HomeMy WebLinkAboutFinal Agenda Packet
AGENDA
City Council Regular Meeting
7:00 PM - Monday, August 20, 2018
Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way
1. CALL TO ORDER AND PLEDGE OF ALLEGIANCE
2. ROLL CALL
3. PROCLAMATION
a) Ready in Renton - September 2018
4. PUBLIC HEARING
a) 2019 - 2024 Transportation Improvement Program
5. APPEAL
a) Planning & Development Committee Report: Wilson Park 1
INABILITY OF THE CITY COUNCIL TO TAKE TESTIMONY ON APPEALS DURING COUNCIL
MEETINGS
State law requires that the City establish a process to handle appeals from application
of environmental and developmental rules and regulations. The Renton City Council,
feeling it was best for the elected representatives to handle the appeals rather than
require citizens to go to court, has retained appellate jurisdiction to itself.
The courts have held that the City Council, while sitting as an appellate body, is acting
as a quasi-judicial body and must obey the rules of procedure of a court more than
that of a political body.
By City Code, and by State law, the City Council may not consider new evidence in this
appeal. The parties to the appeal have had an opportunity to address their arguments
to the Planning & Development Committee of the City Council at a meeting previously
held. Because of the court requirements prohibiting the City Council from considering
new evidence, and because all parties have had an opportunity to address their
concerns to the Planning & Development Committee, the City Council may not
consider oral or written testimony at the City Council meeting. The Council
understands that this is frustrating to citizens and is outside the normal process of
open discourse provided to citizenry during the audience comment portion of the City
Council meeting. However, this burden of not allowing Council to be addressed
concerning pending appeals is outweighed by the quick, inexpensive and local appeal
process provided by the Renton City Council.
6. ADMINISTRATIVE REPORT
7. AUDIENCE COMMENTS
• Speakers must sign-up prior to the Council meeting.
• Each speaker is allowed five minutes.
• When recognized, please state your name & city of residence for the record.
NOTICE to all participants: Pursuant to state law, RCW 42.17A.555, campaigning for any
ballot measure or candidate in City Hall and/or during any portion of the council meeting,
including the audience comment portion of the meeting, is PROHIBITED.
8. CONSENT AGENDA
The following items are distributed to Councilmembers in advance for study and review, and
the recommended actions will be accepted in a single motion. Any item may be removed for
further discussion if requested by a Councilmember.
a) Approval of Council Meeting minutes of August 13, 2018.
Council Concur
b) AB - 2198 City Clerk submits a 60% Direct Petition to Annex for the proposed Parker
Annexation, and recommends a public hearing to consider the petition be set for
September 10, 2018; 14.5 acres located at the southeastern portion of City limits,
bordered by City limits at the west, the urban growth boundary at the west and south,
and by SE 124th St. at the south.
Council Concur; Set Public Hearing on 09/10/2018.
c) AB - 2200 Executive Department recommends approval of a three-year contract with
Diamond Marketing Solutions, Inc., with an annual cost of $98,551.20, for postal metering
and delivery services.
Refer to Finance Committee
d) AB - 2203 Executive Department recommends approval of an agreement with the Renton
Regional Fire Authority outlining the responsibilities and requirements with regards to
the development of Fire Station #15.
Council Concur
e) AB - 2201 Public Works Administration recommends ratifying the Second Addendum to
the Indemnification Agreement, CAG-18-150, with The Boeing Company.
Council Concur
f) AB - 2196 Utility Systems Division recommends approval of an agreement with Northwest
Hydraulic Consultants, Inc., in the amount of $132,377, for the Annual Cedar River
Sediment Survey and Analysis project.
Refer to Utilities Committee
g) AB - 2197 Utility Systems Division recommends approval of the Water Quality Grant
Agreement WQC-2017-Renton-00002, with the Department of Ecology, to accept $93,000
in grant funds for the Heather Down Detention Pond Water Quality Retrofit project. A
$31,000 city match is required.
Refer to Utilities Committee
9. UNFINISHED BUSINESS
Topics listed below were discussed in Council committees during the past week. Those topics
marked with an asterisk (*) may include legislation. Committee reports on any topics may be
held by the Chair if further review is necessary.
a) Transportation Committee: Temporary Total Closure of Intersection E. Valley Rd*;
Temporary Total Closure of SW 19th St*; 2019 - 2024 Transportation Improvement
Program*
10. LEGISLATION
Resolutions:
a) Resolution No. 4351: 2019 - 2024 Transportation Improvement Program (See item 9.a.)
b) Resolution No. 4352: Temporary Total Closure of the Intersection of East Valley Road and
SW 19th Street (See item 9.a)
c) Resolution No. 4353: Temporary Total Closure of SW 19th Street (See item 9.a)
Ordinance for second and final reading:
a) Ordinance No. 5886: Alarm System Regulation (First Reading 8/13/2018)
11. NEW BUSINESS
(Includes Council Committee agenda topics; visit rentonwa.gov/cityclerk for more
information.)
