES (MWBE) RECIPIENT is encouraged to solicit and recruit, to the extent possible, certified minority-owned (MBE) and women-owned (WBE) businesses in purchases and contracts initiated under this Agreement. Contract awards or rejections cannot be made based on MWBE participation; however, the RECIPIENT is encouraged to take the following actions, when possible, in any procurement under this Agreement: a)Include qualified minority and women's businesses on solicitation lists whenever they are potential sources of goods or services. b)Divide the total requirements, when economically feasible, into smaller tasks or quantities, to permit maximum participation by qualified minority and women's businesses. c)Establish delivery schedules, where work requirements permit, which will encourage participation of qualified Version 10/30/2015 AGENDA ITEM #8. g) Page 34 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton minority and women's businesses. d)Use the services and assistance of the Washington State Office of Minority and Women's Business Enterprises (OMWBE) (866-208-1064) and the Office of Minority Business Enterprises of the U.S. Department of Commerce, as appropriate. 17.ORDER OF PRECEDENCE In the event of inconsistency in this Agreement, unless otherwise provided herein, the inconsistency shall be resolved by giving precedence in the following order: (a) applicable federal and state statutes and regulations; (b) The Agreement; (c) Scope of Work; (d) Special Terms and Conditions; (e) Any provisions or terms incorporated herein by reference, including the "Administrative Requirements for Recipients of Ecology Grants and Loans"; and (f) the General Terms and Conditions. 18.PRESENTATION AND PROMOTIONAL MATERIALS ECOLOGY reserves the right to approve RECIPIENT’s communication documents and materials related to the fulfillment of this Agreement: a)If requested, RECIPIENT shall provide a draft copy to ECOLOGY for review and approval ten (10) business days prior to production and distribution. b)RECIPIENT shall include time for ECOLOGY’s review and approval process in their project timeline. c)If requested, RECIPIENT shall provide ECOLOGY two (2) final copies and an electronic copy of any tangible products developed. Copies include any printed materials, and all tangible products developed such as brochures, manuals, pamphlets, videos, audio tapes, CDs, curriculum, posters, media announcements, or gadgets with a message, such as a refrigerator magnet, and any online communications, such as web pages, blogs, and twitter campaigns. If it is not practical to provide a copy, then the RECIPIENT shall provide a description (photographs, drawings, printouts, etc.) that best represents the item. Any communications intended for public distribution that uses ECOLOGY’s logo shall comply with ECOLOGY’s graphic requirements and any additional requirements specified in this Agreement. Before the use of ECOLOGY’s logo contact ECOLOGY for guidelines. RECIPIENT shall acknowledge in the communications that funding was provided by ECOLOGY. 19.PROGRESS REPORTING a)RECIPIENT must satisfactorily demonstrate the timely use of funds by submitting payment requests and progress reports to ECOLOGY. ECOLOGY reserves the right to amend or terminate this Agreement if the RECIPIENT does not document timely use of funds. b)RECIPIENT must submit a progress report with each payment request. Payment requests will not be processed without a progress report. ECOLOGY will define the elements and frequency of progress reports. c)RECIPIENT shall use ECOLOGY’s provided progress report format. d)Quarterly progress reports will cover the periods from January 1 through March 31, April 1 through June 30, July 1 through September 30, and October 1 through December 31. Reports shall be submitted within thirty (30) days after the end of the quarter being reported. e)RECIPIENT must submit within thirty (30) days of the expiration date of the project, unless an extension has been approved by ECOLOGY, all financial, performance, and other reports required by the agreement and funding program guidelines. RECIPIENT shall use the ECOLOGY provided closeout report format. 20.PROPERTY RIGHTS a)Copyrights and Patents. When the RECIPIENT creates any copyrightable materials or invents any patentable property under this Agreement, the RECIPIENT may copyright or patent the same but ECOLOGY retains a royalty free, nonexclusive, and irrevocable license to reproduce, publish, recover, or otherwise use the material(s) or property, and to Version 10/30/2015 AGENDA ITEM #8. g) Page 35 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton authorize others to use the same for federal, state, or local government purposes. b)Publications. When the RECIPIENT or persons employed by the RECIPIENT use or publish ECOLOGY information; present papers, lectures, or seminars involving information supplied by ECOLOGY; or use logos, reports, maps, or other data in printed reports, signs, brochures, pamphlets, etc., appropriate credit shall be given to ECOLOGY. c)Presentation and Promotional Materials. ECOLOGY shall have the right to use or reproduce any printed or graphic materials produced in fulfillment of this Agreement, in any manner ECOLOGY deems appropriate. ECOLOGY shall acknowledge the RECIPIENT as the sole copyright owner in every use or reproduction of the materials. d)Tangible Property Rights. ECOLOGY's current edition of "Administrative Requirements for Recipients of Ecology Grants and Loans," shall control the use and disposition of all real and personal property purchased wholly or in part with funds furnished by ECOLOGY in the absence of state and federal statutes, regulations, or policies to the contrary, or upon specific instructions with respect thereto in this Agreement. e)Personal Property Furnished by ECOLOGY. When ECOLOGY provides personal property directly to the RECIPIENT for use in performance of the project, it shall be returned to ECOLOGY prior to final payment by ECOLOGY. If said property is lost, stolen, or damaged while in the RECIPIENT's possession, then ECOLOGY shall be reimbursed in cash or by setoff by the RECIPIENT for the fair market value of such property. f)Acquisition Projects. The following provisions shall apply if the project covered by this Agreement includes funds for the acquisition of land or facilities: 1.RECIPIENT shall establish that the cost is fair value and reasonable prior to disbursement of funds provided for in this Agreement. 2.RECIPIENT shall provide satisfactory evidence of title or ability to acquire title for each parcel prior to disbursement of funds provided by this Agreement. Such evidence may include title insurance policies, Torrens certificates, or abstracts, and attorney's opinions establishing that the land is free from any impediment, lien, or claim which would impair the uses intended by this Agreement. g)Conversions. Regardless of the Agreement expiration date, the RECIPIENT shall not at any time convert any equipment, property, or facility acquired or developed under this Agreement to uses other than those for which assistance was originally approved without prior written approval of ECOLOGY. Such approval may be conditioned upon payment to ECOLOGY of that portion of the proceeds of the sale, lease, or other conversion or encumbrance which monies granted pursuant to this Agreement bear to the total acquisition, purchase, or construction costs of such property. 21.RECORDS, AUDITS, AND INSPECTIONS RECIPIENT shall maintain complete program and financial records relating to this Agreement, including any engineering documentation and field inspection reports of all construction work accomplished. All records shall: a)Be kept in a manner which provides an audit trail for all expenditures. b)Be kept in a common file to facilitate audits and inspections. c)Clearly indicate total receipts and expenditures related to this Agreement. d)Be open for audit or inspection by ECOLOGY, or by any duly authorized audit representative of the State of Washington, for a period of at least three (3) years after the final grant payment or loan repayment, or any dispute resolution hereunder. RECIPIENT shall provide clarification and make necessary adjustments if any audits or inspections identify discrepancies in the records. ECOLOGY reserves the right to audit, or have a designated third party audit, applicable records to ensure that the state has been properly invoiced. Any remedies and penalties allowed by law to recover monies determined owed will be enforced. Repetitive instances of incorrect invoicing or inadequate records may be considered cause for termination. All work performed under this Agreement and any property and equipment purchased shall be made available to ECOLOGY and to any authorized state, federal or local representative for inspection at any time during the course of Version 10/30/2015 AGENDA ITEM #8. g) Page 36 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton this Agreement and for at least three (3) years following grant or loan termination or dispute resolution hereunder. RECIPIENT shall provide right of access to ECOLOGY, or any other authorized representative, at all reasonable times, in order to monitor and evaluate performance, compliance, and any other conditions under this Agreement. 22.RECOVERY OF FUNDS The right of the RECIPIENT to retain monies received as reimbursement payments is contingent upon satisfactory performance of this Agreement and completion of the work described in the Scope of Work. All payments to the RECIPIENT are subject to approval and audit by ECOLOGY, and any unauthorized expenditure(s) or unallowable cost charged to this Agreement shall be refunded to ECOLOGY by the RECIPIENT. RECIPIENT shall refund to ECOLOGY the full amount of any erroneous payment or overpayment under this Agreement. RECIPIENT shall refund by check payable to ECOLOGY the amount of any such reduction of payments or repayments within thirty (30) days of a written notice. Interest will accrue at the rate of twelve percent (12%) per year from the time ECOLOGY demands repayment of funds. Any property acquired under this Agreement, at the option of ECOLOGY, may become ECOLOGY's property and the RECIPIENT's liability to repay monies will be reduced by an amount reflecting the fair value of such property. 23.SEVERABILITY If any provision of this Agreement or any provision of any document incorporated by reference shall be held invalid, such invalidity shall not affect the other provisions of this Agreement which can be given effect without the invalid provision, and to this end the provisions of this Agreement are declared to be severable. 24.STATE ENVIRONMENTAL POLICY ACT (SEPA) RECIPIENT must demonstrate to ECOLOGY’s satisfaction that compliance with the requirements of the State Environmental Policy Act (Chapter 43.21C RCW and Chapter 197-11 WAC) have been or will be met. Any reimbursements are subject to this provision. 25.SUSPENSION When in the best interest of ECOLOGY, ECOLOGY may at any time, and without cause, suspend this Agreement or any portion thereof for a temporary period by written notice from ECOLOGY to the RECIPIENT. RECIPIENT shall resume performance on the next business day following the suspension period unless another day is specified by ECOLOGY. 26.SUSTAINABLE PRACTICES In order to sustain Washington’s natural resources and ecosystems, the RECIPIENT is fully encouraged to implement sustainable practices and to purchase environmentally preferable products under this Agreement. a)Sustainable practices may include such activities as: use of clean energy, use of double-sided printing, hosting low impact meetings, and setting up recycling and composting programs. b)Purchasing may include such items as: sustainably produced products and services, EPEAT registered computers and imaging equipment, independently certified green cleaning products, remanufactured toner cartridges, products with reduced packaging, office products that are refillable, rechargeable, and recyclable, and 100% post-consumer recycled paper. For more suggestions visit ECOLOGY’s web page: Green Purchasing, , https://ecology.wa.gov/Regulations-Permits/Guidance-technical-assistance/Sustainable-purchasing. 27.TERMINATION a)For Cause ECOLOGY may terminate for cause this Agreement with a seven (7) calendar days prior written notification to the Version 10/30/2015 AGENDA ITEM #8. g) Page 37 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton RECIPIENT, at the sole discretion of ECOLOGY, for failing to perform an Agreement requirement or for a material breach of any term or condition. If this Agreement is so terminated, the parties shall be liable only for performance rendered or costs incurred in accordance with the terms of this Agreement prior to the effective date of termination. Failure to Commence Work. ECOLOGY reserves the right to terminate this Agreement if RECIPIENT fails to commence work on the project funded within four (4) months after the effective date of this Agreement, or by any date mutually agreed upon in writing for commencement of work, or the time period defined within the Scope of Work. Non-Performance. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance by the RECIPIENT of all of its obligations under this Agreement. In the event the RECIPIENT unjustifiably fails, in the opinion of ECOLOGY, to perform any obligation required of it by this Agreement, ECOLOGY may refuse to pay any further funds, terminate in whole or in part this Agreement, and exercise any other rights under this Agreement. Despite the above, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by ECOLOGY and the State of Washington because of any breach of this Agreement by the RECIPIENT. ECOLOGY may withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from the RECIPIENT is determined. b)For Convenience ECOLOGY may terminate for convenience this Agreement, in whole or in part, for any reason when it is the best interest of ECOLOGY, with a thirty (30) calendar days prior written notification to the RECIPIENT, except as noted below. If this Agreement is so terminated, the parties shall be liable only for performance rendered or costs incurred in accordance with the terms of this Agreement prior to the effective date of termination. Non-Allocation of Funds. ECOLOGY’s ability to make payments is contingent on availability of funding. In the event funding from state, federal or other sources is withdrawn, reduced, or limited in any way after the effective date and prior to the completion or expiration date of this Agreement, ECOLOGY, at its sole discretion, may elect to terminate the Agreement, in whole or part, or renegotiate the Agreement, subject to new funding limitations or conditions. ECOLOGY may also elect to suspend performance of the Agreement until ECOLOGY determines the funding insufficiency is resolved. ECOLOGY may exercise any of these options with no notification or restrictions, although ECOLOGY will make a reasonable attempt to provide notice. In the event of termination or suspension, ECOLOGY will reimburse eligible costs incurred by the recipient/contractor through the effective date of termination or suspension. Reimbursed costs must be agreed to by ECOLOGY and the recipient/contractor. In no event shall ECOLOGY’s reimbursement exceed ECOLOGY’s total responsibility under the agreement and any amendments. If payments have been discontinued by ECOLOGY due to unavailable funds, the RECIPIENT shall not be obligated to repay monies which had been paid to the RECIPIENT prior to such termination. RECIPIENT’s obligation to continue or complete the work described in this Agreement shall be contingent upon availability of funds by the RECIPIENT's governing body. c)By Mutual Agreement ECOLOGY and the RECIPIENT may terminate this Agreement, in whole or in part, at any time, by mutual written agreement. d)In Event of Termination All finished or unfinished documents, data studies, surveys, drawings, maps, models, photographs, reports or other materials prepared by the RECIPIENT under this Agreement, at the option of ECOLOGY, will become property of ECOLOGY and the RECIPIENT shall be entitled to receive just and equitable compensation for any satisfactory work Version 10/30/2015 AGENDA ITEM #8. g) Page 38 of 38State of Washington Department of Ecology Agreement No: Project Title: Recipient Name: WQC-2017-Renton-00002 Heather Downs Detention Pond Water Quality Retrofit Project City of Renton completed on such documents and other materials. Nothing contained herein shall preclude ECOLOGY from demanding repayment of all funds paid to the RECIPIENT in accordance with Recovery of Funds, identified herein. 28.THIRD PARTY BENEFICIARY RECIPIENT shall ensure that in all subcontracts entered into by the RECIPIENT pursuant to this Agreement, the state of Washington is named as an express third party beneficiary of such subcontracts with full rights as such. 29.WAIVER Waiver of a default or breach of any provision of this Agreement is not a waiver of any subsequent default or breach, and will not be construed as a modification of the terms of this Agreement unless stated as such in writing by the authorized representative of ECOLOGY. Version 10/30/2015 AGENDA ITEM #8. g) AGENDA ITEM #8. g) 1  CITY OF RENTON, WASHINGTON    RESOLUTION NO. ________    A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, UPDATING AND  EXTENDING RENTON’S SIX‐YEAR TRANSPORTATION IMPROVEMENT PROGRAM  FOR 2019 – 2024.     WHEREAS, the City of Renton has adopted a Six‐Year Transportation Improvement  Program (“TIP”) pursuant to RCW 35.77.010 (Perpetual advanced six‐year plans for coordinated  transportation program expenditures), and the TIP has been updated, amended and modified  from time to time as authorized and required by law; and   WHEREAS, the City Council held a duly noticed public hearing on August 20, 2018,  for the  purpose of considering updates to the TIP; and   WHEREAS, the City Council has reviewed the work accomplished under the TIP,  considered any public testimony given at the public hearing held on August 20, 2018, considered  proposed updates to the TIP, and determined current City transportation needs;   NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO  RESOLVE AS FOLLOWS:   SECTION I. The City of Renton’s 2019‐2024 Six‐Year Transportation Improvement  Program, attached as Exhibit A and fully incorporated herein by this reference, is adopted as the  City’s updated and extended TIP.     SECTION II. The updated and extended TIP, as attached, shall be and constitute  Renton’s 2019‐2024 Six‐Year Transportation Improvement Program for purposes of compliance  with RCW 35.77.010, and shall remain in full force and effect until further revised, amended, and  modified as provided by law.  AGENDA ITEM # 10. a) RESOLUTION NO. ________  2   SECTION III. The Administrator of the Public Works Department and the City Clerk are  authorized and directed to file this resolution, together with Exhibit A, with the Washington State  Secretary of Transportation within 30 days of its adoption.  PASSED BY THE CITY COUNCIL this ____ day of _________________, 2018.                             Jason A. Seth, City Clerk    APPROVED BY THE MAYOR this ____ day of ___________________, 2018.                              Denis Law, Mayor    Approved as to form:              Shane Moloney, City Attorney    RES.1774:7/26/18:scr  AGENDA ITEM # 10. a)               EXHIBIT A      2019 – 2024   TRANSPORTATION IMPROVEMENT PROGRAM  AGENDA ITEM # 10. a) Transportation Improvement Program 2019—2024 | Six-Year Adopted August 2018 Department of Public Works Transportation Systems Division AGENDA ITEM # 10. a) Acknowledgements Mayor Denis Law City Council Ed Prince, Council President Don Persson, Council President Pro-tem Randy Corman Ryan McIrvin Armondo Pavone Ruth Pérez Don Persson Carol Ann Witschi Chief Administrative Officer Robert Harrison Public Works Gregg Zimmerman, Public Works Administrator Jim Seitz, Transportatfon Systems Director Vangie Garcia, Transportatfon Planning & Programming Manager Bob Hanson, Transportatfon Design Manager Chris Barnes, Transportatfon Operatfons Manager Eric Cutshall, Transportatfon Maintenance Manager Heather Gregersen, Program Development Coordinator 2019 – 2024 Transportation Improvement Program 1 AGENDA ITEM # 10. a) Table of Contents Section A – Introduction Purpose of the Transportatfon Improvement Program 4 Renton Business Plan 5 Section B – Map and Location Transportatfon Improvement Program Map 8 Map Index 9 Section C – Development and Prioritization TIP Development Actfvitfes 11 General Programming Criteria 13 Summary of Projects and Prioritfzatfon 15 Section D – Expenditures and Revenues Funding Sources - Itemized 19 Section E – Project Descriptions Detailed Project Descriptfons 26 Section F – Appendix Abbreviatfons and Acronyms Resolutfon to Adopt Six-Year 2019-2024 TIP 2019 – 2024 Transportation Improvement Program 2 AGENDA ITEM # 10. a) Section A Introduction 2019 – 2024 Transportation Improvement Program 3 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Purpose of the Transportation Improvement Program The purpose of this document is to update the City of Renton’s future plans for transportatfon improvement programs and projects. This document is Renton’s comprehensive transportatfon program for the ensuing six calendar years and is mandated by the Revised Code of Washington and Washington Administratfve Code. The Transportatfon Improvement Program (TIP) is a multf-year planning tool for the development of transportatfon facilitfes within the City that: support the Mission and Vision of the City of Renton help achieve the goals of the Renton Business Plan reflect the involvement of City Citfzens and Elected Officials. The Transportatfon Improvement Program is a vital part of planning under the Growth Management Act and city projects must be included in the TIP to be eligible for state and federal grant programs. The Transportatfon Systems Division uses the TIP to coordinate projects and programs with other jurisdictfons and agencies. 