12. ADJOURNMENT
COMMITTEE OF THE WHOLE MEETING AGENDA
(Preceding Council Meeting)
6:00 p.m. - 7th Floor - Council Chambers
Hearing assistance devices for use in the Council Chambers are available upon request to the City Clerk
CITY COUNCIL MEETINGS ARE TELEVISED LIVE ON GOVERNMENT ACCESS CHANNEL 21
To view Council Meetings online, please visit rentonwa.gov/councilmeetings
DenisLawMayorProctamationWftereas,SeptemberhasbeendesignatedbythePresidentoftheUnitedStatesofAmericaas“NationalPreparednessMonth”andcoincideswiththeCityofRenton’s“ReadyinRenton”emergencypreparednesscampaign;and(4%iereas,Rentonhasexperiencednaturalandhuman-causeddisastersinthepast,andscientificevidenceindicatesthecityandtheregionremainvulnerabletodisastersinthefuture;andWfiereas,investinginthepreparednessofourselves,ourfamilies,ourbusinesses,andourneighborhoodscanreduceinjuries,fatalities,andeconomicdevastationfromdisasters;andW’tzereas,thebasicstepsofemergencypreparednessarethesameforeveryone:makeaplan,buildakit,andhelponeanothertobecomeself-sufficientforuptotwoweeks;andWfiereas,becausestayinginformedisavitalpartofrespondingappropriatelytoemergencies,allmembersoftheRentoncommunityareencouragedtolocateandbookmarktheirsourcesofemergencyinformationinadvanceatrentonwa.gov,tosignupforALERTRenton,andtofollowthecity’ssocialmediaaccountsonFacebook,Twitter,andNextDoor;andWñereas,thereisgreatlanguagediversitywithinthecommunity,andRentonresidentsandbusinessesareencouragedtosharewiththeirneighborsthetranslatedinformationatbit.ly/PreparednessPublications,andtorelayanyemergencymessagestohelptheirneighborsunderstandandtakeappropriatelife-savingactions;andWfiereas,“ReadyinRenton”createsanimportantopportunityforeverymemberoftheRentoncommunitytopreparetheirhomes,businesses,andneighborhoodsforanytypeofemergency;Wow,tfierefore,I,DenisLaw,MayoroftheCityofRenton,doherebyproclaimthemonthofSeptember2018tobe?cad5in?entonWtonthintheCityofRentonandencourageallRentonresidentstoformulateapreparednessplan.Inwitnesswhereof,IhavehereuntosetmyhandandcausedthesealoftheCityofRentontobeaffixedthis20thdayofAugust,2018.DenisLaw,MayorCityofRenton,WashingtonRentonCityHaIl,7thFloor1055SouthGradyWay,Renton,WA98057.rentonwa.govAGENDA ITEM #3. a)
2019-2024
Transportation Improvement Plan
AGENDA ITEM #4. a)
Purpose
A multi-year planning tool for the development
of transportation facilities that:
Supports the City’s Mission and Vision
Helps achieve the goals of the Renton
Business Plan
Reflects the involvement of City residents
and Elected Officials
AGENDA ITEM #4. a)
Essential Planning Tool
The Transportation Improvement Plan (TIP) is
vital to the City because it:
Is mandated by Washington State code
Establishes project eligibility for state and
federal grant programs
Helps foster collaboration and coordination
with other jurisdictions/agencies
AGENDA ITEM #4. a)
What’s New?
Format
Interactive Map
Updated Projects Information
New Projects Added
AGENDA ITEM #4. a)
Project Categories
Maintenance & Preservation (11 Projects)
Corridor Projects (22 Projects)
Traffic Operations & Safety (11 Projects)
Non-Motorized (6 Projects)
Other Programs (4 Projects)
Breakdown of Proposed Expenditures
by Category Type within TIP
10%
74%
3%12%
1%AGENDA ITEM #4. a)
Funding Summary
King County / Developer
Local Revitalization Funds
Fund Balance
Mitigation (Impact Fees)
Grants
Business and Occupation
Vehicle Fuel Tax AGENDA ITEM #4. a)
New Grants
TIP No.Project Grant Amount
2.2 SW 43rd St Pavement Preservation $1,000,000
15 Bronson Way N. Bridge Seismic Retrofit & Painting $3,000,000
16 Duvall Ave NE (additional sidewalk)$1,223,939
17 Houser Way N. Seismic Retrofit & Painting $2,999,000
21 Rainier Ave -Phase 4 (Right-of-Way)$3,000,000
21 Rainier Ave -Phase 4 (Construction)$4,500,000
24 S. 2nd Street Conversion (Design)$1,200,000
25 Williams Ave. N Seismic Retrofit & Painting $2,985,000
TOTAL $19,907,939 AGENDA ITEM #4. a)
New Projects Added
TIP No.Project
2.2 SW 43rd St Pavement Preservation
15 Bronson Way N. Bridge Seismic Retrofit & Painting
17 Houser Way N. Seismic Retrofit & Painting
22 Renton Connector
25 Williams Ave. N Seismic Retrofit & Painting
28 Houser Way Non-Motorized Improvements
37 Nile Ave NE Bridge Repair
39 Renton Bus Rapid Transit (BRT)Improvements
40 Transit Master Plan AGENDA ITEM #4. a)
Recent Constructed Projects
SUNSET LANE NE / NE 10TH AVE
IMPROVEMENTS AGENDA ITEM #4. a)
Recent Constructed Projects
CONNECTING DOWNTOWN –PHASE 1 AGENDA ITEM #4. a)
Recent Constructed Projects
116TH AVE SE PEDESTRIAN IMPROVEMENTS
Before
After AGENDA ITEM #4. a)
Anticipated Construction
DUVALL AVE NE ROADWAY PRESERVATION
RENTON AVE NE ROADWAY PRESERVATION
WILLIAMS AVE S/WELLS AVE S TWO-WAY CONVERSION
LAKE WASHINGTON LOOP TRAIL –PHASE 3
AGENDA ITEM #4. a)
Interactive Map
Active Link on Website:
http://www.rentonwa.gov/TIPMap
Allows general public to see
additional graphics on projects,
when available
Project information can be
updated in real time
AGENDA ITEM #4. a)
Recommended Action
Approve the annual updates to the 2019-2024 Transportation
Improvement Program
Present the Resolution for reading and adoption
AGENDA ITEM #4. a)
Questions?AGENDA ITEM #4. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
MINUTES
City Council Regular Meeting
7:00 PM ‐ Monday, August 13, 2018
Council Chambers, 7th Floor, City Hall – 1055 S. Grady Way
CALL TO ORDER AND PLEDGE OF ALLEGIANCE
Mayor Law called the meeting of the Renton City Council to order at 7:00 PM and led the
Pledge of Allegiance.
ROLL CALL
Councilmembers Present:
Ed Prince, Council President
Randy Corman
Ryan McIrvin
Ruth Pérez
Armondo Pavone
Don Persson
Carol Ann Witschi
Councilmembers Absent:
ADMINISTRATIVE STAFF PRESENT
Denis Law, Mayor
Robert Harrison, Chief Administrative Officer
Leslie Clark, Senior Assistant City Attorney
Jason Seth, City Clerk
Chip Vincent, Community & Economic Development Administrator
Gregg Zimmerman, Public Works Administrator
Jennifer Henning, Planning Director
Mark Santos‐Johnson, Community Development Project Manager
Commander Kevin Keyes, Police Department
PROCLAMATION
a) Jerene Battisti Day: A proclamation by Mayor Law was read declaring August 13, 2018 to be
Jerene Battisti Day, and encouraging all citizens to join in this special observance. Ms. Battisti
expressed appreciation for the proclamation.
MOVED BY PRINCE, SECONDED BY WITSCHI, COUNCIL CONCUR IN THE
PROCLAMATION. CARRIED.
AGENDA ITEM #8. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
PUBLIC HEARING
a) Interim Control for Fee Waivers & Property Tax Exemptions in Residential Targeted Areas:
This being the date set and proper notices having been posted and published in accordance
with local and State laws, Mayor Law opened the public hearing to consider an interim control
prohibiting the acceptance of applications for fee waivers or property tax exemptions for
multi‐family housing in residential targeted areas.
Community Project Development Manager Mark Santos‐Johnson reported that Council
adopted an interim control prohibiting the acceptance of applications for fee waivers or
property tax exemptions for multi‐family housing in residential targeted areas on June 25,
2018, and noted that State law required a public hearing be set within 60 days of adopting the
interim control to consider the issue. Mr. Santos‐Johnson explained that Council has docketed
a legislative review of Renton Municipal Code (RMC) 4‐1‐210 Waived Fees regarding the
eligibility and standards for fee waivers, and RMC 4‐1‐220 regarding property tax exemptions
for multi‐family housing in residential targeted areas. He further explained that the region is
currently experiencing a housing shortage, particularly for affordable housing.