4 AGENDA ITEM # 10. a) Provide a safe, healthy, vibrant community Promote safety, health, and security through effective communication and service delivery Facilitate successful neighborhoods through community involvement Encourage and partner in the development of quality housing choices for people of all ages and income levels Promote a walkable, pedestrian and bicycle- friendly city with complete streets, trails, and connections between neighborhoods and community focal points Provide opportunities for communities to be better prepared for emergencies Promote economic vitality and strategically position Renton for the future Promote Renton as the progressive, opportunity- rich city in the Puget Sound region Capitalize on opportunities through bold and creative economic development strategies Recruit and retain businesses to ensure a dynamic, diversified employment base Nurture entrepreneurship and foster successful partnerships with businesses and community leaders Leverage public/ private resources to focus development on economic centers Support planned growth and influence decisions that impact the city Foster development of vibrant, sustainable, attractive, mixed-use neighborhoods in urban centers Uphold a high standard of design and property maintenance Advocate Renton’s interests through state and federal lobbying efforts, regional partnerships and other organizations Pursue transportation and other regional improvements and services that improve quality of life Balance development with environmental protection Building an inclusive informed city with opportunities for all Improve access to city services, programs and employment, and make residents and businesses aware of opportunities to be involved with their community Build connections with ALL communities that reflect the breadth and richness of the diversity in our city Promote understanding and appreciation of our diversity through celebrations and festivals Provide critical and relevant information on a timely basis and facilitate two-way dialogue between city government and the community Meet service demands and provide high quality customer service Plan, develop, and maintain quality services, infrastructure, and amenities Prioritize services at levels that can be sustained by revenue Retain a skilled workforce by making Renton the municipal employer of choice Develop and maintain collaborative partnerships and investment strategies that improve services Respond to growing service demands through partnerships, innovation, and outcome management Renton Business Plan 2019–2024 GOALS The City of Renton, in partnership and communication with residents, businesses, and schools, is dedicated to:MISSION Providing a safe, healthy, welcoming atmosphere where people choose to live Promoting economic vitality and strategically positioning Renton for the future Supporting planned growth and influencing decisions that impact the city Building an inclusive informed city with opportunities for all Meeting service demands through high quality customer service, innovation, a positive work environment, and a commitment to excellence Renton: The center of opportunity in the Puget Sound Region where families and businesses thrive VISION RENTON. AHEAD OF THE CURVE. 5 AGENDA ITEM # 10. a) Section B Map and Location 2019 – 2024 Transportation Improvement Program 6 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Map and Location This sectfon contains a list of all the projects listed in the 2019 - 2024 Transportatfon Improvement Program (TIP), listed by TIP number. The TIP project numbering system starts with programmatfc actfvitfes that typically have annual financial allocatfons. With this in mind, the TIP numbers for these programs will remain the same for future TIPs. The next grouping of projects in alphabetfcal order are projects with full or partfal funding secured, such as with federal or state grants or developer contributfons, or where the City has a financial commitment to implementfng within the six-year period. The last group of projects, where the projects start over in alphabetfcal order, are unfunded local projects or outside agency-led projects, that have been identffied in other long-range plans for the City. INTERACTIVE ONLINE MAP In additfon to having a map index to the map of 2019-2024 TIP projects, there is an interactfve online map where a user can click on a specific project and a dialog box opens with informatfon about that project with a link to the individual TIP sheet. The web address is: http://www.rentonwa.gov/TIPMap 7 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM 2.1 38 18 35 32 2.2 21 24 26 25 15 17 37 20 41 31 29 19 45 16 36 34 47 23 27 30 28 22 42 33 46 43 39 Maintenance and Preservatfon Corridor Projects Traffic Operatfons and Safety Non-Motorized Projects TIP Number # City-wide projects are not identified on this map. TRANSPORTATION IMPROVEMENT PROGRAM MAP 44 8 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM TIP No. Project Title 1 Street Overlay 2 Arterial Rehabilitatfon Program 2.1 Renton Avenue S Resurfacing, S 130th St to Taylor Ave NW 2.2 SW 43rd St Resurfacing, SR 167 to west City Limits 3 Walkway Program 4 Roadway Safety and Guardrail Program 5 Intersectfon Safety & Mobility Program 6 Traffic Safety Program 7 Traffic Operatfon Devices Program 8 Intelligent Transportatfon Systems (ITS) Program 9 Sidewalk Rehabilitatfon and Replacement Program 10 Bridge Inspectfon & Repair Program 11 Barrier-Free Transitfon Plan Implementatfon 12 Project Development & Pre-Design Program 13 Arterial Circulatfon Program 14 1% for the Arts Program 15 Bronson Way N Bridge Repair, across Cedar River 16 Duvall Ave NE Roadway Improvements, NE 7th St to Sunset Blvd NE 17 Houser Way N Bridge Repair- Seismic Retrofit and Paintfng 18 Lake Washington Loop Trail, perimeter of the Renton Airport 19 NE Sunset Boulevard (SR 900) Corridor Improvements, I-405 to east City Limits 20 Park Ave North Extension, Logan Ave N to Southport 21 Rainier Ave S/N Corridor Improvements Phase 4, S 3rd St to NW 3rd Pl 22 Renton Connector, S 2nd St to S 5th St 23 116th Ave SE Improvements, Puget Drive SE to the south City Limits 24 South 2nd Street Conversion Project, Rainier Ave S to Main Ave S 25 Williams Ave N Bridge - Seismic Retrofit and Paintfng 26 Williams Ave S and Wells Ave S Conversion Project, S Grady Way to N 1st St 27 Carr Road improvements, Lind Ave SW to 116th Ave SE 28 Houser Way S/N Non-Motorized Improvements, Mill Ave S to Bronson Way S 29 Houser Way North Widening and Realignment, N 8th St to Lake Washington Blvd 30 Lake to Sound (L2S) Trail, East-West Trail connecting Lake Washington to Puget Sound 31 Lake Washington Blvd N/ Southport Access Improvements, Park Ave N to Gene Coulon Park 32 Lind Ave SW Roadway Widening, SW 16th St to SW 43rd St 33 Logan Ave North Improvements, S 2nd St to Park Ave N 34 Maple Valley Highway Barriers, vicinity of western edge of Riverview Park 35 Monster Road SW/68th Ave S Roadway Improvements, Monster Rd Bridge to City Limits 36 NE 3rd Street / NE 4th Street Corridor Improvements, Sunset Blvd N to the east City Limits 37 Nile Ave NE Bridge Repair, across May Creek 38 Rainier Ave N Corridor Improvements Phase 5, NW 3rd Pl to City Limits 39 Renton Bus Rapid Transit (BRT) Improvements, S Renton Village Pl extension to S Grady Way 40 Transit Master Plan 41 South 3rd Street Conversion Project, Rainier Ave S to Main Ave S 42 South/Southwest 7th Street Corridor Improvements 43 South Grady Way Multf-Modal Improvements, Talbot Rd South to Rainier Ave South 44 South Lake Washington Transit Stop, vicinity of Southport Dr N and Garden Ave N 45 Sunset Area Green Connectfons, vicinity of Sunset Area Revitalization Area 46 SW 27th Street/Strander Boulevard Connectfon 47 Talbot Road S / S 177th St Signalizatfon and Roadway Improvements, adjacent to Valley Medical Center MAP INDEX 9 AGENDA ITEM # 10. a) Section C Development and Prioritization 2019 – 2024 Transportation Improvement Program 10 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM TIP Development Activities TIP project and financial development actfvitfes are intricately intertwined and involve interactfons with many groups and agencies at the local, regional, state and federal levels. Within the Transportatfon Systems Division of the City of Renton, project development involves year-round coordinatfon between the Transportatfon Operatfons and Transportatfon Maintenance Sectfon, the Transportatfon Planning and Programming Sectfon and the Transportatfon Design Sectfon. The Transportatfon Operatfons and Maintenance Sectfon compiles accident and traffic count data, performs level-of-service calculatfons needed to identffy operatfonal/congestfon problems and tracks all transportatfon -related complaints, suggestfons and requests that come into the City. The Transportatfon Design Sectfon, through the TIP’s Overlay Program and Bridge Inspection and Repair Program, work closely with the Maintenance Services Division to establish structural ratfngs for the City’s roads and bridges. These and other data are being used by the Planning and Programming Sectfon to develop transportatfon improvement projects, prepare grant applicatfons, interface with ongoing state and federal transportatfon programs and develop a TIP that supports the goals of the City’s long-range Comprehensive Plan and current business plan. The Transportatfon Planning and Programming Sectfon works with Washington Department of Transporta- tfon, King County Metro Transit, Puget Sound Regional Council, Sound Transit and other groups and agencies to assure consistency between Renton’s transportatfon policies and programs and those of the region. Such consistency is required by the Growth Management Act and related legislatfon and by federal and state grant programs. With on-going changes to I-405 and SR 167 as well as the expansion of the Sound Transit network, especially the I-405 Bellevue to Renton Bus Rapid Transit, the City of Renton must look to creatfng and maintaining an infrastructure system to support these changes to the transportatfon system to promote economic vitality as well as providing a safe and healthy community. Ongoing transportatfon planning actfvitfes, such as updatfng the Transportatfon Element in the Comprehensive Plan and the development of sub-area plans, play an important part in identffying and prioritfzing transportatfon improvement projects. In recent years, long-range planning efforts have played a key role in the development of transportatfon projects for the City: Downtown Civic Core Vision & Action Plan, City Center Community Plan, Sunset Area Transformation Plan, and the Renton Trails and Bicycle Master Plan. All City of Renton departments and City Council are solicited each year to provide input, discuss and comment on the Six-Year TIP. Additfonal input is also gathered through interactfons with other public and private organizatfons and through public meetfngs held in the community concerning specific transportatfon projects and programs. 11 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM At all levels of government - City, State and Federal - there are new laws and regulatfons that create the need for new or different kinds of transportatfon projects and programs that have tremendous impacts on the de- velopment and costs of transportatfon projects. Examples include the Moving Ahead for Progress in the 21 st Century Act (MAP-21), the Growth Management Act, the Clean Air Act, the Commute Trip Reductfon law, the Endangered Species Act and the Surface Water Management Ordinance. Within the City of Renton, there are actfons and interactfons involving other departments and divisions, the private sector, the City Council and Administratfon, which strongly influence the directfon of the transportatfon program. For example, the transportatfon system is significantly impacted by land use decisions, private development proposals and by public water and sewer extensions which increase transportatfon demand by making possible higher density and/or intensity of land uses. Such proposals need to be monitored and analyzed in regard to how they individually and collectfvely create the need for transportatfon improvements. In summary, with its heavy dependence on many different and unpredictable sources of external funding and with the significant impacts created by ongoing local and regional land use decisions, transportatfon project development is a contfnuous actfvity comprised of a multftude of diverse elements. 12 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM General Programming Criteria The yearly update of the Six-Year Transportatfon Improvement Program (TIP) is part of an ongoing process intrinsically linked with the development of the City’s Capital Improvement Program. The Six-Year TIP is also linked with various state and federal funding programs, regional/inter-jurisdictfonal planning and coordina- tfon processes and the City’s Growth Management Act Comprehensive Land Use Plan. Projects are developed and prioritfzed based on community needs, specific goals to be achieved and on gen- eral programming consideratfons. The general programming consideratfons include the following: PRIORITY – As shown on pages 15-17 the projects and programs are prioritfzed by type prepared by City staff with final approval by the City Council during the annual update of the TIP. The prioritfzatfon as- sists staff in assigning the limited resources to projects and programs and reducing resources during funding shortialls. In general, staff expends more resources on higher priority projects in the first three years of the TIP, and when applying for grants staff will consider these projects first unless oth- er lower priority projects better meet the partfcular criteria of a grant program. PLANNING – How, at a local and regional level, a project fits with or addresses identffied future trans- portatfon goals, demands and planning processes must be evaluated. This is strongly influenced by ongoing land use decisions and by regional highway and transit system plans. FINANCING – Many projects are dependent upon external grants, formatfon of LID’s or the receipt of im- pact fees. Prioritfzatfon has to take into account the peculiaritfes of each of the various fund sources and the probabilitfes of when and how much money will be available. SCHEDULING – If a project is interconnected with, or interdependent on, other projects taking place, this is reflected in their relatfve prioritfes. PAST COMMITMENT – The level of previous commitment made by the City in terms of resources, legis- latfve actfons or inter-local agreements must be taken into consideratfon in prioritfzing TIP projects. In additfon to the general consideratfons discussed above, there are five specific project categories through which the TIP is evaluated and analyzed. The categories include the following: Maintenance and Preservatfon of Existfng Infrastructure Corridor Projects Operatfons and Safety Non-Motorized Projects Other Programs These categories provide a useful analysis tool and represent goals developed through an evaluatfon of the City’s transportatfon program in response to input from citfzens and local officials and to state and federal legislatfon. 13 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Taken as a whole, the five categories provide a framework for evaluatfng projects both individually and as part of a strategy that seeks to meet and balance the transportatfon needs of Renton during a tfme of in- creasing transportatfon demand, decreasing revenues, and growing environmental concerns. Although each project can be identffied with an important concern that allows it to be classified into one of the five categories, most projects are intended to address and are developed to be compatfble with multfple goals. Maintenance and Preservation of the Existing Infrastructure is a basic need that must be met by the program. The Mayor and City Council have emphasized the importance of sustaining strong programs in this project category and maintaining our current infrastructure. Therefore, more than half of the Transporta- tfon’s City Funds have historically been allocated under this category. The State Growth Management Act also requires jurisdictfons to assess and address the funding required to maintain their existfng transporta- tfon systems. The City of Renton owns and maintains 250 centerline miles of streets. Corridor Projects are oriented toward moving people through a balanced transportatfon system that in- volves multfple modes of transportatfon. Included are facilitfes that facilitate the movement of transit and carpools. The Moving Ahead for Progress in the 21st Century Act (MAP-21), the State and Federal Clean Air legislatfon and the State Commute Trip Reductfon Act (CTR) have added momentum to regional efforts and placed requirements on local jurisdictfons such as Renton to promote these transportatfon elements. Operations and Safety projects and programs are developed through ongoing analyses of the transporta- tfon system and are directed mainly toward traffic engineering concerns such as safety and congestfon. Pro- jects are identffied not only by analysis of traffic counts, accident records and geometric data, but also through review and investfgatfon of citfzen complaints and requests. Non-Motorized Projects have been developed with major emphasis on addressing community quality of life issues by improving and/or protectfng residentfal livability while providing necessary transportatfon sys- tem improvements. Bicycle and pedestrian projects are included in this category. Other Programs involve planning of transportatfon improvements necessitated by new development and new transportatfon capital improvements. 14 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Summary of Projects and Prioritization The prioritfzatfon of the TIP is influenced by the interconnectfon and/or interdependence among TIP projects and with projects by other City departments and by other jurisdictfons as well as the tfming of those transportatfon projects. Equally important to the prioritfzatfon below is the likelihood, the tfme frame, and the amount of outside funding that will be obtainable to finance transportatfon projects. The prioritfzatfon lists below are sorted by the category type of the projects. Priority TIP No. Project Title Community Planning Area Maintenance and Preservation of the Existing Infrastructure 1 1 Street Overlay Citywide 2 2 Arterial Rehabilitation Program Citywide 3 2.1 Renton Avenue S Resurfacing, S 130th St to Taylor Ave NW City Center 4 2.2 SW 43rd St Resurfacing, SR 167 to west City Limits Valley 5 15 Bronson Way N Bridge Repair, across Cedar River City Center 6 17 Houser Way N Bridge Repair, across Cedar River City Center 7 25 Williams Ave N Bridge Repair, across Cedar River City Center 8 9 Sidewalk Rehabilitation and Replacement Program Citywide 9 37 Nile Ave NE Bridge Repair, across May Creek East Plateau 10 10 Bridge Inspection & Repair Program Citywide 11 4 Roadway Safety and Guardrail Program Citywide 15 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Priority TIP No. Project Title Community Planning Area Corridor Projects 1 26 Williams Ave S and Wells Ave S Conversion Project, S Grady Way to N 1st St City Center 2 20 Park Ave North Extension, Logan Ave N to Southport City Center 3 21 Rainier Ave S/N Corridor Improvements Phase 4, S 3rd St to NW 3rd Pl City Center 4 16 Duvall Ave NE Roadway Improvements, NE 7th St to Sunset Blvd NE Highlands & E. Plateau 5 24 South 2nd Street Conversion Project, Rainier Ave S to Main St City Center 6 19 NE Sunset Boulevard (SR 900) Corridor Improvements I-405 to east City Limits Highlands 7 23 116th Ave SE Improvements, Puget Drive SE to the south City Limits Benson 8 41 South 3rd Street Conversion Project, Rainier Ave S to Main St City Center 9 22 Renton Connector, S 2nd St to S 5th St City Center 10 44 South Lake Washington Transit Stop, vicinity of Southport Dr N and Garden Ave N City Center 11 27 Carr Road improvements, Lind Ave SW to 116th Ave SE Talbot & Benson 12 39 Renton Bus Rapid Transit (BRT) Improvements, S Renton Village Pl extension to S Grady Way City Center 13 42 South 7th Street Corridor Improvements, Rainier Ave South to Talbot Road South City Center 14 31 Lake Washington Blvd N/ Southport Access Improvements, Park Ave N to Gene Coulon Park City Center 15 43 South Grady Way Multi-Modal Improvements, Talbot Rd South to Rainier Ave South City Center 16 38 Rainier Ave N Corridor Improvements Phase 5, NW 3rd Pl to City Limits City Center 17 29 Houser Way North Widening and Realignment, N 8th St to Lake Washington Blvd City Center 18 33 Logan Ave North Improvements, S 2nd St to Park Ave N City Center 19 36 NE 3rd Street / NE 4th Street Corridor Improvements, Sunset Blvd N to the east City Limits Highlands & E. Plateau 20 32 Lind Ave SW Roadway Widening, SW 16th St to SW 43rd St Valley 21 35 Monster Road SW/68th Ave S Roadway Improvements, Monster Rd Bridge and City Limits Valley 22 46 SW 27th Street/Strander Boulevard Connection Valley 16 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM Priority TIP No. Project Title Community Planning Area Operations and Safety 1 5 Intersection Safety & Mobility Program Citywide 2 6 Traffic Safety Program Citywide 3 8 Intelligent Transportation Systems (ITS) Program Citywide 4 7 Traffic Operation Devices Program Citywide 5 34 Maple Valley Highway Barriers, west edge of Riverview Park Cedar River 6 47 Talbot Road S / S 177th St Signalization and Roadway Improvements, adjacent to Valley Medical Center Talbot Non-Motorized Projects 1 18 Lake Washington Loop Trail, south perimeter of the Renton Airport City Center 2 30 Lake to Sound (L2S) Trail, East-West Trail connecting Lake Washington to Puget Sound Valley & City Center 3 28 Houser Way S/N Non-Motorized Improvements, Mill Ave S to Bronson Way S City Center 4 11 Barrier-Free Transition Plan Implementation Citywide 5 3 Walkway Program Citywide 6 45 Sunset Area Green Connections, vicnity of Sunset Area Revitilzation Area Highlands Other Programs 1 13 Arterial Circulation Program Citywide 2 12 Project Development & Pre-Design Program Citywide 3 40 Transit Master Plan Citywide 4 14 1% for the Arts Program N/A 17 AGENDA ITEM # 10. a) Section D Expenditures and Revenues 2019 – 2024 Transportation Improvement Program 18 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year Period  Total 1 Street Overlay $1,090,000 $1,170,000 $2,070,000 $2,170,000 $2,260,000 $2,360,000 $11,120,000 2 Arterial Rehabilitation Program $1,540,000 $1,610,000 $1,680,000 $4,830,000 2.1 Renton Avenue S Resurfacing $550,000 $550,000 2.2 SW 43rd St Resurfacing $220,000 $1,820,000 $2,040,000 3 Walkway Program $200,000 $250,000 $250,000 $250,000 $250,000 $250,000 $1,450,000 4 Roadway Safety and Guardrail Program $25,000 $25,000 $30,000 $30,000 $35,000 $35,000 $180,000 5 Intersection Safety & Mobility Program $250,000 $200,000 $350,000 $350,000 $350,000 $350,000 $1,850,000 6 Traffic Safety Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000 7 Traffic Operation Devices Program $120,000 $120,000 $120,000 $120,000 $120,000 $120,000 $720,000 8 Intelligent Transportation Systems (ITS) Program $60,000 $60,000 $60,000 $60,000 $60,000 $60,000 $360,000 9 Sidewalk