Continuing, Mr. Santos‐Johnson reported that the purpose of multi‐family housing incentives
has been to encourage owner‐occupied and/or rental housing in eligible zones in the
Downtown or Sunset Areas, which are two high‐priority redevelopment centers for the City.
He noted that actual and/or proposed residential development has significantly increased in
these areas since the incentives were adopted. Mr. Santos‐Johnson reported that the purpose
of implementing the interim control was so that Council, the Planning Commission, and staff
could have the opportunity to advance potential amendments to the multi‐family housing
incentives program without the potential of applications being received that may not be in
the City's interest. Concluding, he reported the following next steps:
Develop and present proposals to the Planning Commission and Council Planning &
Development Committee;
Continue to accept and provide opportunities for additional public comment; and
Continue to provide public notice of the ongoing process either through the City's
website or by encouraging interested parties to become parties of record.
Public Comment was invited.
The following people spoke in opposition of the proposed interim control:
Howard McOmber, Renton, stated the incentives are vital to the effort of developing
and redeveloping properties in the residential targeted areas.
Anita Woo, Bellevue, remarked that the interim control jeopardizes the financial
feasibility of her current redevelopment project located near Jefferson Ave NE and NE
16th St.
Craig Keppler, Seattle, speaking on behalf of the Renton Village project, spoke in favor
of limiting fee waivers to projects located within the residential targeted areas.
Jim Houton, Bellevue, expressed support for the fee waivers because it mitigates
some investment risk.
Timothy Woo, Bellevue, expressed support for the fee waivers because they lower
risks for property investors.
AGENDA ITEM #8. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
There being no further public comment, it was
MOVED BY MCIRVIN, SECONDED BY WITSCHI, COUNCIL CLOSE THE PUBLIC
HEARING. CARRIED.
APPEAL
a) Planning & Development Committee ‐ Wilson Park I Preliminary Plat
MOVED BY MCIRVIN, SECONDED BY CORMAN, COUNCIL POSTPONES ITS FINAL
ACTION ON THE WILSON PARK I HEARING EXAMINER DECISION UNTIL ITS NEXT
COUNCIL MEETING, AUGUST 20, 2018. THE WILSONS HAVE UNTIL FRIDAY,
AUGUST 17, 2018 TO COMMIT IN WRITING TO CITY STAFF THAT WILSON PARK I
WILL BE BUILT TO ALL CITY LAWS, REGULATIONS, STANDARDS, AND
SPECIFICATIONS IN EFFECT AS OF AUGUST 17, 2018. IN OTHER WORDS, WILSON
PARK I WILL LOSE ITS VESTED STATUS. HOWEVER, CITY STAFF WOULD ALLOW THE
APPLICATION TO PROCEED WITHOUT NEED TO RE‐APPLY FOR PRELIMINARY PLAT
APPROVAL AND WITHOUT NEED TO PAY PRELIMINARY PLAT APPLICATION FEES.
IN EXCHANGE, THE CITY COUNCIL TAKES THE PRELIMINARY ACTION TONIGHT TO
MODIFY THE HEARING EXAMINER DECISION TO EXTEND THE PLAT EXPIRATION
DATE FOR WILSON PARK I FROM AUGUST 16, 2018 TO AUGUST 23, 2018. IF THE
WILSONS COMMIT TO THE ABOVE TERM (FOR WILSON PARK I TO MEET CURRENT
LAWS, REGULATIONS, STANDARDS, AND SPECIFICATIONS), THEN CITY STAFF WILL
RECOMMEND TO THE CITY COUNCIL TO EXTEND THE WILSON PARK I EXPIRATION
TO JULY 5, 2019. THE CITY COUNCIL HOLDS OPEN THE APPEAL HEARING FOR
WILSON PARK I TO RETAIN JURISDICTION AND TO MAKE A FINAL DECISION AS TO
THE HEARING EXAMINER DECISION. CARRIED.
ADMINISTRATIVE REPORT
Chief Administrative Officer Robert Harrison reviewed a written administrative report
summarizing the City’s recent progress towards goals and work programs adopted as part of
its business plan for 2018 and beyond. Items noted were:
The second annual Cruz the Loop event will take place Saturday, August 18th from
5:00 to 9:00 p.m. It will be an evening of live music, food, classic cars, and the vintage
cruise around the Renton loop. Pre‐registration is required as spots are limited. For
more information, visit http://rentonwa.gov/cruz.
Learn how to respond to disasters. Renton CERT classes are taught by local subject
matter experts including firefighters, police officers, chaplains, emergency managers,
and medical professionals. Learn to extinguish fires, conduct search and rescue,
provide basic first aid, identify and respond to terrorism, assist professional
responders, reduce survivor stress, and prepare yourself and your community for
emergencies. Summer classes will take place August 23rd through 25th from 8:00
a.m. to 5:00 p.m. Register online with code 61514 or call 425‐430‐6700.
Preventative street maintenance will continue to impact traffic and result in
occasional street closures.
CONSENT AGENDA
Items listed on the Consent Agenda were adopted with one motion, following the listing.
a) Approval of Council Meeting minutes of August 6, 2018. Council Concur.
AGENDA ITEM #8. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
b) AB ‐ 2178 City Clerk recommended granting a 20‐year latecomer agreement, File No. LA‐17‐
001, in the amount of $188,408, to Kushal Varma and Kajal Ram for sewer main extension on
SE 132nd St., and authorizing staff to finalize the latecomer agreement per City Code,
including directing the City Clerk to notify affected property owners. Refer to Utilities
Committee.
c) AB ‐ 2195 Transportation Systems Division recommended adoption of a resolution authorizing
the temporary complete closure of SW 19th St. between 100 SW 19th St. and 204 SW 19th St.
for a period of up to 10 calendar days between September 4 and September 30, 2018 to
construct the Rolling Hills Creek culvert tie‐in as part of the I‐405/SR 167 Interchange Direct
Connector project. Refer to Transportation (Aviation) Committee.
MOVED BY PRINCE, SECONDED BY CORMAN, COUNCIL CONCUR TO APPROVE THE
CONSENT AGENDA, AS PRESENTED. CARRIED.
UNFINISHED BUSINESS
a) Public Safety Committee Chair Pavone presented a report concurring in the staff
recommendation to repeal and replace Renton Municipal Code 6‐3, with language and processes
that support modern false alarm reduction programs.
MOVED BY PAVONE, SECONDED BY PERSSON, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
b) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to
approve the Award of the Falcon Ridge Lift Station Replacement and Force Main Improvements
Project to Road Construction Northwest, Inc. with a bid of $926,502.50. The Utilities Committee
further recommended concurrence in the staff recommendation of a budget transfer of
$250,000 from Thunder Hill Interceptor Rehabilitation project (426.465495) to Falcon Ridge Lift
Station Replacement and Force Main Improvements project (426.465480) as part of the next
budget adjustment. The proposed $1,250,000 budget for Falcon Ridge Lift Station Replacement
and Force Main Improvements project will be sufficient to cover the bid amount plus an
approximate 20% contingency, the engineering contract, and staff time.
MOVED BY WITSCHI, SECONDED BY MCIRVIN, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
c) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to
execute Change Order No. 1 to CAG‐17‐174 with Laser Underground & Earthworks, Inc. in the
amount of $302,406.79 for the rebuilding of Cedar Avenue South.
MOVED BY WITSCHI, SECONDED BY CORMAN, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
AGENDA ITEM #8. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
d) Finance Committee Chair Persson presented a report concurring in the staff recommendation to
approve the following payments:
1. Accounts Payable – total payment of $12,193,110.73 for vouchers 10081‐10084, 72518,
72718, 7012018, 366581‐366584, 366596‐366929, 366943‐367341; payroll benefit
withholding vouchers 5845‐5864, 70218, 70918, 366585‐366595, 366930‐366942; and
seventeen wire transfers.
2. Payroll – total payment of $3,017,559.20 for payroll vouchers which includes 1,575 direct
deposits and 79 checks (June 15‐30 & July 01‐15 2018 pay periods).
3. Kidder Mathews – total payment of $25,842.40 for vouchers 5671‐5684.
MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
e) Utilities Committee Chair Witschi presented a report concurring in the staff recommendation to
execute the agreement with Murraysmith, Inc. in the amount of $683,735 for Phase 2 of the
Downtown Utility Improvement Project.
MOVED BY WITSCHI, SECONDED BY CORMAN, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
f) Finance Committee Chair Persson presented a report concurring in the staff recommendation to
approve the Consortium Fiber Project Agreement to conduct a feasibility study to utilize the
Eastside Rail Corridor as a fiber optic infrastructure corridor.
MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
g) Finance Committee Chair Persson presented a report concurring in the staff recommendation to
authorize and sign the En Pointe Technology purchase order in the amount of $157,730.17 for
the renewal of Microsoft Enterprise Licenses True‐up under an existing Volume Licensing
Agreement (Enrollment No. 81271399 / Agreement No. 01E73965).
MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL CONCUR IN THE
COMMITTEE RECOMMENDATION. CARRIED.