Rehabilitation and Replacement Program $100,000 $110,000 $110,000 $110,000 $110,000 $110,000 $650,000 10 Bridge Inspection & Repair Program $90,000 $50,000 $100,000 $100,000 $100,000 $100,000 $540,000 11 Barrier‐Free Transition Plan Implementation $60,000 $80,000 $80,000 $80,000 $80,000 $80,000 $460,000 12 Project Development & Pre‐Design Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000 13 Arterial Circulation Program $145,000 $150,000 $150,000 $150,000 $150,000 $150,000 $895,000 14 1% for the Arts Program $15,000 $15,000 $15,000 $15,000 $15,000 $15,000 $90,000 15 Bronson Way N Bridge Repair $420,000 $2,510,000 $2,930,000 16 Duvall Ave NE Roadway Improvements $1,512,139 $1,512,139 17 Houser Way N Bridge Repair $470,000 $2,531,900 $222,550 $3,224,450 18 Lake Washington Loop Trail $340,000 $1,425,000 $1,200,000 $950,000 $3,250,000 $7,165,000 19 NE Sunset Blvd (SR 900) Corridor Improvements $459,000 $2,750,000 $7,550,000 $6,850,000 $6,450,000 $6,250,000 $30,309,000 20 Park Ave North Extension $5,825,000 $625,000 $6,450,000 21 Rainier Ave S/N Corridor Improvements Phase 4 $1,500,000 $1,951,323 $8,800,000 $5,850,000 $150,000 $18,251,323 22 Renton Connector $278,700 $621,300 $3,963,000 $8,850,000 $13,713,000 23 116th Ave SE Improvements $1,600,000 $3,700,000 $2,600,000 $2,200,000 $10,100,000 24 South 2nd Street Conversion Project $100,000 $1,350,000 $7,800,000 $7,800,000 $17,050,000 25 Williams Ave N Bridge Repair $470,000 $2,740,450 $3,210,450 26 Williams Ave S and Wells Ave S Conversion Project $1,933,800 $6,348,269 $8,282,069 27 Carr Road improvements $50,000 $50,000 28 Houser Way Non‐Motorized Improvements $385,000 $836,000 $966,000 $2,187,000 29 Houser Way North Widening and Realignment $1,065,000 $1,560,000 $2,340,000 $4,965,000 30 Lake to Sound (L2S) Trail $2,800,000 $2,800,000 31 Lake Wash. Blvd N/Southport Access Improvements $2,000,000 $2,000,000 32 Lind Ave SW Roadway Widening $400,000 $1,650,000 $2,350,000 $4,400,000 33 Logan Ave North Improvements $1,240,000 $10,000,000 $11,240,000 34 Maple Valley Highway Barriers $299,035 $2,838,865 $3,137,900 35 Monster Road SW/68th Ave S  Improvements $50,000 $8,000,000 $8,050,000 36 NE 3rd Street / NE 4th Street Corridor Improvements $20,000 $20,000 $750,000 $4,190,000 $5,180,000 $3,200,000 $13,360,000 37 Nile Ave NE Bridge Repair $50,000 $200,000 $250,000 38 Rainier Ave N Corridor Improvements Phase 5 $100,000 $2,000,000 $2,100,000 39 Renton Bus  Rapid Transit (BRT) Improvements $3,195,000 $9,052,500 $9,052,500 $21,300,000 40 Renton Master Transit Plan $300,000 $200,000 $500,000 41 South 3rd Street Conversion Project $4,000,000 $6,500,000 $10,700,000 $21,200,000 42 S/SW 7th Street Corridor Improvements $200,000 $1,600,000 $10,364,000 $3,608,928 $15,772,928 43 South Grady Way Multi‐Modal Improvements $550,000 $1,760,000 $1,690,000 $4,000,000 44 South Lake Washington Transit Stop $4,350,000 $4,350,000 45 Sunset Area Green Connections $3,600,000 $10,700,000 $7,900,000 $22,200,000 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL EXPENDITURES $20,804,939 $23,801,942 $35,905,285 $57,030,165 $80,475,500 $75,577,428 $293,595,259 SUMMARY OF PROJECT EXPENDITURES 19 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year Period  Total 1 Street Overlay $700,000 $710,000 $720,000 $730,000 $740,000 $750,000 $4,350,000 2 Arterial Rehabilitation Program 2.1 Renton Avenue S Resurfacing 2.2 SW 43rd St Resurfacing 3 Walkway Program 4 Roadway Safety and Guardrail Program 5 Intersection Safety & Mobility Program 6 Traffic Safety Program 7 Traffic Operation Devices Program 8 Intelligent Transportation Systems (ITS) Program 9 Sidewalk Rehabilitation and Replacement Program 10 Bridge Inspection & Repair Program 11 Barrier‐Free Transition Plan Implementation 12 Project Development & Pre‐Design Program 13 Arterial Circulation Program 14 1% for the Arts Program 15 Bronson Way N Bridge Repair 16 Duvall Ave NE Roadway Improvements 17 Houser Way N Bridge Repair 18 Lake Washington Loop Trail 19 NE Sunset Boulevard (SR 900) Corridor Improvements 20 Park Ave North Extension 21 Rainier Ave S/N Corridor Improvements Phase 4 22 Renton Connector 23 116th Ave SE Improvements 24 South 2nd Street Conversion Project 25 Williams Ave N Bridge Repair 26 Williams Ave S and Wells Ave S Conversion Project 27 Carr Road improvements 28 Houser Way Non‐Motorized Improvements 29 Houser Way North Widening and Realignment 30 Lake to Sound (L2S) Trail 31 Lake Washington Blvd N/ Southport Access Improvements 32 Lind Ave SW Roadway Widening 33 Logan Ave North Improvements 34 Maple Valley Highway Attenuator 35 Monster Road SW/68th Ave S Roadway Improvements 36 NE 3rd Street / NE 4th Street Corridor Improvements 37 Nile Ave NE Bridge Repair 38 Rainier Ave N Corridor Improvements Phase 5 39 Renton Bus  Rapid Transit (BRT) Improvements 40 Renton Master Transit Plan 41 South 3rd Street Conversion Project 42 S/SW 7th Street Corridor Improvements 43 South Grady Way Multi‐Modal Improvements 44 South Lake Washington Transit Stop 45 Sunset Area Green Connections 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL VEHICLE FUEL TAX $700,000 $710,000 $720,000 $730,000 $740,000 $750,000 $4,350,000 RESOURCE: VEHICLE FUEL TAX 20 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year Period  Total 1 Street Overlay $390,000 $460,000 $490,000 $530,000 $560,000 $600,000 $3,030,000 2 Arterial Rehabilitation Program $510,000 $530,000 $550,000 $1,590,000 2.1 Renton Avenue S Resurfacing $275,000 $275,000 2.2 SW 43rd St Resurfacing $220,000 $820,000 $1,040,000 3 Walkway Program $200,000 $250,000 $100,000 $100,000 $100,000 $100,000 $850,000 4 Roadway Safety and Guardrail Program $25,000 $25,000 $30,000 $30,000 $35,000 $35,000 $180,000 5 Intersection Safety & Mobility Program 6 Traffic Safety Program $130,000 $70,000 $200,000 7 Traffic Operation Devices Program $120,000 $120,000 $120,000 $120,000 $120,000 $120,000 $720,000 8 Intelligent Transportation Systems (ITS) Program 9 Sidewalk Rehabilitation and Replacement Program $100,000 $110,000 $110,000 $110,000 $110,000 $110,000 $650,000 10 Bridge Inspection & Repair Program $90,000 $50,000 $50,000 $50,000 $50,000 $50,000 $340,000 11 Barrier‐Free Transition Plan Implementation $60,000 $80,000 $140,000 12 Project Development & Pre‐Design Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000 13 Arterial Circulation Program $145,000 $150,000 $150,000 $150,000 $150,000 $150,000 $895,000 14 1% for the Arts Program $15,000 $15,000 $15,000 $15,000 $15,000 $15,000 $90,000 15 Bronson Way N Bridge Repair 16 Duvall Ave NE Roadway Improvements $30,000 $30,000 17 Houser Way N Bridge Repair, 18 Lake Washington Loop Trail $75,000 $75,000 19 NE Sunset Boulevard (SR 900) Corridor Improvements $32,975 $32,975 20 Park Ave North Extension 21 Rainier Ave S/N Corridor Improvements Phase 4 $100,000 $450,000 $550,000 22 Renton Connector 23 116th Ave SE Improvements 24 South 2nd Street Conversion Project $100,000 $100,000 25 Williams Ave N Bridge Repair $122,550 $122,550 26 Williams Ave S and Wells Ave S Conversion Project 27 Carr Road improvements 28 Houser Way Non‐Motorized Improvements 29 Houser Way North Widening and Realignment 30 Lake to Sound (L2S) Trail 31 Lake Washington Blvd N/ Southport Access Improvements 32 Lind Ave SW Roadway Widening 33 Logan Ave North Improvements 34 Maple Valley Highway Barriers 35 Monster Road SW/68th Ave S Roadway Improvements 36 NE 3rd Street / NE 4th Street Corridor Improvements $20,000 $20,000 $40,000 37 Nile Ave NE Bridge Repair 38 Rainier Ave N Corridor Improvements Phase 5 39 Renton Bus  Rapid Transit (BRT) Improvements 40 Renton Master Transit Plan 41 South 3rd Street Conversion Project 42 S/SW 7th Street Corridor Improvements 43 South Grady Way Multi‐Modal Improvements 44 South Lake Washington Transit Stop 45 Sunset Area Green Connections 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL B & O Share $1,782,975 $2,017,550 $2,135,000 $2,215,000 $1,820,000 $1,880,000 $11,850,525 RESOURCE: BUSINESS LICENSE AND BUSINESS & OCCUPATION 21 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year    Period Total 1 Street Overlay 2 Arterial Rehabilitation Program 2.1 Renton Avenue S Resurfacing 2.2 SW 43rd St Resurfacing $1,000,000 $1,000,000 3 Walkway Program 4 Roadway Safety and Guardrail Program 5 Intersection Safety & Mobility Program 6 Traffic Safety Program 7 Traffic Operation Devices Program 8 Intelligent Transportation Systems (ITS) Program 9 Sidewalk Rehabilitation and Replacement Program 10 Bridge Inspection & Repair Program 11 Barrier‐Free Transition Plan Implementation 12 Project Development & Pre‐Design Program 13 Arterial Circulation Program 14 1% for the Arts Program 15 Bronson Way N Bridge Repair $420,000 $2,510,000 $2,930,000 16 Duvall Ave NE Roadway Improvements $1,049,039 $1,049,039 17 Houser Way N Bridge Repair $406,550 $2,531,900 $2,938,450 18 Lake Washington Loop Trail $340,000 $1,042,961 $1,382,961 19 NE Sunset Boulevard (SR 900) Corridor Improvements $426,025 $426,025 20 Park Ave North Extension 21 Rainier Ave S/N Corridor Improvements Phase 4 $1,192,475 $1,358,000 $5,800,000 $8,350,475 22 Renton Connector 23 116th Ave SE Improvements 24 South 2nd Street Conversion Project $1,200,000 $1,200,000 25 Williams Ave N Bridge Repair $406,550 $2,517,900 $2,924,450 26 Williams Ave S and Wells Ave S Conversion Project $1,453,800 $2,396,200 $3,850,000 27 Carr Road improvements 28 Houser Way Non‐Motorized Improvements 29 Houser Way North Widening and Realignment 30 Lake to Sound (L2S) Trail 31 Lake Washington Blvd N/ Southport Access Improvements 32 Lind Ave SW Roadway Widening 33 Logan Ave North Improvements 34 Maple Valley Highway Barriers 35 Monster Road SW/68th Ave S Roadway Improvements 36 NE 3rd Street / NE 4th Street Corridor Improvements 37 Nile Ave NE Bridge Repair 38 Rainier Ave N Corridor Improvements Phase 5 39 Renton Bus  Rapid Transit (BRT) Improvements 40 Renton Master Transit Plan 41 South 3rd Street Conversion Project 42 S/SW 7th Street Corridor Improvements 43 South Grady Way Multi‐Modal Improvements 44 South Lake Washington Transit Stop 45 Sunset Area Green Connections 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL GRANTS AWARDED $5,694,439 $12,356,961 $8,000,000 $26,051,400 RESOURCE: GRANTS AWARDED 22 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year    Period Total 1 Street Overlay 2 Arterial Rehabilitation Program 2.1 Renton Avenue S Resurfacing 2.2 SW 43rd St Resurfacing 3 Walkway Program 4 Roadway Safety and Guardrail Program 5 Intersection Safety & Mobility Program $250,000 $200,000 $450,000 6 Traffic Safety Program $10,000 $80,000 $90,000 7 Traffic Operation Devices Program 8 Intelligent Transportation Systems (ITS) Program $60,000 $60,000 $120,000 9 Sidewalk Rehabilitation and Replacement Program 10 Bridge Inspection & Repair Program 11 Barrier‐Free Transition Plan Implementation 12 Project Development & Pre‐Design Program 13 Arterial Circulation Program 14 1% for the Arts Program 15 Bronson Way N Bridge Repair 16 Duvall Ave NE Roadway Improvements $322,475 $322,475 17 Houser Way N Bridge Repair 18 Lake Washington Loop Trail $307,039 $307,039 19 NE Sunset Boulevard (SR 900) Corridor Improvements 20 Park Ave North Extension 21 Rainier Ave S/N Corridor Improvements Phase 4 $307,525 $593,323 $700,000 $945,000 $150,000 $2,695,848 22 Renton Connector 23 116th Ave SE Improvements 24 South 2nd Street Conversion Project 25 Williams Ave N Bridge Repair 26 Williams Ave S and Wells Ave S Conversion Project 27 Carr Road improvements $50,000 $50,000 28 Houser Way Non‐Motorized Improvements 29 Houser Way North Widening and Realignment 30 Lake to Sound (L2S) Trail 31 Lake Washington Blvd N/ Southport Access Improvements 32 Lind Ave SW Roadway Widening 33 Logan Ave North Improvements 34 Maple Valley Highway Barriers 35 Monster Road SW/68th Ave S Roadway Improvements 36 NE 3rd Street / NE 4th Street Corridor Improvements 37 Nile Ave NE Bridge Repair 38 Rainier Ave N Corridor Improvements Phase 5 39 Renton Bus  Rapid Transit (BRT) Improvements 40 Renton Master Transit Plan 41 South 3rd Street Conversion Project 42 S/SW 7th Street Corridor Improvements 43 South Grady Way Multi‐Modal Improvements 44 South Lake Washington Transit Stop 45 Sunset Area Green Connections 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL MITIGATION $1,000,000 $1,240,362 $700,000 $945,000 $150,000 $4,035,362 RESOURCE: MITIGATION (IMPACT FEES) 23 AGENDA ITEM # 10. a) City of Renton | 2019‐2024 Transportation Improvement Program TIP No. Project Title 2019 2020 2021 2022 2023 2024 Six‐Year    Period Total 1 Street Overlay 2 Arterial Rehabilitation Program 2.1 Renton Avenue S Resurfacing 2.2 SW 43rd St Resurfacing 3 Walkway Program 4 Roadway Safety and Guardrail Program 5 Intersection Safety & Mobility Program 6 Traffic Safety Program 7 Traffic Operation Devices Program 8 Intelligent Transportation Systems (ITS) Program 9 Sidewalk Rehabilitation and Replacement Program 10 Bridge Inspection & Repair Program 11 Barrier‐Free Transition Plan Implementation 12 Project Development & Pre‐Design Program 13 Arterial Circulation Program 14 1% for the Arts Program 15 Bronson Way N Bridge Repair 16 Duvall Ave NE Roadway Improvements 17 Houser Way N Bridge Repair 18 Lake Washington Loop Trail 19 NE Sunset Boulevard (SR 900) Corridor Improvements 20 Park Ave North Extension $5,825,000 $625,000 $6,450,000 21 Rainier Ave S/N Corridor Improvements Phase 4 $2,100,000 $4,455,000 $6,555,000 22 Renton Connector 23 116th Ave SE Improvements 24 South 2nd Street Conversion Project 25 Williams Ave N Bridge Repair 26 Williams Ave S and Wells Ave S Conversion Project 27 Carr Road improvements 28 Houser Way Non‐Motorized Improvements 29 Houser Way North Widening and Realignment 30 Lake to Sound (L2S) Trail $2,800,000 $2,800,000 31 Lake Washington Blvd N/ Southport Access Improvements $2,000,000 $2,000,000 32 Lind Ave SW Roadway Widening 33 Logan Ave North Improvements 34 Maple Valley Highway Barriers 35 Monster Road SW/68th Ave S Roadway Improvements 36 NE 3rd Street / NE 4th Street Corridor Improvements 37 Nile Ave NE Bridge Repair 38 Rainier Ave N Corridor Improvements Phase 5 39 Renton Bus  Rapid Transit (BRT) Improvements 40 Renton Master Transit Plan 41 South 3rd Street Conversion Project 42 S/SW 7th Street Corridor Improvements 43 South Grady Way Multi‐Modal Improvements 44 South Lake Washington Transit Stop 45 Sunset Area Green Connections 46 SW 27th Street/Strander Boulevard Connection 47 Talbot Road S / S 177th St Improvements TOTAL OTHER SOURCES $10,625,000 $625,000 $2,100,000 $4,455,000 $17,805,000 RESOURCE: OTHER (Developer Contributions, Other Agencies, etc) 24 AGENDA ITEM # 10. a) Section E Project Descriptions 2019 – 2024 Transportation Improvement Program 25 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 1 Project Title:Street Overlay Community Planning Area:Citywide Fund: Functional Classification:Local and Collector Project: Project Length:various Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 28,000 - 4,000 24,000 4,000 4,000 4,000 4,000 4,000 4,000 R-O-W (includes Admin)- - - - - - - - - - Construction 14,161,226 1,671,226 1,730,000 10,760,000 1,030,000 1,110,000 2,010,000 2,110,000 2,200,000 2,300,000 Construction Services 455,947 63,947 56,000 336,000 56,000 56,000 56,000 56,000 56,000 56,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 14,645,173 1,735,173 1,790,000 11,120,000 1,090,000 1,170,000 2,070,000 2,170,000 2,260,000 2,360,000 Source of Fund: Vehicle Fuel Tax 5,680,000 660,000 670,000 4,350,000 700,000 710,000 720,000 730,000 740,000 750,000 Business & Occupation Share 3,395,173 75,173 290,000 3,030,000 390,000 460,000 490,000 530,000 560,000 600,000 Fund Balance 30,000 - 30,000 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 800,000 - 800,000 - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (Gen Fund Transfer)1,000,000 1,000,000 - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 3,740,000 - - 3,740,000 - - 860,000 910,000 960,000 1,010,000 Total Sources 14,645,173 1,735,173 1,790,000 11,120,000 1,090,000 1,170,000 2,070,000 2,170,000 2,260,000 2,360,000 122108 317 Street Overlay Project Expenditures & Resources Programmed Michelle Faltaous 425-430-7301 Annual program for repairing and resurfacing existing roadways. Installation of ADA compliant curb ramps has been incorporated into the Street Overlay Program in accordance with federal requirements. This program funds overlays on neighborhood streets and collector streets while the Arterial Rehabilitation Program (TIP No. 2) funds principal and minor arterials. This program allocates $100K/yr for the overlay of alleyways. Asphalt concrete pavement (ACP) overlay and slurry seal of streets provide for improved driving surface and are highly cost-effective ways of avoiding expensive repairs and reconstruction. The Pavement Management System and biennial survey of roadway conditions greatly improve the efficiency of the Overlay Program. The 2016 "Pavement Management Program State of the Streets Report" rated the average Pavement Condition Index (PCI) as 68. According to the report, $78M will need to be invested in pavement rehabilitation in the next 10 years to bring the PCI to 70 and maintain it at that level. The City will be conducting an updated street survey through the summer of 2018. Due to increasing ADA regulations starting in 2019, the annual design and contract award will be prepared by a Consultant. The ADA required curb ramps may be split out into its own contract. 10,905,173 3,740,000 Programmed Pre-2019 Six-Year Program 26 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 2 Project Title:Arterial Rehabilitation Program Community Planning Area:Citywide Fund: Functional Classification:Principal and Minor Arterial Project: Project Length:various Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 3,240,000 - - 3,240,000 - - - 1,030,000 1,080,000 1,130,000 Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other (City Match)1,590,000 - - 1,590,000 - - - 510,000 530,000 550,000 Total Expenses 4,830,000 - - 4,830,000 - - - 1,540,000 1,610,000 1,680,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 1,590,000 - - 1,590,000 - - - 510,000 530,000 550,000 Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 3,240,000 - - 3,240,000 - - - 1,030,000 1,080,000 1,130,000 Total Sources 4,830,000 - - 4,830,000 - - - 1,540,000 1,610,000 1,680,000 Arterial Rehabilitation Program 1,590,000 3,240,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program The 2016 "Pavement Management Program State of the Streets Report" rated the average Pavement Condition Index (PCI) as 68. According to the report, $78M will need to ne invested in pavement rehabilitation in the next 10 years to bring the PCI to 70 and maintain it at that level. The City was awarded a $1,020,700 STP grant for the Renton Ave Extension and $1,000,000 was awarded to SW 43rd St. Expenditures and Funds for years 2019, 2020, & 2021 are reflected in individual TIP project sheets for Renton Ave Resurfacing (TIP #2.1) and SW 43rd Preservation (TIP #2.2). 317 Michelle Faltaous 425-430-7301 This program provides for the rehabilitation of principal and minor arterial streets. Installation of ADA-compliant curb ramps has been incorporated into the annual Arterial Rehabilitation and Overlay programs according to new federal requirements. This program will provide funding for the City match for larger federally funded projects. The Overlay Program (TIP #1) concentrates to a great degree on maintaining residential streets, where relatively small traffic volumes and less truck and bus traffic make standard asphalt overlays a long term means of maintenance. Arterial streets can often deteriorate rather quickly and often require more costly rehabilitation measures and/or costly temporary repairs to avoid more extensive deterioration. 122186 27 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 2.1 Project Title:Arterial Rehabilitation - Renton Ave S Resurfacing Community Planning Area:West Hill Fund: Functional Classification:Minor Arterial Project: Project Length:0.60 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 78,310 78,310 - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,875,390 - 1,325,390 550,000 550,000 - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,953,700 78,310 1,325,390 550,000 550,000 - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 505,655 78,310 152,345 275,000 275,000 - - - - - Fund Balance 427,345 - 152,345 275,000 275,000 - - - - - Grants Awarded (STP)1,020,700 - 1,020,700 - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 1,953,700 78,310 1,325,390 550,000 550,000 - - - - - Arterial Rehabilitation - Renton Ave S Resurfacing 1,953,700 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program The construction of this project is being coordinated with development construction along Renton Ave S to minimize construction impacts and cost. 317 Hebe Bernardo 425-430-7232 This project will resurface 0.60 miles of Renton Ave S from S 130th St (west City Limits) to Hardie Ave SW and upgrade ADA ramps to current standards. The roadway is classified as a T-2 truck route carrying 5.8 million tones of freight annually. The overall condition of the pavement will be improved and the project will extend the pavement life (12-15 years). Renton Ave S is also an alternate route to SR-900, connecting Renton to the Skyway area and South Seattle. The City was awarded a $1,020,700 STP grant for Pavement Preservation in 2016. Design is underway and will be completed in the Fall of 2018. Construction to be completed in 2019. 122185 28 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 2.2 Project Title:Arterial Rehabilitation - SW 43rd St Pavement Preservation Community Planning Area:Valley Fund: Functional Classification:Principal Arterial Project: Project Length:1.17 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 220,000 - - 220,000 - 220,000 - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,820,000 - - 1,820,000 - - 1,820,000 - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 2,040,000 - - 2,040,000 - 220,000 1,820,000 - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 1,040,000 - - 1,040,000 - 220,000 820,000 - - - Fund Balance - - - - - - - - - - Grants Awarded (STP Preservation)1,000,000 - - 1,000,000 - - 1,000,000 - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - Total Sources 2,040,000 - - 2,040,000 - 220,000 1,820,000 - - - 2,040,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Arterial Rehabilitation - SW 43rd St Pavement Preservation 317 NEW Michelle Faltaous 425-430-7301 This project will resurface the roadway from the western city limits to the SR 167 Ramps, except where there are existing concrete panels. This project will also upgrade all intersection ramps to current ADA standards as well as install and replace all delineation to City of Renton standards. Also included in this project are the adjustment or evaluation for replacement of existing features affected by resurfacing such as monuments, catch basins, or drainage grates. This principal arterial and T-1 truck route is a major east-west corridor that serves and directly connects to the Sounder Station. SW 43rd St connects directly to SR 167 and is used as a main access to Valley Medical Center, IKEA, and other major employment centers. Resurfacing this roadway will improve the overall condition of the pavement and the project will extend the pavement life (12-15 years) of this key east-west South County corridor. New project. The City was awarded a $1,000,000 STP grant for Pavement Preservation in 2018. 