LEGISLATION
Resolution:
a) Resolution No. 4350: A resolution was read authorizing the Mayor and City Clerk to enter
into an interlocal agreement with the City of Bellevue, City of Kirkland, City of Redmond, King
County, Bellevue School District 405, Lake Washington School District, and Renton School
District, entitled "Consortium Project Agreement 73," regarding the Eastside Rail Corridor
(ERC) Fiber Optic Feasibility Study, with such study being a project of the Community
Connectivity Consortium which was previously formed by interlocal agreement.
MOVED BY PERSSON, SECONDED BY PÉREZ, COUNCIL ADOPT THE RESOLUTION AS
READ. CARRIED.
AGENDA ITEM #8. a)
August 13, 2018 REGULAR COUNCIL MEETING MINUTES
Ordinance for first reading:
b) Ordinance No. 5886: An ordinance was read repealing and replacing Chapter 6‐3 of the
Renton Municipal Code, amending alarm system regulations, and providing for severability
and establishing an effective date.
MOVED BY PAVONE, SECONDED BY PERSSON, COUNCIL REFER THE ORDINANCE
FOR SECOND AND FINAL READING AT THE NEXT COUNCIL MEETING. CARRIED.
NEW BUSINESS
Please see the attached Council Meeting Calendar.
MOVED BY PAVONE, SECONDED BY CORMAN, COUNCIL REFER THE TOPIC OF THE RENTON
REGIONAL FIRE AUTHORITY’S SEPARATION FROM RECEIVING CITY SUPPORT FOR CERTAIN
SERVICES TO THE COMMITTEE OF THE WHOLE. CARRIED.
ADJOURNMENT
MOVED BY PRINCE, SECONDED BY PERSSON, COUNCIL ADJOURN. CARRIED. TIME:
7:37 P.M.
Jason A. Seth, CMC, City Clerk
Jason Seth, Recorder
Monday, August 13, 2018
AGENDA ITEM #8. a)
Council Committee Meeting Calendar
August 13, 2018
August 20, 2018
Monday
4:00 PM Transportation Committee, Chair Corman – Council Conference Room
1. Temporary Total Closure of East Valley Rd & SW 19th St. Intersection
2. Temporary Total Closure of SW 19th St.
3. 2019-2024 Six-year Transportation Improvement Program
4. Regional Transit Planning Discussion
5. Emerging Issues in Transportation
- Including Wells and Williams Conversion Update
5:30 PM Community Services Committee, Chair Pérez – Council Conference Room
1. Park Maintenance Responsibility of Homeless Camp Removals & Requirements
2. Emerging Issues in Community Services
6:00 PM Committee of the Whole, Chair Prince – Council Chambers
1. King County Metro’s Sewer Interceptor Rehabilitation Project
2. Regional Issues
AGENDA ITEM #8. a)
AB - 2198
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Proposed Annexation - Parker 60% Direct Petition to Annex
RECOMMENDED ACTION: Council Concur; Set Public Hearing on XX/XX/XXXX
DEPARTMENT: City Clerk
STAFF CONTACT: Jason Seth, City Clerk
EXT.: 6502
FISCAL IMPACT SUMMARY:
N/A
SUMMARY OF ACTION:
On March 11, 2013, Council authorized Adria Krail, petitioner, to circulate a 60% Direct Petition to Annex
specifying that property owners must accept City zoning and their proportional share of the City's existing
bonded indebtedness. On June 12, 2018, Ms. Krail submitted the 60% Direct Petition to Annex to the City. The
petition was then forwarded to King County Department of Assessments to certify the petition's sufficienc y
per RCW 35A.01.040. King County certified the petition in a letter dated July 12, 2018 (attached). Therefore,
staff recommends a Public Hearing to consider the 60% Direct Petition to Annex for the proposed Parker
Annexation be set for September 10, 2018. The proposed annexation area was pre-zoned via Ordinance #5254
with R-4 zoning, which will become effective upon annexation.
The proposed 14.5-acre Parker Annexation is located at the southeastern portion of the City limits. The Parker
Annexation Area is bordered by Renton City limits at the west, by the urban growth boundary at the west and south, and
by Southeast 124th St. at the south.
EXHIBITS:
A. Issue Paper
B. King County Certification Letter
C. Vicinity Map
STAFF RECOMMENDATION:
Set September 10, 2018 as a Public Hearing to consider the 60% Direct Petition to Annex for the proposed
Parker Annexation.
AGENDA ITEM #8. b)
DEPARTMENT OF COMMUNITY
& ECONOMIC DEVELOPMENT
M E M O R A N D U M
DATE: August 1, 2018
TO: Ed Prince, Council President
Members of the Renton City Council
VIA: Denis Law, Mayor
FROM: Chip Vincent, Administrator x6592
STAFF CONTACT: Angie Mathias, Long Range Planning Manger x6576
SUBJECT: Parker Annexation - Acceptance of 60% Direct Petition to
Annex
ISSUES:
Should the City Council accept the 60% Direct Petition to Annex from the Parker
Annexation Area now that the petition has been certified by the King County
Department of Assessments? If the City Council accepts the 60% Direct Petition, should
the Administration be directed to forward the Notice of Intent package for this
annexation to the Boundary Review Board?
RECOMMENDATION:
Council accept the 60% Direct Petition to Annex the approximately 8-
acre Parker Annexation site;
Council authorize the Administration to forward the Notice of Intent for
the Parker Annexation to the Boundary Review Board for King County
for their review.
BACKGROUND SUMMARY:
At its March 11, 2013 public meeting, Council accepted the 10% Notice of Intent to
Commence Annexation petition and authorized the circulation of a 60% Direct Petition
to Annex. City of Renton departments reviewed the annexation proposal and all staff
reported that the annexation represents a logical extension of their respective services
and systems. There were no issues identified that would impede the annexation.
On June 12, 2018, the petitioner submitted the 60% Direct Petition to Annex. That
petition was certified as sufficient, with signatures of property owners representing at
least 60% of the taxable value of the annexation area, by King County on July 12, 2018.
AGENDA ITEM #8. b)
Ed Prince, Council President
Page 2 of 2
August 1, 2018
Page 2 of 4
BACKGROUND SUMMARY:
The proposed 14.5-acre Parker Annexation is located at the southeastern portion of the
City limits. The Parker Annexation Area is bordered by Renton City limits at the west, by
the urban growth boundary at the east and north, and by Southeast 124th St at the
south.
1. Location: The proposed 14.5-acre Parker Annexation is bordered by the existing
City limits at its west.
2. Assessed value: The 2018 assessed valuation of the subject annexation site is
$18,991,000.
3. Natural features: The topography is level with only very small areas of grade
change of small hills rising to five feet above the grade of the surrounding land.
Approximately 560 feet of a type Ns stream runs through a portion of the
annexation area. It is in the southeastern portion of the area. Type Ns streams
are waters that do not contain fish or fish habitat and have intermittent flows,
they are seasonal non-habitat streams in which surface flow is not present for at
least some portion of a year of normal rainfall. Ns Waters must be physically
connected by an above-ground channel system to Type S, F, or Np Waters. Any
future development would be required to comply with Critical areas regulations
which require a 50 foot buffer from the stream and an additional 15 foot
structure setback beyond the buffer. Additionally a large wetland in a tract is
located along the western boundary of the annexation area. It appears that
there is no vacant land adjacent to the wetland so buffers for new development
would not be applied.
4. Existing land uses: There are 44 single-family residences and vacant land.
5. Existing zoning: Existing King County zoning is R-4. This area was prezoned by the
City of Renton as part of the East Renton Plateau pre-zoning. City of Renton
Ordinance #5254 prezoned the area with R-4 zoning; this zoning will become
effective upon annexation.
6. Comprehensive Plan: Renton’s Comprehensive Plan designates the subject
annexation site as Residential Low Density (RLD).
7. School District: The Parker Annexation area is in the Issaquah School District.
8. Public services: All responding City of Renton departments and divisions noted
that the annexation represents a logical extension of their respective services
and systems and presents no foreseeable problems. Specific comments follow:
AGENDA ITEM #8. b)
Ed Prince, Council President
Page 2 of 2
August 1, 2018
Page 3 of 4
Water Utility. The subject site is located within Water District No. 90’s water
service area by agreement under the coordinated water system plan. A
certificate of water availability from District 90 will be required prior to the
issuance of development permits within the subject area, following
annexation to the City. It is expected that developer extensions of District
No. 90’s water mains will be required to provide service for fire protection
and domestic use within the annexation area. The proposed area will not
generate need for additional City employees because it is within Water
District No. 90.
Wastewater Utility. The area is within the Renton wastewater service area
and is currently served with sewer service by the City. The annexation does
not present any problems for the utility.
Parks. The Community Services department indicated that the annexation
represents a logical extension of the services provided by their department.
Staff noted that the area is currently underserved with Renton parks and
recreation. Staff stated that the Community Planning area this annexation
falls in has been identified as needing to acquire land for two neighborhood
parks and one community park. However, King County’s Coal Field Park is
adjacent to the site.
Police. The Police Department did not indicate any concerns regarding this
proposed annexation. It is estimated that the area will generate an additional
39 calls for service annually.
Fire. Renton Regional Fire Authority currently serve the area, they will
continue to serve it. Staff did not indicate any concerns regarding this
proposed annexation.