29 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 3 Project Title:Walkway Program Community Planning Area:Citywide Fund: Functional Classification:various Project: Project Length:various Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 32,000 - 2,000 30,000 5,000 5,000 5,000 5,000 5,000 5,000 Preliminary Engineering 150,000 - - 150,000 25,000 25,000 25,000 25,000 25,000 25,000 R-O-W (includes Admin)- - - - - - - - - - Construction 1,231,088 73,088 8,000 1,150,000 150,000 200,000 200,000 200,000 200,000 200,000 Construction Services 120,000 - - 120,000 20,000 20,000 20,000 20,000 20,000 20,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,533,088 73,088 10,000 1,450,000 200,000 250,000 250,000 250,000 250,000 250,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 933,088 73,088 10,000 850,000 200,000 250,000 100,000 100,000 100,000 100,000 Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 600,000 - - 600,000 - - 150,000 150,000 150,000 150,000 Total Sources 1,533,088 73,088 10,000 1,450,000 200,000 250,000 250,000 250,000 250,000 250,000 933,088 600,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Walkway Program With the cost of design and construction of sidewalk projects exceeding the annual funding for this program, this program was used as match funding for grant applications in 2018. 317 120009 Hebe Bernardo 425-430-7232 This program provides for the design and construction of non-motorized transportation facilities for pedestrians as well as provide City match funding for larger federal and state funded projects. Projects are identified and prioritized using criteria from the Comprehensive Citywide Walkway Study, Council direction, and through coordination with the City's Neighborhood Program. Providing safe and convenient non-motorized facilities is an integral part of a complete transportation network. Specific improvements will respond to the needs of school children, the aged and persons with disabilities, and support increased use of transit. The Comprehensive Citywide Walkway Study was completed in 2009 and is being used to select projects that move into the design and construction phases. 30 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 4 Project Title:Roadway Safety and Guardrail Program Community Planning Area:Citywide Fund: Functional Classification:various Project: Project Length:various Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 21,000 - 3,000 18,000 3,000 3,000 3,000 3,000 3,000 3,000 R-O-W (includes Admin)- - - - - - - - - - Construction 175,000 714 24,286 150,000 20,000 20,000 25,000 25,000 30,000 30,000 Construction Services 14,000 - 2,000 12,000 2,000 2,000 2,000 2,000 2,000 2,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000 Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000 210,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Roadway Safety and Guardrail Program 317 120110 Chris Barnes 425-430-7220 This program will provide guardrail improvements each year and improve the safety of the roadside environment. This program will implement roadside safety improvements including barrier systems and hazardous object removal. This program will develop a policy and standardized criteria for barriers and selection of projects. 31 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 5 Project Title:Intersection Safety & Mobility Program Community Planning Area:Citywide Fund: Functional Classification:various Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 314,000 - 44,000 270,000 45,000 45,000 45,000 45,000 45,000 45,000 R-O-W (includes Admin)- - - - - - - - - - Construction 1,380,000 99,652 30,348 1,250,000 150,000 100,000 250,000 250,000 250,000 250,000 Construction Services 356,000 - 26,000 330,000 55,000 55,000 55,000 55,000 55,000 55,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 2,050,000 99,652 100,348 1,850,000 250,000 200,000 350,000 350,000 350,000 350,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 200,000 99,652 100,348 - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 450,000 - - 450,000 250,000 200,000 - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 1,400,000 - - 1,400,000 - - 350,000 350,000 350,000 350,000 Total Sources 2,050,000 99,652 100,348 1,850,000 250,000 200,000 350,000 350,000 350,000 350,000 650,000 1,400,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Intersection Safety & Mobility Program 317 122601 Chris Barnes 425-430-7220 This program will install new traffic signals, software systems to improve traffic signal timing operations, central signal system upgrades or make improvements to existing signals identified by the Transportation Systems' Traffic Signal Priority List. The Priority List is determined by citizen concerns, intersection safety, mobility needs, and intersections that meet MUTCD traffic signal warrants. Historically, one traffic signal is designed and constructed every two-three years to meet safety and mobility needs. This program budgets for projects needed to meet increasing demand, and the need for signalized traffic control. Elements used to prioritize project intersections may include vehicular approach volumes, accident analysis, signal-warrant analysis, and pedestrian volume. Preliminary engineering and design will begin for SW 41st St. and Oakesdale Ave SW in 2018 and construction completed in 2020. 32 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 6 Project Title:Traffic Safety Program Community Planning Area:Citywide Fund: Functional Classification:various Project: Project Length:various Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 34,905 34,905 - - - - - - - - Preliminary Engineering 139,000 - 19,000 120,000 20,000 20,000 20,000 20,000 20,000 20,000 R-O-W (includes Admin)- - - - - - - - - - Construction 948,904 160,904 68,000 720,000 120,000 120,000 120,000 120,000 120,000 120,000 Construction Services 63,000 - 3,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000 Post Construction Services - - - - - - - - - - Other (Trans to 503)11,000 11,000 - - - - - - - - Total Expenses 1,196,809 206,809 90,000 900,000 150,000 150,000 150,000 150,000 150,000 150,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 345,000 55,000 90,000 200,000 130,000 70,000 - - - - Fund Balance 113,259 103,259 - 10,000 10,000 - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 95,000 5,000 - 90,000 10,000 80,000 - - - - Bonds / LID's Formed - - - - - - - - - - Other (Landing Reimb)43,550 43,550 - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 600,000 - - 600,000 - - 150,000 150,000 150,000 150,000 Total Sources 1,196,809 206,809 90,000 900,000 150,000 150,000 150,000 150,000 150,000 150,000 596,809 600,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Traffic Safety Program 317 122115 Chris Barnes 425-430-7220 This ongoing yearly program provides funding for special small-scale traffic safety improvements that are identified and require materials, labor or equipment. This program includes converting school zone signs to electronic operation, installation of pedestrian safety traffic signals including Rectangular Rapid Flashing Beacons (RRFB), and Hawk hybrid beacon signals, bulbouts and radar speed signs for traffic calming. Historically, this level of traffic safety improvements are required on an annual basis. This program budgets for safety projects to address these needs. Projects are typically identified through citizen concerns, analysis of accident records or observation by City Traffic Operations personnel. School speed zone flashing beacons and speed radar signs will be installed for traffic calming. 33 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 7 Project Title:Traffic Operation Devices Program Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000 Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 902,000 62,000 120,000 720,000 120,000 120,000 120,000 120,000 120,000 120,000 Fund Balance 97,000 73,763 23,237 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000 999,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Traffic Operation Devices Program 317 122904 Eric Cutshall 425-430-7423 The City of Renton owns and operates 135 traffic signals, 4800+ street lights, 700+ lane miles and 12,000+ signs. This program replaces failed video detection cameras, signal heads, signal cabinets, UPS batteries and LED indications as needed based on the findings from yearly maintenance programs. This program also provides for new/replacement of signs that are obsolete, faded or that do not meet retro reflectivity requirements, replacement of damaged luminaire and signal poles. This program also replaces pavement markings and failed C-curbing with a more maintenance friendly composite curbing. Most of Renton's traffic signals and UPS systems require extensive maintenance and replacement programs to keep traffic signals operating as efficiently as possible. Signage requires a maintenance program to maintain retro reflectivity requirements. Pavement deterioration has increased the number of failed loops throughout the City and as loops fail they are replaced with video detection cameras and associated equipment. Ongoing based on findings of yearly maintenance programs and engineering work orders. 34 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 8 Project Title:Intelligent Transportation Systems (ITS) Program Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000 R-O-W (includes Admin)- - - - - - - - - - Construction 300,000 38,015 21,985 240,000 40,000 40,000 40,000 40,000 40,000 40,000 Construction Services 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 430,000 38,015 31,985 360,000 60,000 60,000 60,000 60,000 60,000 60,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 60,000 30,000 30,000 - - - - - - - Fund Balance 10,000 8,015 1,985 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 120,000 - - 120,000 60,000 60,000 - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 240,000 - - 240,000 - - 60,000 60,000 60,000 60,000 Total Sources 430,000 38,015 31,985 360,000 60,000 60,000 60,000 60,000 60,000 60,000 190,000 240,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Intelligent Transportation Systems (ITS) Program An additional $30,000/yr has been allocated to this program. 317 122162 Eric Cutshall 425-430-7423 Provides for improvements to the operational efficiency of the roadway system, including development and implementation of signal coordination programs, Adaptive Signal Control, installation of fiber communication, PTZ cameras, Radar signs, LED signs, transit signal priority, Intelligent Traffic Systems (ITS) Master Plan and signal improvements such as protective/permissive phasing. Improving the capacity and efficiency of the existing roadway system is a cost effective element of the transportation program. Installing fiber communication creates higher bandwidths so PTZ cameras can be installed. Fiber optic communication provides the Traffic Management Center with real time traffic conditions, adaptive signal control and ability to view video detection systems. The goal is to have fiber installed to all 135 traffic signals. This program is currently in the process of installing fiber communications and expanding adaptive signal control which affects 70% of the City's traffic signals. 35 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 9 Project Title:Sidewalk Rehabilitation and Replacement Program Community Planning Area:Citywide Fund: Functional Classification:various Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 204 204 - - - - - - - - Preliminary Engineering 61,822 61,822 - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,498,537 361,679 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000 Construction Services 11,467 11,467 - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,572,030 435,172 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 850,000 100,000 100,000 650,000 100,000 110,000 110,000 110,000 110,000 110,000 Fund Balance 722,030 335,172 386,858 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 1,572,030 435,172 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000 1,572,030 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Sidewalk Rehabilitation and Replacement Program The 2019 program funding will be used to repair the sidewalk along Rainier Ave between S 2nd St and Tobin. 317 122801 Michelle Faltaous 425-430-2270 This program provides for the replacement of existing curb and gutter, sidewalks, and curb ramps where such facilities have deteriorated or have been damaged. In order to address deficiencies and provide safe and convenient non-motorized facilities for pedestrians in neighborhoods, the City must have a program to analyze, repair or replace damaged or deteriorated curb and gutter, sidewalks, and curb ramps. There are some places where curb ramps do not exist or are not to current ADA standards and they will be upgraded through this program. Staff continue to receive location requests from the public and other staff for review and prioritization. 36 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 10 Project Title:Bridge Inspection & Repair Program Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 385,056 88,056 87,000 210,000 30,000 20,000 40,000 40,000 40,000 40,000 R-O-W (includes Admin)- - - - - - - - - - Construction 162,000 - 15,000 147,000 20,000 17,000 20,000 35,000 20,000 35,000 Construction Services - - - - - - - - - - Post Construction Services 218,000 - 35,000 183,000 40,000 13,000 40,000 25,000 40,000 25,000 Other - - - - - - - - - - Total Expenses 765,056 88,056 137,000 540,000 90,000 50,000 100,000 100,000 100,000 100,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 450,000 50,000 60,000 340,000 90,000 50,000 50,000 50,000 50,000 50,000 Fund Balance 115,056 38,056 77,000 - - - - - - - Grants Awarded (FEMA)- - - - - - - - - - Grants Awarded (State Share)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 200,000 - - 200,000 - - 50,000 50,000 50,000 50,000 Total Sources 765,056 88,056 137,000 540,000 90,000 50,000 100,000 100,000 100,000 100,000 565,056 200,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Bridge Inspection & Repair Program 317 120106 Derek Akesson 425-430-7337 The Transportation Division inspects 27 bridge structures owned by the City of Renton, every two years. The purpose of these inspections is to monitor the condition of bridge elements in order to identify structural deficiencies in need of repair. The goals of the program are to keep the bridges open and safe for public use, preserve bridge infrastructure by maximizing the useful lie through active maintenance, retrofitting and rehabilitation, and replace bridges with reliable new structures when repair or rehabilitation is not feasible. Per Federal Regulations, the City is required to perform a bridge condition inspection for all bridges, located in the public right-of-way and open for public use, that span 20-ft or more. WSDOT recommends condition inspections be performed on all short span and pedestrian bridges, located with the public right-of-way and open for public use. In order to qualify for Federal Highway Administration (FHWA) bridge funding, the City must stay in compliance with the Federal Regulations. Funds shown under construction are for minor repairs to bridge structures. 37 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 11 Project Title:Barrier Free Transition Plan Implementation Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000 Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 416,000 5,171 46,829 364,000 44,000 64,000 64,000 64,000 64,000 64,000 Construction Services 39,000 - 3,000 36,000 6,000 6,000 6,000 6,000 6,000 6,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 520,000 5,171 54,829 460,000 60,000 80,000 80,000 80,000 80,000 80,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 175,171 5,171 30,000 140,000 60,000 80,000 - - - - Fund Balance 24,829 - 24,829 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 320,000 - - 320,000 - - 80,000 80,000 80,000 80,000 Total Sources 520,000 5,171 54,829 460,000 60,000 80,000 80,000 80,000 80,000 80,000 200,000 320,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Barrier Free Transition Plan Implementation An additional $30,000 for 2019 and $40,000/yr for years 2020-2024 have been allocated to this program. 317 122705 Dan Hasty 425-430-7217 This program provides funding for designing and building features on an "as needed" basis in response to individual requests to improve access for individuals with special needs. A project list has been developed based upon sites identified in the Transition Plan section of the City of Renton Comprehensive Citywide Sidewalk Study. This program implements projects that support the City's effort to transition pedestrian facilities within the right-of-way into conformity with provisions contained in the Americans with Disabilities Act (ADA) Guidelines. The ADA Transition Plan has been adopted on May 18 2015. A programmatic approach is required to ensure compliance with federal law. Maintenance of the GIS database to continue Self Evaluation of existing curb ramps, newly constructed curb ramps, annexations, capital improvement projects, and/or physical condition changes is ongoing. 38 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 12 Project Title:Project Development & Pre-Design Program Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 766,795 77,233 89,562 600,000 100,000 100,000 100,000 100,000 100,000 100,000 Preliminary Engineering 343,204 13,204 30,000 300,000 50,000 50,000 50,000 50,000 50,000 50,000 R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000 Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000 1,110,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Project Development & Pre-Design Program The Trails and Bicycle Master Plan Update is anticipated to be completed in the end of 2018. Once the Trails and Bicycle Master Plan is complete, staff will work on updating the Comprehensive Citywide Walkway Study (last updated in 2009). 317 122150 Vangie Garcia 425-430-7319 Perform critical activities needed for the development of transportation projects that will best serve the needs of Renton and be eligible for grant applications. Also provides for the monitoring of active grant projects for compliance with State and Federal laws, regulations and specifications. Other critical activities to develop future capital improvement projects consist of but are not limited to project scoping, cost estimates, pre-design, interlocal agreements, analyses of existing and projected transportation problems, local and regional mobility goals and deficiency analysis. This program includes small studies funding. Transportation, in partnership with Parks Division is updating the Trail and Bicycle Master Plan. 39 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 13 Project Title:Arterial Circulation Program Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000 Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 1,093,454 53,454 145,000 895,000 145,000 150,000 150,000 150,000 150,000 150,000 Fund Balance 1,546 - 1,546 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000 1,095,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Arterial Circulation Program Transportation will develop a work plan to create a Transit Master Plan. 317 120029 Vangie Garcia 425-430-7319 This program provides for the short and long-range planning and traffic analyses required to evaluate and update proposed transportation improvements projects, to assess the impacts of new development proposals, and to recommend local and regional transportation system improvements for all modes of travel. This program also covers programmatic activities to maintain eligibility for grant funding, such as assuring that project specifications and management comply with current State and Federal standards and regulations, Title VI reporting and ADA Transition Plan implementation. This program will also provide coordination with the I-405 project team, to assure it provides the maximum benefits and minimum problems for Renton's transportation system. State and Federal government regulations and legislation, the Growth Management Act (GMA), and the Puget Sound Regional Council Vision 2040 highlight the increasing importance of making sure that local and regional transportation plans are coordinated to the benefit of Renton make ongoing multi-modal planning a high priority need. In order to meet the City's Business Plan Goals, transportation will play a key role with public and private partnerships to promote economic vitality. This project will fund the ongoing planning work which will lead to refinement and/or adjustment of the of improvement projects on the arterial network identified in the Transportation Element of the City's 2015 Comprehensive Plan and other long-range planning documents. 40 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 14 Project Title:1% For The Arts Program Community Planning Area:N/A Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000 Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000 Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000 133,823 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 1% For The Arts Program 317 122112 Heather Gregersen 425-430-7393 Funding is tied to the calculated share of eligible types of transportation projects and transportation funding subject to the City's 1% for the Arts Program. All gateway project proposals under this program are subject to approval of the Arts Commission. This program transfers funds to Fund 125, which is being managed by the Department of Community and Economic Development. Program is now based on actual design and construction costs. $11,151 was transferred in 2013 for 2012 capital expenditures. $10,454 was transferred in 2014 for 2013 capital expenditures. $9,344 was transferred in 2015 for 2014 capital expenditures. $16,767 was transferred in 2016 for 2015 expenditures. $28,823 was transferred in 2017 for 2016 expenditures. 41 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 15 Project Title:Bronson Way Bridge - Seismic Retrofit and Painting Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,950,000 - - 1,950,000 - 1,950,000 - - - - Construction Services 430,000 - - 430,000 - 430,000 - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (FHWA Bridge 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - - 3,000,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Bronson Way Bridge - Seismic Retrofit and Painting 317 NEW Derek Akesson 425-430-7337 The Bronson Way Bridge was built by WSDOT in 1939. Ownership was transferred to the City in January 2018 as part of the SR-900 turnback agreement. It is a three span bridge that crosses over the Cedar River. The project will remove the existing paint from the steel girders, repair corrosion damage and apply a new protective paint system. The project will also perform a seismic analysis and retrofit along with other improvements. The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load carrying capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquefication susceptibility during seismic events. New project. In April 2018, the project was awarded $3,000,000 of Washington State funding (2018 Supplemental Transportation Budget) to perform a seismic retrofit and painting of the bridge. No local match is required. 42 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 16 Project Title:Duvall Ave NE - NE 7th St to Sunset Blvd NE Community Planning Area:Highlands & East Plateau Fund: Functional Classification:Minor Arterial Project: Project Length:0.67 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,044,136 353,250 335,435 355,451 355,451 - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 4,559,488 - 3,576,000 983,488 983,488 - - - - - Construction Services 900,200 - 727,000 173,200 173,200 - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 6,503,824 353,250 4,638,435 1,512,139 1,512,139 - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 90,000 - 60,000 30,000 30,000 - - - - - Fund Balance & Held Reserve 649,121 90,838 447,658 110,625 110,625 - - - - - Grants Awarded (TIB 74.285%)3,468,289 262,412 3,205,877 - - - - - - - Grants Awarded (DOE 75%)1,223,939 - 174,900 1,049,039 1,049,039 - - - - - Mitigation 1,072,475 - 750,000 322,475 322,475 - - - - - Bonds / LID's Formed - - - - - - - - - - Other (Water Dept)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 6,503,824 353,250 4,638,435 1,512,139 1,512,139 - - - - - 6,503,824 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Duvall Ave NE - NE 7th St to Sunset Blvd NE The City was awarded a TIB grant in the amount of $3,468,289 (2015) for the roadway reconstruction between NE 10th St and NE 12th St, curb, gutter, sidewalk and streetlights on the west side and channelization from NE 12th St to south of the intersection with NE Sunset Blvd. The City was also awarded a Department of Ecology (DOE) grant (2018) in the amount of $1,223,939 for water quality improvements via the installation of water quality treatment facilities. A future phase will install non-motorized improvements along the east side of Duvall Ave NE, from NE 7th St to NE 12th St. This project is anticipated to be ready for construction in early 2019. 317 122702 Flora Lee 425-430-7303 Reconstruction/resurfacing of roadway, including new pavement, curb, gutter, sidewalk, street lights, storm drainage, channelization and bike lanes from NE 7th St to Sunset Blvd NE. Complete roadway improvements, bicycle lanes and sidewalks on Duvall Ave NE, from NE 7th St to Sunset Blvd NE. Condition of the existing roadway pavement requires road reconstruction in segments of the roadway. Project will enhance safety for pedestrians, bicyclists and vehicular along this corridor. 43 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 17 Project Title:Houser Way Bridge - Seismic Retrofit and Painting Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - - R-O-W (includes Admin)50,000 - - 50,000 50,000 - - - - - Construction 2,189,450 - - 2,189,450 - 2,189,450 - - - - Construction Services 435,000 - - 435,000 - 212,450 222,550 - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 3,294,450 - 70,000 3,224,450 470,000 2,531,900 222,550 - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance 72,900 - 9,450 63,450 63,450 - - - - - Grants Awarded (FHWA Bridge 2,999,000 - 60,550 2,938,450 406,550 2,531,900 - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 222,550 - - 222,550 - - 222,550 - - - Total Sources 3,294,450 - 70,000 3,224,450 470,000 2,531,900 222,550 - - - 3,071,900 222,550 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Houser Way Bridge - Seismic Retrofit and Painting 317 NEW Derek Akesson 425-430-7337 The Houser Way Bridge was built by the City of Renton in 1960. It is a three span bridge that crosses over the Cedar River. The project will remove the existing paint from the steel girders, repair corrosion damage and apply a new protective paint system. The project will also perform a seismic analysis and retrofit and replace/upgrade the bridge rails along with other improvements. The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load carrying capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquification susceptibility during seismic events. The bridge rail has been damaged. New project. In late 2017, the project was awarded a Federal Highway Administration (FHWA) grant of $2,999,000 to perform a seismic retrofit and painting of the bridge. A 13.5% local match is required for Preliminary Engineering and ROW. If construction is authorized by December 2020, the project is eligible for 100% FHWA funding for the eligible costs. 44 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 18 Project Title:Lake Washington Loop Trail Community Planning Area:City Center Fund: Functional Classification:varies Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 2,261,301 597,219 314,082 1,350,000 - - 1,200,000 150,000 - R-O-W (includes Admin)670,000 - 670,000 - - - - - - - Construction 4,880,000 - 530,000 4,350,000 300,000 1,350,000 - - 200,000 2,500,000 Construction Services 1,492,000 - 27,000 1,465,000 40,000 75,000 - - 600,000 750,000 Post Construction Services - - - - - - - - - Other - - - - - - - - - - Total Expenses 9,303,301 597,219 1,541,082 7,165,000 340,000 1,425,000 - 1,200,000 950,000 3,250,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 124,984 49,984 - 75,000 - 75,000 - - - - Fund Balance + Held Reserve - - - - - - - - - - Grants Awarded (TAP)346,000 329,855 16,145 - Grants Awarded (STP ROW)575,000 - 575,000 - - - - - - - Grants Awarded (Ped/Bike Program - PE Phase 3)426,000 217,380 208,620 - - - - - - - Grants Awarded (Ped/Bike Program - CN)430,000 - 370,659 59,341 59,341 - - - - - Grants Awarded (STP - CN Phase 3 1,694,278 370,658 1,323,620 280,659 1,042,961 - - - - Mitigation 307,039 - - 307,039 - 307,039 - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 5,400,000 - - 5,400,000 - - 1,200,000 950,000 3,250,000 Total Sources 9,303,301 597,219 1,541,082 7,165,000 340,000 1,425,000 - 1,200,000 950,000 3,250,000 3,903,301 5,400,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Lake Washington Loop Trail Phase 3 construction is expected to start in the fall or winter of 2019. 317 122802 Michelle Faltaous 425-430-7301 The project will construct approximately 1.3 miles of pedestrian and bicycle facilities to complete a gap in the Lake Washington trail system. Improvements include a 12-foot wide combined pedestrian/bicycle path, a landscaped buffer separating the path from the travelled roadway, pedestrian level lighting. For the segment located along Airport Way, the facilities will include a bike track and sidewalk, which will involve removing one westbound lane of traffic on Airport Way. The project will separate pedestrians and bicyclists from the vehicular traffic, enhancing safety and encouraging residents to use active transportation modes. The City was awarded the following grants: TAP = $346,000 (2013); STP Non-Motorized = $575,000 (2015); Ped & Bike = $426,000 (2015); STP = $1,694,278; Ped & Bike Safety = $ 430,000 (under recommendation for 2017). Construction has been implemented in phases, with Phases 1 and 2 completed. Phase 3 (Logan Ave N/Cedar River to Rainier Ave N) design is underway.Phase 4 is from Airport Way/Rainier Ave N intersection to north City limits (programmed in 2020-2022). 45 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 19 Project Title:NE Sunset Boulevard (SR 900) Corridor Improvements Community Planning Area:Highlands Fund: Functional Classification:Principal Project: Project Length:3.0 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 200,000 200,000 - - - - - - - - Preliminary Engineering 3,500,833 501,831 990,002 2,009,000 209,000 - 1,000,000 600,000 200,000 - R-O-W (includes Admin)3,300,000 - - 3,300,000 250,000 2,750,000 300,000 - - - Construction 20,000,000 - - 20,000,000 - - 5,000,000 5,000,000 5,000,000 5,000,000 Construction Services 5,000,000 - - 5,000,000 - - 1,250,000 1,250,000 1,250,000 1,250,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 32,000,833 701,831 990,002 30,309,000 459,000 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 312,866 2,364 277,527 32,975 32,975 - - - - - Fund Balance + Held Reserve 324,032 74,032 250,000 - - - - - - - Grants Awarded (STP/CMAQ)1,313,935 425,435 462,475 426,025 426,025 - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (REET)200,000 200,000 - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 29,850,000 - - 29,850,000 - 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000 Total Sources 32,000,833 701,831 990,002 30,309,000 459,000 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000 2,150,833 29,850,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program NE Sunset Boulevard (SR 900) Corridor Improvements 30% Design of the corridor improvements is completed. WSDOT is currently reviewing the channelization plan. Project will be on hold until ROW funding can be identified. 317 122902 Keith Woolley 425-430-7318 This project will seek to address pedestrian, transit and bicycle needs. This corridor needs a series of key improvements to improve traffic operations such as channelization, traffic signal modifications, signal treatments, possible queue jumps, access management through installation of medians. The corridor limits are from I-405 on the west and to the east City limits. This corridor has strong potential for non-motorized and transit usage. The Sunset area is experiencing residential and retail growth. The Sunset Area Planned Action EIS prepared in 2011 delineated transportation needs along Sunset Blvd from N Park Dr to Monroe Ave NE (estimated at $33M). The project has received a STP/CMAQ grant in the amount of $1,313,935 for design and is on the PSRC contingency list for ROW funding. Transportation will continue to look into other funding sources, such as TIB, for the ROW and construction phases. 46 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 20 Project Title:Park Avenue North Extension Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:0.23 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,000,000 100,091 649,909 250,000 250,000 - - - - - R-O-W (includes Admin)1,500,000 - 300,000 1,200,000 1,200,000 - - - - - Construction 4,000,000 - - 4,000,000 3,500,000 500,000 - - - - Construction Services 1,000,000 - - 1,000,000 875,000 125,000 - - - - Post Construction Services - - - - - - - - - - Other (BNSF/Gate)- - - - - - - - - - Total Expenses 7,500,000 100,091 949,909 6,450,000 5,825,000 625,000 - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 100,091 100,091 - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (LRF)7,399,909 - 949,909 6,450,000 5,825,000 625,000 - - - - Other (Developer)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 7,500,000 100,091 949,909 6,450,000 5,825,000 625,000 - - - - Park Avenue North Extension 7,500,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 317 122190 Hebe Bernardo 425-430-7232 The project will extend Park Ave N to the north of Logan Ave N, to provide access to Southport, PSE property and The Boeing Company. Improvements include bicycle and pedestrian facilities, illumination, landscaping. With the additional development growth in the North Renton area, which includes The Landing and the Southport residential/hotel/office development, this project will construct improvements to improve accessibility. The design work will be completed in 2019 and the project is scheduled to go to bid in June of 2019. 47 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 21 Project Title:Rainier Ave S/N Phase 4 - S 3rd Street to NW 3rd Pl Community Planning Area:City Center Fund: Functional Classification:Principal Project: Project Length:0.51 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 3,000,000 543,395 1,505,282 951,323 500,000 451,323 - - - - R-O-W (includes Admin)3,500,000 - - 3,500,000 1,000,000 1,500,000 1,000,000 - - - Construction 10,500,000 - - 10,500,000 - - 6,000,000 4,500,000 - - Construction Services 3,300,000 - - 3,300,000 - - 1,800,000 1,350,000 150,000 - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 20,300,000 543,395 1,505,282 18,251,323 1,500,000 1,951,323 8,800,000 5,850,000 150,000 - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 709,600 56,387 103,213 550,000 - - 100,000 450,000 - - Fund Balance 239,552 39,552 100,000 100,000 - - 100,000 - - - Grants Awarded (STP PE)2,600,000 447,456 1,302,069 850,475 750,475 100,000 - - - - Grants Awarded (STP ROW)3,000,000 - - 3,000,000 442,000 1,258,000 1,300,000 - - - Grants Awarded (STP CN)4,500,000 - - 4,500,000 - - 4,500,000 - - - Mitigation 2,695,848 - - 2,695,848 307,525 593,323 700,000 945,000 150,000 - Bonds / LID's Formed - - - - - - - - - - Other (TIB Grant)*6,555,000 - - 6,555,000 - - 2,100,000 4,455,000 - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 20,300,000 543,395 1,505,282 18,251,323 1,500,000 1,951,323 8,800,000 5,850,000 150,000 - 20,300,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Rainier Ave S/N Phase 4 - S 3rd Street to NW 3rd Pl Phase 4 of the Rainier Ave S Corridor Improvements has been separated into two phases due to cost and feasibility. Currently, there is a Renton Airport Master Plan process that may affect the alignment of Airport Way, which is at the northern end of Phase 4. This grant request is to fund the construction of Phase 4A from S 3rd St to S Tobin St. The City of Renton will construct Phase 4B after the Airport Master Plan is final and approved. *Transportation plans to also apply for a TIB grant for the construction of Phase 4A. Previous phases of Rainier were constructed with TIB funds but if this phase does not receive TIB funding, the City will use local funds to construct the project. 317 122195 Michelle Faltaous 425-430-7301 This is Phase 4 of the Rainier Ave Corridor Improvements, and will extend the improvements from S 3rd St to NW 3rd Pl. Project elements include sidewalk widening with streetscaping, adding pedestrian-scale illumination, adding a pedestrian actuated traffic signal, upgrading existing traffic signals, transit facility improvements, planted buffer strips and landscaped medians. Also includes a ped/bike path on the east side of Rainier Ave N, between Airport Way and NW 3rd Pl. Rainier Ave is a critical corridor in central Renton with existing operational problems and in need of infrastructure enhancements to provide greater ease of non-motorized and transit-based travel. It also provides improved access to the Renton Airport and Boeing's Renton Plant. Improvements will enhance traffic flow and reduce accidents. A STP grant in the amount of $2,600,000 was awarded (2014) for design of Phase 4 and design is currently underway. Additional STP grants were awarded for Right-of-Way for $3,000,000 and for construction of Phase 4A for $4,500,000. 48 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 22 Project Title:Renton Connector Community Planning Area:City Center Fund: Functional Classification:Urban Collector Project: Project Length:0.5 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,500,000 - - 1,500,000 - - 278,700 621,300 600,000 - R-O-W (includes Admin)- - - - - - - - - - Construction 12,213,000 - - 12,213,000 - - - - 3,363,000 8,850,000 Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 13,713,000 - - 13,713,000 - - 278,700 621,300 3,963,000 8,850,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 13,713,000 - - 13,713,000 - - 278700 621,300 3,963,000 8,850,000 Total Sources 13,713,000 - - 13,713,000 - - 278,700 621,300 3,963,000 8,850,000 - 13,713,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Renton Connector 317 NEW Vangie Garcia 425-430-7319 The Renton Connector project will install a continuous non-motorized facility along Burnett Ave S. between S. 2nd St and S. 5th St via separated walkways, protected bicycle lanes (cycle track), and a multi-use path. This project will also include reduced travel lanes, landscaped medians, and reconfigured public parking areas in order to provide opportunities to incorporate art, play spaces, and resting areas along the connector. Intersection improvements will include traffic signalization improvements and curb ramp upgrades to ADA standards. As a key element of the Downtown Civic Core Vision and Action Plan, The Renton Connector is a new urban trail, or "greenway", that creates a signature Civic Core and Downtown green spine and regional trail connection between the Cedar River Trail, Lake to Sound Trail, Lake Washington Loop Trail, and the Eastside Rail Corridor for pedestrians and cyclists between the Cedar River, City Hall and the South Renton Transit Center to the South. New Project. Project is pending funding availability. Transportation has applied for grants to begin design and will continue to look into other funding sources. 49 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 23 Project Title:116th Ave SE Improvements Community Planning Area:Benson Fund: Functional Classification:Minor Arterial Project: Project Length:2.5 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,313,179 113,179 - 1,200,000 - - 600,000 600,000 - - R-O-W (includes Admin)2,800,000 - - 2,800,000 - - 1,000,000 1,800,000 - - Construction 5,315,028 615,028 - 4,700,000 - - - 1,000,000 2,000,000 1,700,000 Construction Services 1,547,102 147,102 - 1,400,000 - - - 300,000 600,000 500,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 10,975,309 875,309 - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 221,638 221,638 - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (CMAQ+SRTS)653,671 653,671 - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 10,100,000 - - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000 Total Sources 10,975,309 875,309 - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000 875,309 10,100,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 116th Ave SE Improvements Transportation applied for a FY 2020 WSDOT Pedestrian-Bicycle grant for the design of a walkway and a bike lane on the west side of 116th Ave SE, between SE 168th St and SE 160th St. 317 122117 Flora Lee 425-430-7303 Widen roadway to provide a 3-lane roadway with bike lanes along 116th Ave SE and Edmonds Way SE, including new pavement, curb, gutter, sidewalk, street lights, traffic signals, storm drainage, channelization and landscaping from Puget Drive SE to the southern City limits. Benson Hill Community Plan recommended improvements for a first phase, based on the neighborhood needs. The priority, cost and schedule for the phased improvements will be determined based on available funding. 116th Ave SE is classified as a minor arterial. Non-continuous segments of sidewalk exist along the roadway. Improvements will enhance vehicular, bicycle and pedestrian safety along this important north-south transportation corridor. The corridor improvements are estimated at $33M. Phase 1 Improvements (SE Petrovitsky Rd to SE 168th St) are shown as programmed for 2020-2024. Staff will be developing scope, cost and schedule for future phases. 50 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 24 Project Title:South 2nd Street Conversion Project Community Planning Area:City Center Fund: Functional Classification:Principal Project: Project Length:0.5 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,450,000 - - 1,450,000 100,000 1,350,000 - - - R-O-W (includes Admin)- - - - - - - - - - Construction 12,000,000 - - 12,000,000 - - - 6,000,000 6,000,000 - Construction Services 3,600,000 - - 3,600,000 - - - 1,800,000 1,800,000 - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 17,050,000 - - 17,050,000 - 100,000 1,350,000 7,800,000 7,800,000 - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 100,000 - - 100,000 - 100,000 - - - - Fund Balance - - - - - - - - - - Grants Awarded (STP)1,200,000 - - 1,200,000 - - 1,200,000 - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (WSDOT Turnback)364,931 - - 364,931 - - 150,000 214,931 - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 15,385,069 - - 15,385,069 - - 7,585,069 7,800,000 - Total Sources 17,050,000 - - 17,050,000 - 100,000 1,350,000 7,800,000 7,800,000 - South 2nd Street Conversion Project 1,664,931 15,385,069 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program The City was awarded $1.2M STP funds for preliminary engineering in the PSRC Countywide competition. There is $300,000 for this project that is third in line on the Regional project contingency list. 317 Vangie Garcia 425-430-7319 The South 2nd Street Conversion Project will be improving multimodal mobility in around the downtown core by converting an existing 4–lane one-way roadway to a roadway with one through-lane in each direction between Main Ave South and Rainier Ave South. This project also includes pedestrian and bicycle facilities, traffic operations improvements, and transit upgrades that will provide better traffic operation and circulation for all modes of transportation. The improvements include a westbound bypass transit lane from just west of Logan Ave S to just east of Lake Avenue. Transit facility upgrades include new RapidRide stops and a transit queue jump at the new traffic signal at the Shattuck intersection. This project is one of the strategies identified in the City Center Community Plan as well as the Downtown Civic Core Action Plan. The project enhances downtown Renton as a destination area, while improving circulation and enhancing pedestrian safety and environment. The intersection of S 2nd St and Burnett is key connection to The Renton Connector Project (TIP No. 22) Since grant funding for design is for FY 2021, we hope to request advance construction funds to get started on design in order to apply for more grant opportunities. 51 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 25 Project Title:Williams Ave Bridge - Seismic Retrofit and Painting Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - - R-O-W (includes Admin)50,000 - - 50,000 50,000 - - - - - Construction 2,175,450 - - 2,175,450 - 2,175,450 - - - - Construction Services 435,000 - - 435,000 - 435,000 - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 3,280,450 - 70,000 3,210,450 470,000 2,740,450 - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 132,000 - 9,450 122,550 - 122,550 - - - - Fund Balance 163,450 - - 163,450 63,450 100,000 - - - - Grants Awarded (FHWA Bridge 2,985,000 - 60,550 2,924,450 406,550 2,517,900 - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 3,280,450 - 70,000 3,210,450 470,000 2,740,450 - - - - 3,280,450 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Williams Ave Bridge - Seismic Retrofit and Painting 317 NEW Derek Akesson 425-430-7337 The Williams Ave Bridge was built by the City of Renton in 1954. It is a three span bridge that crosses over the Cedar River. The project will remove the existing paint from the steel girders, repair corrosion damage and apply a new protective paint system. The project will also perform a seismic analysis and retrofit along with other improvements. The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load carrying capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquefication susceptibility during seismic events. New project. In late 2017, the project was awarded a Federal Highway Administration (FHWA) grant of $2,985,000 to perform a seismic retrofit and painting of the bridge. A 13.5% local match is required for Preliminary Engineering and ROW. If construction is authorized by December 2020, the project is eligible for 100% FHWA funding for eligible costs. 52 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 26 Project Title:Williams Ave S and Wells Ave S Conversion Project Community Planning Area:City Center Fund: Functional Classification:Principal Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 1,147,300 128,030 1,019,270 - - - - - - - R-O-W (includes Admin)130,000 - 130,000 - - - - - - - Construction 7,547,000 - 2,364,931 5,182,069 1,233,800 3,948,269 - - - - Construction Services 2,100,000 - - 2,100,000 500,000 1,600,000 - - - - Post Construction Services - - - - - - - - - - Other (BNSF CM Agreement)1,000,000 - - 1,000,000 200,000 800,000 - - - - Total Expenses 11,924,300 128,030 3,514,201 8,282,069 1,933,800 6,348,269 - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 220,000 - 10,000 210,000 30,000 180,000 - - - - Fund Balance 540,000 128,030 411,970 - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (STP)3,850,000 - - 3,850,000 1,453,800 2,396,200 - - - - Mitigation 1,157,965 - 407,965 750,000 450,000 300,000 - - - - Bonds / LID's Formed - - - - - - - - - - Other (WSDOT Mitigation)319,335 - 319,335 - - - - - - - Other (WSDOT Turnback)2,364,931 - 2,364,931 - - - - - - - Other (Utilties Reimb)- - - - - - - - - - - - - - - - - - - - Undetermined 3,472,069 - - 3,472,069 - 3,472,069 - - - - Total Sources 11,924,300 128,030 3,514,201 8,282,069 1,933,800 6,348,269 - - - - 8,452,231 3,472,069 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Williams Ave S and Wells Ave S Conversion Project The City was awarded a STP grant in the amount of $3,850,000 in 2016. Design starting in 2017 and construction is anticipated to start in 2019. 317 122908 Keith Woolley 425-430-7318 The project provides pedestrian and bicyclists facilities and enhancements, traffic operation and circulation improvements in Downtown. The improvements include adding signalized raised intersections with bulb outs, lighting, street furniture, streetscape, bike racks, signage and converting Williams Ave S and Wells Ave S to two-way traffic operations. This project is one of the strategies identified in the City Center Community Plan. The project enhances downtown Renton as a destination area, while improving circulation, reducing traffic speeds and enhancing pedestrian safety. A feasibility study, including a Downtown Circulation Traffic Analysis for the conversion to two-way operations was completed. 53 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 27 Project Title:Carr Road Improvements Community Planning Area:Talbot & Benson Fund: Functional Classification:Major Arterial Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 50,000 - - 50,000 50,000 - - - - - Preliminary Engineering 784,421 666,866 117,555 - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 834,421 666,866 117,555 50,000 50,000 - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance 78,424 78,424 - - - - - - - - Grants Awarded (Fed Safety)660,000 542,445 117,555 - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 95,997 45,997 - 50,000 50,000 - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 834,421 666,866 117,555 50,000 50,000 - - - - - 834,421 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Carr Road Improvements 317 122920 Vangie Garcia 425-430-7319 A corridor study prepared by King County in 2003 identified the need for roadway improvements from Lind Ave SW and SW 43rd St intersection and extend east crossing SR 167 and ending at 116th Ave SE. Potential improvements vary from roadway realignment/widening at several locations to address geometric deficiencies, widening to 5-lane roadway (2 lanes westbound, 3 lanes eastbound), including bicycle lanes on new alignment. The total project cost is estimated as $80M. Carr Road is classified as a principal arterial. It has four lanes of traffic with left-turn lanes at intersections. Improvements are necessary to enhance vehicle traffic capacity and safety for vehicles, bicycles, and pedestrians on this major east-west transportation corridor. Future roadway improvement options include spot safety improvements, bicycle and pedestrian improvements, roadway widening and roadway on new alignment. Staff will be developing scope, cost and schedule for the intersection of Talbot Rd near Valley Medical Center. 54 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 28 Project Title:Houser Way S/N Non-Motorized Improvements Community Planning Area:City Center Fund: Functional Classification:Principal Arterial Project: Project Length:0.36 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 220,000 - - 220,000 - - - 220,000 - - R-O-W (includes Admin)165,000 - - 165,000 - - - 165,000 - - Construction 750,000 - - 750,000 - - - - 400,000 350,000 Construction Services 900,000 - - 900,000 - - - - 360,000 540,000 Post Construction Services 152,000 - - 152,000 - - - - 76,000 76,000 Other - - - - - - - - - - Total Expenses 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000 Total Sources 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000 - 2,187,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Houser Way S/N Non-Motorized Improvements 317 NEW Vangie Garcia 425-430-7319 This project would install a separated bike facility on the north side of Houser Way S/N, between Mill Ave S. and Bronson Way N. Intersection crossings would be improved at Cedar River Park Drive and Mill Ave S. The project will include planing and pavement overlay, channelization, and intersection crossing improvements. For feasibility and constructibility issues, the roadway and pedestrian bridge sections would not be part of this project. The feedback during the public engagement process for the Trails and Bicycle Master Plan update identified Houser Way as the route for the Eastside Rail Corridor alignment. With the development of the Civic Core Plan, development of this section of the bicycle network creates an important connection point for bicycle traffic between the north and south portions of the City's urban growth center. Creating a bike facility down to Mill Ave S creates a connection to the Cedar River Trail. The crossing at Cedar River Park Drive is a connection point for people connecting from Liberty Park to the Renton Community Center. New Project. 55 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 29 Project Title:Houser Way North - North 8th Street to Lake Washington Blvd Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 900,000 - - 900,000 - - - 900,000 - - R-O-W (includes Admin)165,000 - - 165,000 - - - 165,000 - - Construction 3,000,000 - - 3,000,000 - - - - 1,200,000 1,800,000 Construction Services 900,000 - - 900,000 - - - - 360,000 540,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000 Total Sources 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000 317 Houser Way North - North 8th Street to Lake Washington Blvd Bob Mahn 425-430-7322 This project will widen and realign the existing one lane roadway to a two-lane roadway and includes intersection improvements to convert Houser Way N to a two-way operation. Includes new roadway, curbs, pedestrian-bicycle path, drainage, signals, lighting, signing and channelization. The City of Renton travel demand model predicts traffic volumes increasing significantly in the North Renton Area in the near future. One of the recommendations to improve northbound access to Lake Washington Blvd is to convert Houser Way N to a two-way operations, between N 8th St and Lake Washington Blvd. A conceptual layout of the two-way approach to the intersection of Houser Way and Lake WA Blvd has been completed. This project will coordinate with the Southport Development improvements to the Southport entrance at the Lake WA Blvd/Coulon Park intersection. - 4,965,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 56 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 30 Project Title:Lake to Sound (L2S) Trail Community Planning Area:Valley & City Center Fund: Functional Classification:Minor and Principal Arterial, and Other Project: Project Length:1.6 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 800,000 800,000 - - - - - - - - R-O-W (includes Admin)110,000 110,000 - - - - - - - - Construction 2,240,000 - - 2,240,000 2,240,000 - - - - - Construction Services 560,000 - - 560,000 560,000 - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 3,710,000 910,000 - 2,800,000 2,800,000 - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (KC+CMAQ Grant)3,710,000 910,000 - 2,800,000 2,800,000 - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 3,710,000 910,000 - 2,800,000 2,800,000 - - - - - 3,710,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Lake to Sound (L2S) Trail If L2S uses BNSF ROW for central section, the alignment would likely be on the south side, lower bank. Downtown Civic Core team prefers alignment with city-owned Houser Way section along the south side of ROW. Alignment within BNSF would require King County to purchase ROW and new bridges to cross roadways. An alignment on 7th Street can be developed as a reasonable alternative or parallel route as a trail within railroad ROW is developed (TIP #42). 317 122903 Vangie Garcia 425-430-7319 The Lake to Sound (L2S) Trail is a joint partnership between the cities of Renton, SeaTac, Tukwila, Burien and Des Moines, in coordination with King County. The 17-mile L2S Trail will provide an east-west connection between the shoreline of Lake Washington (Renton) and the shoreline of Puget Sound (Des Moines). Phase A goes from Naches Ave SW (Renton) to Fort Dent Park (Tukwila). The length between Naches Ave SW and Mill Ave S are future phases. Phase A will connect Fort Dent (Tukwila) to the larger system of regional trails in South King County, including the Green River Trail, the Interurban Trail and the Cedar River Trail. Phase A will provide a 12-foot wide asphalt paved multi-use trail, with 2-foot gravel shoulders. In the Downtown Civic Core Plan, the L2S Trail connects to the Eastside Rail Corridor (ERC) and the Renton Connector (TIP #22). This project received a $950,000 CMAQ grant for construction of Phase A (Naches Ave SW to Fort Dent Park inTukwila), in 2014. No City match is required. King County is leading the design for construction of Phase A, Fort Dent Park Connection. Construction of Phase A is anticipated to be completed in 2019. City staff will be developing scope, cost and schedule for future phases. 57 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 31 Project Title:Lake Washington Blvd N - Park Ave N to Gene Coulon Memorial Park Community Planning Area:City Center Fund: Functional Classification:Collector Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 14,899 14,899 - - - - - - - - Preliminary Engineering 28,460 28,460 - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,973,821 373,821 - 1,600,000 1,600,000 - - - - - Construction Services 410,363 10,363 - 400,000 400,000 - - - - - Post Construction Services 15,934 15,934 - - - - - - - - Other - - - - - - - - - - Total Expenses 2,443,477 443,477 - 2,000,000 2,000,000 - - - - - Resources: Vehicle Fuel Tax 2,807 2,807 - - - - - - - - Business & Occupation Share 2,734 2,734 - - - - - - - - Fund Balance 8,828 8,828 - - - - - - - - Grants Awarded (1)149,501 149,501 - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 258,353 258,353 - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (Dev. Expend)2,000,000 - - 2,000,000 2,000,000 - - - - - Other (Dev. Reimb)21,253 21,253 - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 2,443,476 443,476 - 2,000,000 2,000,000 - - - - - 2,443,476 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Lake Washington Blvd N - Park Ave N to Gene Coulon Memorial Park Last Phase underway. Design for Lake Washington Blvd is complete. Construction to start in the summer of 2018 and be completed by the end of 2019. 317 122121 Bob Hanson 425-430-7319 This project includes road widening, traffic signals, railroad crossings, drainage, curb, gutter, sidewalks and bicycle lanes. Developer to design and construct improvements, and get credit toward mitigation contribution. The developer is completing the project in 3 phases. This project will serve the development and access needs to Coulon Park and the Southport Development. Agreement with developer to credit traffic mitigation towards the costs of certain improvements. The hotel tower was complete in 2018. The office towers are under construction. This project will be funded by the development of Southport. The costs shown below are for the estimated mitigation credit, per agreement with the developer. 58 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 32 Project Title:Lind Ave SW - SW 16th St to SW 43rd St Community Planning Area:Valley Fund: Functional Classification:Minor Arterial Project: Project Length:1.69 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 650,000 - - 650,000 - - - 400,000 250,000 - R-O-W (includes Admin)- - - - - - - - - - Construction 3,200,000 - - 3,200,000 - - - - 1,200,000 2,000,000 Construction Services 550,000 - - 550,000 - - - - 200,000 350,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000 Total Sources 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000 - 4,400,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Lind Ave SW - SW 16th St to SW 43rd St 317 120024 Bob Mahn 425-430-7322 Widen existing roadway to five lanes where required. Includes new roadway, curbs, sidewalks, drainage, signals, lighting, signing and channelization. Increasing traffic demands in the Valley due in part to development will create the need to increase the capacity of this major north/south arterial. A potential project is a signal installation at the intersection at Lind Ave SW and SW 34th St (currently unsignalized). Additionally, improvements may result from future WSDOT I-405 plans which include an interchange at Lind Ave SW (currently unfunded). The needs, priorities and schedules for improvements on Lind Ave SW will be determined through Arterial Circulation studies. 59 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 33 Project Title:Logan Ave North Improvements Community Planning Area:City Center Fund: Functional Classification:Principal Arterial Project: Project Length:0.76 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 39,760 39,760 - - - - - - - - Preliminary Engineering 3,245,616 1,005,616 - 2,240,000 - - - - 1,240,000 1,000,000 R-O-W (includes Admin)9,033,266 33,266 - 9,000,000 - - - - - 9,000,000 Construction 5,108,330 4,908,330 200,000 - - - - - - - Construction Services 1,167,070 1,081,070 86,000 - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 18,594,042 7,068,042 286,000 11,240,000 - - - - 1,240,000 10,000,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 27,065 27,065 - - - - - - - - Fund Balance 59,090 20,111 38,979 - - - - - - - Grants Awarded (STP)3,074,943 2,988,943 86,000 - - - - - - - Grants Awarded (TIB)3,912,242 3,751,221 161,021 - - - - - - - Mitigation 200,000 200,000 - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (Integra Phone)53,702 53,702 - - - - - - - - Other (Boeing Lot)27,000 27,000 - - - - - - - - - - - - - - - - - - Undetermined 11,240,000 - - 11,240,000 - - - - 1,240,000 10,000,000 Total Sources 18,594,042 7,068,042 286,000 11,240,000 - - - - 1,240,000 10,000,000 Logan Ave North Improvements 7,354,042 11,240,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Project has been closed out for Phase 1. 317 122303 Vangie Garcia 425-430-7319 Phase 1 (Cedar River Bridge to N 6th St) is complete. Phase 2 (N 6th St to Park Ave N) will add a NB lane, new curb, gutter, sidewalks (on the east side), landscaped buffer, and a pedestrian/bicycle trail (west side), streetlights, pedestrian scale illumination, crosswalks, channelization. The increase in traffic and the new RapidRide transit have warranted widening to add a northbound lane. Included with the improvements are urban roadway amenities to implement "Complete Streets" practice per City code. Project is on hold until the Boeing Company is in a position to dedicate property to the project. 60 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 34 Project Title:Maple Valley Highway Barriers Community Planning Area:Cedar River Fund: Functional Classification:Principal Arterial Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 522,970 - - 522,970 - - 274,035 248,935 - - R-O-W (includes Admin)156,300 - - 156,300 - - 25,000 131,300 - - Construction 1,804,160 - - 1,804,160 - - - 1,804,160 - - Construction Services 654,470 - - 654,470 - - - 654,470 - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - - Total Sources 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - - - 3,137,900 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Maple Valley Highway Barriers 317 Chris Barnes 425-430-7220 This project includes two barriers: One is to install a concrete median barrier between east and westbound travel lanes of the SR 169 S-Curve between the Riviera Apartments and S. 5th Street including associated roadway widening to add the barrier. The second barrier improvement will remove the existing concrete barrier end treatment located eastbound (east of the Riviera Apartments) and replace with 2 new concrete barriers extending west. Maple Valley Highway (SR 169) is a principal arterial carrying 44,000 vehicles per day. This project will improve safety for traffic on Maple Valley Highway (SR 169) at this location, which has been the site to numerous collision impacts. The design report for the Cedar River half bridge is complete and was funded by the Roadway Safety and Guardrail Program (TIP # 4). Final design and construction pending funding availability. 61 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 35 Project Title:Monster Road SW/68th Ave S Roadway Improvements Community Planning Area:Valley Fund: Functional Classification:N/A Project: Project Length:0.92 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 50,000 - - 50,000 - - - - 50,000 - Preliminary Engineering 5,000,000 - - 5,000,000 - - - - - 5,000,000 R-O-W (includes Admin)3,000,000 - - 3,000,000 - - - - - 3,000,000 Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000 Total Sources 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000 - 8,050,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Monster Road SW/68th Ave S Roadway Improvements 317 Vangie Garcia 425-430-7319 Widen existing roadway to four lanes plus two-way-left-turn-lane where needed and bike lanes. Realign Beacon Coal Mine Road approach to intersection with the Monster Road SW roadway. Includes new roadway, curbs, sidewalk, drainage, street lighting, traffic signals, channelization, retaining walls and widening the existing bridge. Will serve growing north-south traffic demand. A preliminary design study was completed in 1999. The project cost is estimated at $32M, with the City's share estimated at $13M and King Co. at $19M. Phase 1 of improvements will address drainage problems between the Monster Rd Bridge and the City limits. Scope, cost and implementation schedule to be determined. Project is pending future grant funding availability. Cost beyond 2024 not shown. 62 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 36 Project Title:NE 3rd Street/NE 4th Street Corridor Improvements Community Planning Area:Highlands & East Plateau Fund: Functional Classification:Principal Project: Project Length:2.2 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 258,420 218,420 - 40,000 20,000 20,000 - - - - Preliminary Engineering 2,276,917 776,917 - 1,500,000 - - 750,000 750,000 - - R-O-W (includes Admin)684,024 84,024 - 600,000 - - - 600,000 - - Construction 10,816,803 2,316,803 - 8,500,000 - - - 2,500,000 4,500,000 1,500,000 Construction Services 3,042,921 322,921 - 2,720,000 - - - 340,000 680,000 1,700,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 17,079,085 3,719,085 - 13,360,000 20,000 20,000 750,000 4,190,000 5,180,000 3,200,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 462,831 422,831 - 40,000 20,000 20,000 - - - - Fund Balance 1,024,433 1,024,433 - - - - - - - - Grants Awarded (TIB)1,495,542 1,495,542 - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation 373,700 373,700 - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (KC WD#90)352,541 352,541 - - - - - - - - Other (Franchise Reimb)50,038 50,038 - - - - - - - - - - - - - - - - - - Undetermined 13,320,000 - - 13,320,000 - 750,000 4,190,000 5,180,000 3,200,000 Total Sources 17,079,085 3,719,085 - 13,360,000 20,000 20,000 750,000 4,190,000 5,180,000 3,200,000 3,759,085 13,320,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program NE 3rd Street/NE 4th Street Corridor Improvements The estimated cost for all corridor improvements (Sunset Blvd N to the east City limits) is $46M. Programmed expenses (2021-2024) are placeholders for future phases. Programmed expenses in 2019-2020 are for developing scope, cost and schedule for next phases. Future phases are pending future grant funding availability. Increased estimated costs from previous TIP for inflation. 317 122176 Keith Woolley 425-430-7318 This project involves a series of improvements in this corridor to improve traffic operations such as rechannelization and traffic signal modifications, possible transit priority signal treatments and queue jumps. This project will seek to meet pedestrian, transit and bicycle needs. Phase 1 constructed a new signal and other improvements at NE 4th St and Whitman Ave NE. This corridor has a strong potential for transit usage and is experiencing rapid residential and retail growth. The NE 3rd/4th Corridor Study was adopted in May 2005. The study refined the corridor transportation needs and costs, including pedestrian, transit, bicycle improvements, as well as streetscape enhancement. 63 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 37 Project Title:Nile Ave NE Bridge Replacement Community Planning Area:East Plateau Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 250,000 - - 250,000 - 50,000 200,000 - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 250,000 - - 250,000 - 50,000 200,000 - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 50,000 - - 50,000 - 50,000 - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 200,000 - - 200,000 - - 200,000 - - - Total Sources 250,000 - - 250,000 - 50,000 200,000 - - - 50,000 200,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Nile Ave NE Bridge Replacement 317 NEW Derek Akesson 425-430-7337 The Nile Ave NE Bridge was built by King County in 1951. Ownership was transferred to the City in 2009 as part of the MacKay Annexation (Ord #5456). It is a single span bridge that crosses over May Creek. The initial phase of this project will evaluate replacement options with a type, size and location (TS&L) study. The bridge is 17 years beyond its original design life of 50 years. It will very likely need to be replaced or significantly retrofitted within the next 10 years. The main span is comprised of precast concrete girders. The girders are supported on treated timber piles with a timber caps. Some of the timber piles are showing signs of deterioration. New project. To date the project has not received grant funding for replacement. However, with a TS&L study, the City will be in a very good position to apply for Federal Highway Administration (FHWA) funding when the bridge condition qualifies for replacement funding. 64 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 38 Project Title:Rainier Ave N Corridor Improvements (Phase 5) Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:0.76 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 100,000 - - 100,000 - - - - 100,000 - Preliminary Engineering 2,000,000 - - 2,000,000 - - - - - 2,000,000 R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000 Total Sources 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000 - 2,100,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Rainier Ave N Corridor Improvements (Phase 5) 317 Vangie Garcia 425-430-7319 This is Phase 5 of the Rainier Ave Corridor Improvements, and will extend the improvements from NW 3rd Pl to north City limits. Project elements include widening of sidewalks with streetscaping, adding pedestrian-scale illumination and planted buffer strips. The street may be narrowed from 5 to 3 lanes where feasible. On the east side of Rainier Ave the new multi-use trail will be installed (Lake Washington Loop Trail), (as shown on TIP #18). Rainier Ave is a critical corridor in Renton with existing operational problems and in need of infrastructure enhancements to provide greater ease for non-motorized and transit- based travel. Funds shown in 2023 are for planning to determine the roadway cross section. Project cost estimated at $31.5M and is unfunded. Costs beyond 2024 not shown. 65 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 39 Project Title:Renton Bus Rapid Transit (BRT) Improvements Community Planning Area:City Center Fund: Functional Classification:TBD Project: Project Length:TBD Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500 Total Expenses 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded(2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500 Total Sources 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500 Renton Bus Rapid Transit (BRT) Improvements - 21,300,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 317 NEW Vangie Garcia 425-430-7319 New transit access road improvements from I-405 exit 3 (Talbot Rd) to South Renton Transit Center. Includes reconfiguration of Grady Way, Lake Ave S and S Renton Village Place to accommodate transit. With current traffic conditions and configurations, improvements will be needed to ensure speed and reliability of the BRT system into and out of the South Renton Transit Center. This transit hub is currently and will remain a key connection point for transit users for both Metro and Sound Transit. Proximity to the Sounder Station and future increase of parking availability also plays a key role in improvement accessibility needs. New Project. Estimated cost in Regional Transportation Plan is $21,300,000. Design and Construction should be implemented and coordinated with South Renton Transit Center, development of Renton Village, and implementation of I-405 Bus Rapid Transit. 66 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 40 Project Title:Transit Master Plan Community Planning Area:Citywide Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 500,000 - - 500,000 - - 300,000 200,000 - - Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction - - - - - - - - - - Construction Services - - - - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 500,000 - - 500,000 - - 300,000 200,000 - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 500,000 - - 500,000 - - 300,000 200,000 - - Total Sources 500,000 - - 500,000 - - 300,000 200,000 - - - 500,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Transit Master Plan 317 NEW Vangie Garcia 425-430-7319 The Transit Master Plan provides the city with a means to influence decisions made by regional transit authorities. It also provides a basis on which to begin advancing proposed capital projects for further study, design and prioritization, and position them to be strong competitors for grant funding. The plan establishes scalable short- and long-term strategies, and identifies projects that will foster a high-quality transit system to meet Renton’s needs. Although the City does not operate its own transit service, the role of transit in Renton is evolving and becoming more of a priority in the region. The current regional vision allows cities and other urban service providers prioritized maximizing the use of existing infrastructure, making more efficient and less costly investments in new infrastructure, and minimizing the environmental impact of urban growth. This prioritization made transportation a key role in the region by creating improved accessibility and mobility for walking, biking, and transit. Regional growth centers are envisioned as major focal points of higher density population and employment, served with efficient multimodal transportation infrastructure and services. Linking these centers with a highly efficient transportation system allows the region to take actions to reduce the rate of growth in vehicle miles traveled, especially by providing and expanding transportation choices. New project. 67 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 41 Project Title:South 3rd Street Conversion Project Community Planning Area:City Center Fund: Functional Classification:Principal Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 4,000,000 - - 4,000,000 - - 4,000,000 - - - R-O-W (includes Admin)- - - - - - - - - - Construction 13,200,000 - - 13,200,000 - - - 5,000,000 8,200,000 - Construction Services 4,000,000 - - 4,000,000 - - - 1,500,000 2,500,000 - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded(2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 - Total Sources 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 - South 3rd Street Conversion Project - 21,200,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 317 Vangie Garcia 425-430-7319 The project provides pedestrian and bicyclists facilities and enhancements, traffic operation and circulation improvements in Downtown. The improvements include adding raised intersections with bulb outs, parklets, pedestrian plaza, lighting, street furniture, streetscape, bicycle blvd, bike racks, signage, wayfinding and converting S 3rd St to two-way operations. This project is one of the strategies identified in the City Center Community Plan. The project enhances downtown Renton as a destination area, while improving circulation, reducing traffic speeds and enhancing pedestrian safety. A feasibility study, including a Downtown Circulation Traffic Analysis for the conversion to two-way operations was completed. This is the last project of the Downtown Conversion to a two-way operations. It will continue the downtown improvements, further enhancing the pedestrian and bicyclists environment. Project is pending future grant funding availability. 68 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 42 Project Title:S/SW 7th Street Corridor Improvements - Naches Ave S to Talbot Road S Community Planning Area:City Center Fund: Functional Classification:Minor Arterial Project: Project Length:1.16 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning 32,270 32,270 - - - - - - - - Preliminary Engineering 2,311,842 311,842 - 2,000,000 - - 200,000 800,000 1,000,000 - R-O-W (includes Admin)1,725,124 25,124 - 1,700,000 - - - 800,000 900,000 Construction 11,362,668 975,141 14,599 10,372,928 - - - - 7,264,000 3,108,928 Construction Services 1,999,882 299,882 - 1,700,000 - - - - 1,200,000 500,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 17,431,786 1,644,259 14,599 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share 52,115 52,115 - - - - - - - - Fund Balance + Reserve 72,164 60,401 11,763 - - - - - - - Grants Awarded (STP)497,241 494,405 2,836 - - - - - - - Grants Awarded (TIB)613,338 613,338 - - - - - - - - Mitigation 424,000 424,000 - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 15,772,928 - - 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928 Total Sources 17,431,786 1,644,259 14,599 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928 1,658,858 15,772,928 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program S/SW 7th Street Corridor Improvements - Naches Ave S to Talbot Road S Added costs for the SW 7th St Sidepath. It is assumed that no ROW would be required. 317 122151 Vangie Garcia 425-430-7319 Widening the existing S 7th St from Talbot Road S to Rainier Ave S roadway to 3 lanes (2 lanes EB and 1 lane WB) and a separated multi-use trail. Includes new curb, gutter, wider sidewalks, street lighting, landscaping, channelization and upgrades to traffic signals. The S 7th St Project - Traffic Analysis Report provided alternatives for corridor improvement options. This project also includes a sidepath on SW 7th St between Rainier Ave S and Naches Ave S. The segment of the S 7th St corridor connects Talbot Rd S (SR 515) with Rainier Ave S (SR 167). The segment of S 7th St is part of a designated east-west ped/bike route through the City's commercial core and an important link between regional trails. The South Renton Neighborhood Study has identified South 7th St as needing streetscape improvements. The Trails and Bicycle Master Plan Update identified SW 7th St/S 7th St as a good alternate/parallel route as the L2S Trail (TIP #30) is developed. With the expansion of the South Renton Transit Center and Bus Rapid Transit (BRT) implementation, S 7th St is important non-motorized link to downtown core. Costs incurred are for Phase 1, which added a traffic signal and an eastbound right-turn lane at the intersection of S 7th St and Shattuck Ave S. Project is pending future grant funding availability. 69 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 43 Project Title:South Grady Way - Talbot Rd South to Rainier Ave South Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 750,000 - - 750,000 - - 550,000 200,000 - - R-O-W (includes Admin)- - - - - - - - - - Construction 2,500,000 - - 2,500,000 - - - 1,200,000 1,300,000 - Construction Services 750,000 - - 750,000 - - - 360,000 390,000 - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 - Total Sources 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 - - 4,000,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program South Grady Way - Talbot Rd South to Rainier Ave South 317 Vangie Garcia 425-430-7319 This project will perform a comprehensive analysis of multi-modal transportation improvements, including review of potential transit improvements along Grady Way, such as Business Access and Transit (BAT) lanes and Traffic Signal Priority (TSP). The project will remove the islands at the intersections of S Grady Way with Lake Ave S and Shattuck Ave S, to allow for a continuous eastbound lane from Rainier Ave S to Talbot Rd S. Included are modifications to the traffic signal, new pedestrian crossings and channelization. The improvements will add much needed capacity to the S Grady Way corridor. Project is pending future grant funding availability. 70 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 44 Project Title:South Lake Washington Transit Stop Community Planning Area:City Center Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 600,000 - - 600,000 - - 600,000 - - - R-O-W (includes Admin)- - - - - - - - - - Construction 3,000,000 - - 3,000,000 - - 3,000,000 - - - Construction Services 750,000 - - 750,000 - - 750,000 - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 4,350,000 - - 4,350,000 - - 4,350,000 - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (1)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 4,350,000 - - 4,350,000 - - 4,350,000 - - - Total Sources 4,350,000 - - 4,350,000 - - 4,350,000 - - - - 4,350,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program South Lake Washington Transit Stop 317 Vangie Garcia 425-430-7319 This project will implement a Bus Transit Station at Park Ave. N and Garden Ave N. The project includes a new transit stop, with passenger amenities such as shelters, lighting, benches, litter receptacles, bicycle racks and lockers. The project is proposed to meet recent travel demand growth in the area and as a part of the connectivity of the regional transit system. This transit hub will provide service to a 17.5 acre mixed use site consisting of 730,000 sq.ft. of office space, 43,000 sq.ft. of meeting space, 30,000 sq.ft. of retail, 383 apartment units and a 347 unit hotel. Other new development in the area includes two hotels. In addition, a large manufacturing company's employees will benefit from the transit hub's location as well as visitors to The Landing and the 57 acre Gene Coulon Park. The preliminary planning for this transit project will be incorporated into the N Park Ave Extension Project (TIP #20). 71 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 45 Project Title:Sunset Area Green Connections Community Planning Area:Highlands Fund: Functional Classification:N/A Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 2,600,000 - - 2,600,000 - - - 2,600,000 - - R-O-W (includes Admin)1,000,000 - - 1,000,000 - - - 1,000,000 - - Construction 16,000,000 - - 16,000,000 - - - - 9,200,000 6,800,000 Construction Services 2,600,000 - - 2,600,000 - - - - 1,500,000 1,100,000 Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000 Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (CED)- - - - - - - - - - Other (2)- - - - - - - - - - - - - - - - - - - - Undetermined 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000 Total Sources 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000 - 22,200,000 Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program Sunset Area Green Connections 317 Vangie Garcia 425-430-7319 This project will construct multi-modal improvements identified in the Sunset Area Community Planned Action Study. Roadways will be widened/extended/realigned to provide for future traffic flows. Several residential streets will be developed as "green connections" improving pedestrian mobility and enhance the neighborhood. Roadways included are NE 10th St, NE Sunset Lane, Harrington Ave NE, NE 12th St, Edmonds Ave NE, Jefferson Ave NE, Kirkland Ave NE and Glennwood Ave NE. Improvements to these streets are key to support the redevelopment of the Sunset Area Community in the Highlands area, bounded by NE 21st St on the north, Edmonds Ave NE on the west, NE 7th St on the south, and Monroe Ave NE on the east. The City in partnership with the Renton Housing Authority aspires to redevelop the Sunset Terrace public housing community and encourage private delopment in the Planned Action Study area over a 20-year period. The total cost of the project is estimated at $22.2M. Schedule, cost and selection of streets to be improved to be determined. Significant cost participation will be required from development. Surface Water is leading this project and has completed two projects along Harrington Ave NE. 72 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 46 Project Title:SW 27th Street/Strander Boulevard Connection Community Planning Area:Valley Fund: Functional Classification:Minor Arterial Project: Project Length:1.27 mi Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering 5,030,912 5,030,912 - - - - - - - - R-O-W (includes Admin)3,842,563 3,842,563 - - - - - - - - Construction 16,798,111 16,748,111 50,000 - - - - - - - Construction Services 2,435,829 2,435,829 - - - - - - - - Post Construction Services 3,009,442 3,009,442 - - - - - - - - Other - - - - - - - - - - Total Expenses 31,116,857 31,066,857 50,000 - - - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Interfund Loan 700,000 700,000 - - - - - - - - Gen & Prop Fund Balances 2,638,698 2,588,698 50,000 - - - - - - - Grants Awarded (State & Fed 2,408,422 2,408,422 - - - - - - - - Grants Awarded (FMSIB)7,697,425 7,697,425 - - - - - - - - Mitigation 1,413,835 1,413,835 - - - - - - - - Bonds / LID's Formed 2,799,500 2,799,500 - - - - - - - - Other (Sound Transit & FRB)4,687,421 4,687,421 - - - - - - - - Other (STP & TIB)7,346,536 7,346,536 - - - - - - - - City of Tukwila Reimburse 1,000,000 1,000,000 - - - - - - - - - - - - - - - - - - PW Utilities (Water/Surf Wat)425,020 425,020 - - - - - - - - Undetermined - - - - - - - - - - Total Sources 31,116,857 31,066,857 50,000 - - - - - - - SW 27th Street/Strander Boulevard Connection 29,691,837 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program The City of Tukwila has taken the lead for future phases. 317 122239, 122240 Keith Woolley 425-430-7318 The project will provide a grade-separated crossing at the Union Pacific Railroad (UPRR) and Burlington Northern Santa Fe (BNSF) railroad tracks. Bicycle and pedestrian connections will be provided to the Tukwila Station and the Interurban Trail. Phase 1 - Seg 2a - 2 lane roadway from Naches Ave SW to the Sounder Station, including a BNSF bridge is completed. This project provides a critical four/five-lane arterial that will serve as a connector to West Valley Highway (SR 181) and East Valley Road, as well as an arterial connector to SR 167 from the south. A new east-west arterial roadway will connect the cities of Renton and Tukwila and provide significant congestion relief to existing arterials. The new road will provide access to the Tukwila Train/Sound Transit Station. The new grade separated arterial (UPRR and BNSF railroads) will provide significant benefits to both freight mobility and general motorists. 73 AGENDA ITEM # 10. a) TRANSPORTATION IMPROVEMENT PROGRAM 2019 - 2024 TIP No. 47 Project Title:Talbot Road S / S 177th Street Signalization & Roadway Improvements Community Planning Area:Talbot Fund: Functional Classification:Major Collector Project: Project Length:N/A Contact: Project Description: Justification: Status: Changes: Funded:Unfunded: Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024 Expenditures: Planning - - - - - - - - - - Preliminary Engineering - - - - - - - - - - R-O-W (includes Admin)- - - - - - - - - - Construction 1,000,000 - 1,000,000 - - - - - - - Construction Services 25,000 - 25,000 - - - - - - - Post Construction Services - - - - - - - - - - Other - - - - - - - - - - Total Expenses 1,025,000 - 1,025,000 - - - - - - - Resources: Vehicle Fuel Tax - - - - - - - - - - Business & Occupation Share - - - - - - - - - - Fund Balance - - - - - - - - - - Grants Awarded (1)- - - - - - - - - - Grants Awarded (2)- - - - - - - - - - Mitigation - - - - - - - - - - Bonds / LID's Formed - - - - - - - - - - Other (Dev. Expenditure)1,025,000 - 1,025,000 - - - - - - - Other (Dev. Reimb)- - - - - - - - - - - - - - - - - - - - Undetermined - - - - - - - - - - Total Sources 1,025,000 - 1,025,000 - - - - - - - Talbot Road S / S 177th Street Signalization & Roadway Improvements 1,025,000 - Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program 317 Vangie Garcia 425-430-7319 This project involves installing a traffic signal and various roadway improvements including meeting pedestrian transit and bicycle needs. This project is proposed to meet recent traffic demand through this intersection and surrounding area as a result of the expansion of Valley Medical Center. The project is currently in design and will be starting construction in 2018 once they receive an approved permit. 74 AGENDA ITEM # 10. a) Section F Appendix 2019 – 2024 Transportation Improvement Program 75 AGENDA ITEM # 10. a) City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM 25 Abbreviations and Acronyms The following list defines the abbreviated words and/or acronyms used in the City of Renton’s Six -Year Transportatfon Improvement Program. ACP Asphalt Concrete Pavement ADA American Disability Act BAT Business Access Transit BNSF Burlington Northern Santa Fe BRAC Bridge Replacement Advisory Committee CBD Central Business District CIP Capital Improvement Program CMAQ Congestfon Mitfgatfon and Air Quality CTR Commute Trip Reductfon (State Act) DOE Department of Ecology EB Eastbound ECL East City Limits EIS Environmental Impact Study ER Emergency Relief FHWA Federal Highway Administratfon FMSIB Freight Mobility Strategic Investment Board GIS Geographic Informatfon System GMA Growth Management Act HOV High Occupancy Vehicles ITS Intelligent Transportatfon System LF Linear Feet LID Local Improvement District LOS Level of Service MAP-21 Moving Ahead for Progress in the 21st Century Act METRO Municipality of Metropolitan Seattle MOU Memorandum of Understanding MUTCD Manual on Uniform Traffic Control Devices NCL North City Limits NB Northbound PMS Pavement Management System Precon Preconstructfon Engineering/Administratfon (design phase of project) PS&E Plans, Specificatfons, and Estfmates ROW Right-of-way RTA Regional Transit Authority SB Southbound SCATBd South County Area Transportatfon Board SCL South City Limits SOV Single Occupant Vehicle ST Sound Transit STP Surface Transportatfon Program TDM Transportatfon Demand Management Program TIB Transportatfon Improvement Board TIP Transportatfon Improvement Plan UPRR Union Pacific Railroad UPS Uninterruptfble Power Supple WB Westbound WCL West City Limits WSBIS Washington State Bridge Inventory System WSDOT Washington State Department of Transportatfon 76 AGENDA ITEM # 10. a) 1  CITY OF RENTON, WASHINGTON    RESOLUTION NO. ______      A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING  THE TEMPORARY TOTAL CLOSURE OF THE INTERSECTION OF EAST  VALLEY ROAD AND SW 19TH STREET, BETWEEN 1701 EAST VALLEY ROAD  AND 2501 EAST VALLEY ROAD TO THE NORTH AND SOUTH, AND 200 SW  19TH STREET AND 204 SW 19TH STREET TO THE EAST AND WEST.      WHEREAS, the Washington State Department of Transportation (“WSDOT”) plans  to install a culvert that conveys Rolling Hills Creek under East Valley Road, at the  approximate address of 1801 East Valley Road; and  WHEREAS, this construction activity will require temporary street closure along  East Valley Road, between 1701 East Valley Road to 2501 East Valley Road, as well as SW  19th Street between 200 SW 19th Street and 204 SW 19th Street; and  WHEREAS, pursuant to City Code section 9‐9‐3 the City Council is to authorize such  closures by means of a resolution;  WHEREAS, the City wishes to provide full and adequate notice to the public of the  extent and nature of such closure;   NOW, THEREFORE, THE CITY OF RENTON, WASHINGTON, DO RESOLVE AS  FOLLOWS:  SECTION I.  The City Council does hereby authorize the temporary total closure  of the intersection of East Valley Road and SW 19th Street, between 1701 East Valley Road  and 2501 East Valley Road to the north and south, and 200 SW 19th Street and 204 SW 19th  AGENDA ITEM # 10. b) RESOLUTION NO. ________      2  Street to the east and west, for up to four calendar days, anytime during the period of  August 24, 2018 to August 27, 2018, to allow WSDOT to install the culvert.  PASSED BY THE CITY COUNCIL this _______ day of _________________, 2018.       __________________________________   Jason A. Seth, City Clerk           APPROVED BY THE MAYOR this _______ day of _________________, 2018.       __________________________________   Denis Law, Mayor           Approved as to form:      __________________________________  Shane Moloney, City Attorney    Date of Publication: ____________    RES:1780:7/26/18:scr    AGENDA ITEM # 10. b) 1  CITY OF RENTON, WASHINGTON    RESOLUTION NO. ______      A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING  THE TEMPORARY TOTAL CLOSURE OF SW 19TH STREET BETWEEN 100 SW  19TH STREET AND 204 SW 19TH STREET.      WHEREAS, the Washington State Department of Transportation (“WSDOT”) plans  to install a new 120” saddle manhole that connects Rolling Hills Creek to the existing  conveyance system; and  WHEREAS, this construction activity will require temporary total street closure  along SW 19th Street, between 100 SW 19th Street and 204 SW 19th Street; and  WHEREAS, pursuant to City Code section 9‐9‐3 the City Council is to authorize such  closures by means of a resolution;  WHEREAS, the City wishes to provide full and adequate notice to the public of the  extent and nature of such closure;   NOW, THEREFORE, THE CITY OF RENTON, WASHINGTON, DO RESOLVE AS  FOLLOWS:  SECTION I.  The City Council does hereby authorize the temporary total closure  of SW 19th Street, between 100 SW 19th Street and 204 SW 19th Street, for up to 10      AGENDA ITEM # 10. c)   RESOLUTION NO. ________      2    calendar days, anytime during the periods of September 4, 2018 to September 30, 2018, to  allow WSDOT to install a new 120” saddle manhole.  PASSED BY THE CITY COUNCIL this _______ day of _________________, 2018.       __________________________________   Jason A. Seth, City Clerk           APPROVED BY THE MAYOR this _______ day of _________________, 2018.       __________________________________   Denis Law, Mayor           Approved as to form:      __________________________________  Shane Moloney, City Attorney    Date of Publication: ____________    RES:1781:8/3/18:scr    AGENDA ITEM # 10. c) 1  CITY OF RENTON, WASHINGTON    ORDINANCE NO. ________    AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, REPEALING AND  REPLACING CHAPTER 6‐3 OF THE RENTON MUNICIPAL CODE, AMENDING ALARM  SYSTEM REGULATIONS, AND PROVIDING FOR SEVERABILITY AND ESTABLISHING  AN EFFECTIVE DATE.     WHEREAS, excessive false alarms unduly burden the City of Renton Police Department’s  limited law enforcement resources; and  WHEREAS, the purpose of this ordinance is to establish reasonable expectations of alarm  users, and alarm companies, and to ensure that alarm users are held responsible for their use of  alarm systems; and  WHEREAS, the Council deems it necessary to replace the current RMC Chapter 6‐3  (Burglar Alarms) relating to false alarm regulations; and  WHEREAS, the Council has determined that it would be beneficial to delegate the  enforcement responsibilities for excessive false alarms;  NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO  ORDAIN AS FOLLOWS:  SECTION I. Chapter 6‐3 of the Renton Municipal Code is repealed in its entirety and  replaced with the following language:  CHAPTER 3  ALARM SYSTEM REGULATIONS  SECTION:  6‐3‐1:    Purpose  6‐3‐2:    Definitions  6‐3‐3:    Authority; Funds  6‐3‐4:    Alarm Permit Required  6‐3‐5:    Duties Of An Alarm User  6‐3‐6:    Duties Of An Alarm Company  AGENDA ITEM # 10. a) ORDINANCE NO. ________  2  6‐3‐7:    Violations  6‐3‐8:    Suspension Of Response  6‐3‐9:    Reinstatement Of Response  6‐3‐10:  Appeals Process    6‐3‐1 PURPOSE:  It is the intent of this chapter to reduce the number of false alarms occurring  within the City and to minimize the resulting waste of City resources by providing  for corrective administrative action to hold alarm users and alarm companies  responsible for proper use of alarm systems.  6‐3‐2 DEFINITIONS:  The following words, terms and phrases, when used in this chapter, shall have the  meanings ascribed to them, except where the context clearly indicates a different  meaning:   A. Alarm Administrator: Person or persons designated by the City to  administer the provisions of this chapter.  B. Alarm Company: Person or company, firm, and/or a company engaged in  the selling, leasing, installing, servicing or monitoring alarm systems.  C. Alarm Dispatch Request: A notification to a law enforcement agency that  an alarm, either manual or automatic, has been activated at a particular alarm  site, which results in a request for law enforcement action.  D. Alarm Permit: A permit issued to an alarm user allowing the operation of  an alarm system within the City.   E. Alarm Signal: A detectable signal, audible or visual, generated by an alarm  system, which is intended to elicit a response from the City.   AGENDA ITEM # 10. a) ORDINANCE NO. ________  3  F. Alarm System: Any single device or assembly of equipment designed to  signal the occurrence of an illegal or unauthorized entry, or other illegal activity  requiring immediate attention, and to which law enforcement is requested to  respond by an alarm company, but does not include motor vehicle or boat alarms,  fire alarms, or alarms designated to elicit a medical response.   G. Alarm User: Any person, corporation, partnership, proprietorship,  government, or educational entity or any other entity owning, leasing, or  operating an alarm system, or on whose premises an alarm system is maintained  for the protection of such premises.   H. Alarm User Awareness Class: A class conducted for the purpose of  educating alarm users about the responsible use, operation, and maintenance of  alarm systems and the problems created by false alarms.  I. Automatic Dial Protection Device: An automatic dialing device or an  automatic telephone dialing alarm system that includes any system which, upon  being activated, automatically initiates to the Renton Police Department a  recorded message or code signal indicating a need for law enforcement response.   J. Cancellation: The process by which an alarm dispatch request response is  terminated when the alarm company (designated by the alarm user) notifies the  Renton Police Department that there is not an existing situation at the alarm site  requiring police response.  If cancellation occurs prior to police arriving at the  scene, no fine will be assessed.  K. City: The City of Renton, Washington, or its designee.   AGENDA ITEM # 10. a) ORDINANCE NO. ________  4  L. False Alarm:  1. A false alarm  includes the following:  a. The activation of an alarm system through mechanical or electronic  failure; malfunction; improper installation; negligence of alarm user, his/her  employees or agents that either directly or through a third party/object summons  law enforcement personnel; and  b. Upon inspection by the Renton Police Department, evidence  indicates that no unauthorized entry, burglary, or other such crime was  committed or attempted in or on the premises which would have activated a  properly functioning alarm system.  2. A false alarm shall not include:  a. An alarm which can reasonably be determined to have been caused  by conditions of nature;   b. Other extraordinary circumstances not reasonably subject to  control by the alarm user;   c. An alarm in which an alarm dispatch request response from the City  is cancelled by the user’s alarm company before the City arrives at the alarm  location; or  d. Intentional activation of the alarm system because of the  reasonable, but mistaken, belief that a crime is being or about to be committed.   M. Permit Year: A twelve (12)‐month period beginning on January 1st of each  year which the alarm permit is issued.    AGENDA ITEM # 10. a) ORDINANCE NO. ________  5  N. Runaway Alarm: An alarm system that produces repeated alarm signals  that do not appear to be caused by separate human action or that produces three  (3) separate false alarm signals within a twenty‐four (24) hour period.   O. Verify: An attempt by the monitoring company, through telephone  verification, or its representative, to determine whether an alarm signal is valid  before requesting law enforcement dispatch, in an attempt to avoid an  unnecessary alarm dispatch request. Telephone verification means, at a  minimum, that a second call be made to a different number if the first attempt  fails to reach an alarm user who can properly identity themselves to determine  whether an alarm signal is valid before requesting law enforcement dispatch.   P.  Violator: Any alarm user that violates any provisions under this chapter  including but not limited to any alarm user upon whose property a false alarm  occurs.   6‐3‐3 AUTHORITY; FUNDS:  A. Responsibility for administration of this chapter is vested with the Chief of  Police.  B. The Chief of Police shall designate an alarm administrator to carry out the  administrative duties and functions described in this chapter.  C. The Chief of Police has the authority to review and recommend to the City  Council false alarm fees set forth in the City of Renton Fee Schedule.   D. The Chief of Police has the authority to delegate the City’s rights and  responsibilities delineated by this chapter to a third party.  AGENDA ITEM # 10. a) ORDINANCE NO. ________  6  6‐3‐4 ALARM PERMIT REQUIRED:  No person shall own, lease or operate an alarm system without first obtaining a  permit for such alarm system from the City.  A separate alarm permit is required  for each alarm site.  A fee is required for the initial alarm registration.  No fee will  be charged for annual renewals. Each alarm permit shall be assigned a unique  permit number, and the alarm user or alarm company may be required to provide  the permit number to facilitate law enforcement dispatch and enforcement of this  chapter. Each alarm permit shall expire on December 31 of the year issued and  must be renewed annually by submitting an updated application to the City.  A  late fee will be assessed if the renewal is more than thirty (30) days late. An alarm  permit cannot be transferred to another person or alarm site.    A. Application: Each alarm user has a duty to obtain an application from the  City and apply for each permit on a form provided by the City.  B. Transfer of Possession: When the occupancy or possession of the  premises at which an alarm system is maintained is transferred, the alarm user  obtaining possession of the property shall file an application for an alarm permit  within thirty (30) days of obtaining possession of the property. Alarm permits are  not transferable.  C. Reporting Updated Information: Whenever any information provided on  the alarm permit application changes, the alarm user shall provide correct  information to the City within thirty (30) days of the change.  AGENDA ITEM # 10. a) ORDINANCE NO. ________  7  D. Multiple Alarm Systems: If an alarm user has one (1) or more alarm  systems protecting two (2) or more separate structures having different addresses  and/or tenants, a separate permit shall be required for each structure and/or  tenant.  E. Failure to Register, Renew, or Update Information: Failure to initially  obtain or renew a permit under this chapter or report any updated information  within thirty (30) days of change shall result in a fine as set forth in the City of  Renton Fee Schedule.  F. Unpermitted Alarm Signal: If an alarm signal is originated from the  property of an alarm user who does not possess a current permit and such signal  results in an alarm dispatch request, the alarm user shall pay a fine for failure to  register as described in RMC 6‐3‐4.E, in addition to any other applicable fines and  fees.  6‐3‐5 DUTIES OF AN ALARM USER:  A. Comply with all applicable provisions of this chapter;  B. Maintain the premises and the alarm system in a manner that will reduce  or eliminate false alarms;  C. Provide the permit number to the alarm company to facilitate dispatch;  D. Refrain from manually activating an alarm for any reason other than the  occurrence of an event that the alarm system was intended to report. An alarm  user must not manually initiate a False Alarm;  E. Obtain an alarm permit for each alarm system;  AGENDA ITEM # 10. a) ORDINANCE NO. ________  8  F.  Renew permit(s) annually;  G. Update the City with any changes to information contained on an alarm  permit application within thirty (30) days of the change.  H. Failure of alarm user to comply with the duties of this chapter may result  in a fine as set forth in the City of Renton Fee Schedule.  6‐3‐6 DUTIES OF AN ALARM COMPANY:  A. Any person engaged in the alarm business in the City shall comply with the  following:  1. Obtain and maintain the required state, county and/or city license(s).  2. Provide the City most current name, address, and telephone number  and other available information of the alarm user or a designee, who can be called  in an emergency, twenty‐four (24) hours a day, and contact a key holder or other  emergency contact who will be requested to respond immediately if necessary.  B. Ninety (90) days after enactment of this chapter, each alarm company  shall, on all new and upgraded installations, use only alarm control panels which  meet current industry standards.  C. Prior to activation of the alarm system, the alarm company must provide  to each alarm user:  1. Instructions explaining the proper operation of the alarm system; and  2. Written information of how to obtain service from the alarm company  for the alarm system.  D. Any alarm company doing business within the City of Renton shall:  AGENDA ITEM # 10. a) ORDINANCE NO. ________  9  1. Attempt to verify, by calling the alarm site and/or alarm user by  telephone, to determine whether an alarm signal is valid before requesting  dispatch. Telephone verification shall require, at a minimum, that a second call be  made to a different number, if the first attempt fails to reach an alarm user who  can properly identify themselves to attempt to determine whether an alarm signal  is valid, except in the case of a panic, silent, duress or burglary and/or robbery‐in‐ progress alarm, or in cases where a crime‐in‐progress has been verified by video  and/or audible means.  2. Provide each address and alarm permit number to the communications  center to facilitate dispatch and/or cancellations.  3. Communicate any available information about the location of the  alarm.  4. Communicate a cancellation to the law enforcement communications  center as soon as possible following a determination that a response is  unnecessary.  E. Failure of an alarm company to comply with the duties under this chapter  may result in a fine as set forth in the City of Renton Fee Schedule.  6‐3‐7 VIOLATIONS:  A. It shall be a violation of this chapter:  1. For a false alarm to occur on an alarm user’s property;  2. To install, maintain, or use an audible alarm system which sounds  continually for more than fifteen (15) minutes;  AGENDA ITEM # 10. a) ORDINANCE NO. ________  10  3. To install, maintain, or use an automatic dial protection device that  reports, or causes to be reported, any recorded message to the Renton Police  Department;  4. To fail to obtain a permit for an alarm system;   5. To fail to provide updated information to the City as described in this  chapter; or  6. To fail to comply with any other requirement of this chapter.  B. The alarm user will be responsible for violations under this chapter  whether or not the alarm user individually caused the violation to occur.  C. It shall be a violation of this chapter for an alarm company to violate any  requirements of this chapter.   D. Any violation of this chapter shall result in a fine, as determined by the City  of Renton Fee Schedule.  6‐3‐8 SUSPENSION OF RESPONSE:  A. The City may discontinue response of City emergency services if the City  determines that:  1. There is a false statement or omission of material fact made to the City  or contained in a permit application.  2. An alarm system meets the definition of a runaway alarm.  3. An alarm system has generated in excess of eight (8) false alarms  during any calendar year.  AGENDA ITEM # 10. a) ORDINANCE NO. ________  11  4. The alarm user has failed to make payment of any fine or fee assessed  under this chapter within ninety (90) days of the assessment.  5. An alarm user commits any other violation of this chapter.  6‐3‐9 REINSTATEMENT OF RESPONSE:  A. The City may resume City emergency services response upon the alarm  user submitting satisfactory proof of compliance of one (1) or more of the  following:  1. Proof that the alarm system has been inspected and the measures  taken to ensure the alarm system is in good working order. Measures taken may  require the alarm user to repair, upgrade or modify the alarm system to be  compliant with this chapter.  2. Proof the alarm user has been retrained on the use of the alarm system  and procedures for contacting the alarm company in the case of false activation.  3. The alarm user successfully completes an online alarm user awareness  class and test.  4. All fees and fines are paid in full including a reinstatement fee as set  forth in the City of Renton Fee Schedule.  6‐3‐10 APPEALS PROCESS:  A. If the City assesses a fine, suspends, denies the issuance, renewal or  reinstatement of the alarm permit, the City or its designee shall send written  notice of the action and a statement of the right to an appeal to the aggrieved  party.   AGENDA ITEM # 10. a) ORDINANCE NO. ________  12  B. Any party fined in accordance with this chapter may appeal an assessment  of a fine, a suspension of an alarm permit, or other enforcement action to the City  by mailing the appeal to the address as shown on the notice within fifteen (15)  days after receipt of the notice. The appeal must set forth in writing the reasons  for the appeal and any evidence that should be considered. The failure to give  notice of appeal within fifteen (15) days shall constitute a waiver of the right to  contest the violation(s) or enforcement action(s).  C. If a hearing is requested, written notice of the time, place, and manner of  the hearing shall be mailed to the address of the alarm user as contained in the  alarm permit, at least fifteen (15) days prior to the date of the hearing, which shall  be held no more than thirty (30) days after the request for hearing is filed.  D. The appeal shall be administered by the Chief of Police or his/her designee  (Hearing Officer). The alarm user and a representative of the Police Department  shall have the right to present written and/or oral evidence. If the Hearing Officer  determines, after the presentation of evidence, that any violations have occurred,  the Hearing Officer shall issue written findings and record the findings in the alarm  user’s record within thirty (30) days, and the fines shall be paid, including an  additional appeal fee. If the Hearing Officer determines that no violation has been  committed, the appeal fee and associated fine, if already paid, shall be refunded  within thirty (30) days, and no finding of violation may be entered on the alarm  user’s record.  AGENDA ITEM # 10. a) ORDINANCE NO. ________  13  E. The appeal decision made by the Hearing Officer may be appealed to the  King County Superior Court within thirty (30) calendar days from the date the  decision is issued.   SECTION II. If any section, subsection, sentence, clause, phrase or work of this  ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction,  such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other  section, subsection, sentence, clause, phrase or word of this ordinance.  SECTION III. This ordinance shall be in full force and effect thirty (30) days after  publication of a summary of this ordinance in the City’s official newspaper.  The summary shall  consist of this ordinance’s title.      PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2018.                         Jason A. Seth, City Clerk    APPROVED BY THE MAYOR this _______ day of _____________________, 2018.                         Denis Law, Mayor    Approved as to form:             Shane Moloney, City Attorney  Date of Publication:      ORD:2006:6/20/18:scr  AGENDA ITEM # 10. a)