Surface Water. The area is located in the May Creek drainage basin and any
future development will be required to comply with the City’s Surface Water
Design Manual and the Flow Control Duration Matching Forested Site
Conditions should be applied. Staff noted that the area contains very limited
stormwater infrastructure, consisting of primarily ditches. There are no curb
and gutters and some lawns encroach into the right of way. Several parcels
contain standing water and are possible wetlands. Additionally, an unnamed
stream that is a tributary to May Creek originates within this area. There are
no records of drainage complaints with King County. If the area annexes, it
will require maintenance from the City. The annexation is a logical extension
of the services provided by the division.
Transportation Systems. The Transportation Systems staff has no concerns
regarding the proposed annexation. Staff indicated that additional
AGENDA ITEM #8. b)
Ed Prince, Council President
Page 2 of 2
August 1, 2018
Page 4 of 4
Transportation Systems staff would not be required and that the annexation
represents a logical extension of services. Staff indicated that dedication of
right-of-way on Southeast 120th and Southeast 124th may be required if the
streets were to be redeveloped in the future to current Renton standards.
Also, the roadways in the area have not been constructed to include curb,
gutter, and sidewalks, which is the current Renton development standard for
roadways. The area does have street lighting, but it does not meet current
Renton Standards. Energy costs associated with existing and new street
lighting, existing and new traffic control signage, and pavement markings
may be incurred by the City. Staff indicated that the City would assume
ownership and responsibility of all existing streets in the area.
Public Works Maintenance. The annexation does not present any problems
for the Department and it represents a logical extension of their services.
Staff noted that seven years ago the area had some roads rebuilt and in
some places the roads are cracking. Also, there are shoulders in the area that
will need to be maintained.
Building. The Building section did not indicate any concerns regarding the
proposed annexation.
Planning. The Planning section did not indicate any concerns regarding the
proposed annexation.
CONCLUSION:
The proposed Parker Annexation has been certified as having sufficient signatures
representing at least 60% of the area’s assessed value. It also has reasonable
boundaries and appears to comply with Boundary Review Board objectives. Reviewing
staff raised no objections to this annexation. The proposed Parker Annexation furthers
the City’s Business Plan goals and is in the general welfare and interest of the City. The
Administration recommends the Council accept the 60% Direct Petition and authorize
staff to forward the Notice of Intent package to the Boundary Review Board for King
County.
AGENDA ITEM #8. b)
AGENDA ITEM #8. b)
Coalfield ParkCoalfield ParkShadow Ave NENE 7th Pl
NE 6th St Private RdNE 6 t h S t
SE 120th St
SE 124th St
NE 7th Ct
Rosario Pl NES E 1 2 4 t h S t156th Ave SERosario Pl NES
hado
w
A
ve NE155th Ave SEParker A nnexat ionVicinity Ma pAnnex b ou nd a ry
Pa rks
Pa rce lso1:3,200
0 400200Fee t
Pa th: H:\CED\Planning\GIS\GIS_projects\annex ations\parker_annex\Mx ds \1_parker_annex _v ic inity.mxd
Pri nted Date: 03/13/2013
AGENDA ITEM #8. b)
AB - 2200
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Office Mail Metering Services Contract with Diamond Marketing
Solutions, Inc.
RECOMMENDED ACTION: Refer to Finance Committee
DEPARTMENT: Executive
STAFF CONTACT: Karl Hurst, Print & Mail Coordinator
EXT.: 6975
FISCAL IMPACT SUMMARY:
$98,551.20 yearly; contract for a three-year term totaling $295,653.60
Cost of contract will be covered in Print/Mail’s current budget.
SUMMARY OF ACTION:
Print/Mail Services has used the vendor Postal Express since before 1996. Services provided are: metering, postal
delivery, pickup/delivery from Highlands USPS to City of Renton and pickup/delivery from City of Renton to Postal
Express. Postal Express was purchased by GSO several years ago and became a subsidiary of the company. Since the
acquisition, services provided to the City has declined, including but not limited to: late service, missed daily service, an d
not funding postage to their subcontracted m etering company.
Print/Mail Services would like to contract with vendor Diamond Marketing Solutions, Inc. (which is an innovative, full -
service, Renton business) for metering and postal delivery. Yearly cost would be $98,551.20, compared to $99,299.47,
cost of same services for the past 12 months with Postal Express. All costs are estimated and depend on amount of office
mail generated in the future (see Exhibit C).
A new service provider will be procured for pickup/delivery from Highlands USPS to City of Renton and pickup/delivery
from City of Renton to Diamond Marketing Solutions, Inc. Preliminary estimates from one delivery service suggest costs
could be cut by 20 to 30 percent from what Postal Express was charging (see exhibit B).
EXHIBITS:
A. Contract w/Diamond Marketing Solutions, Inc.
B. Cost Comparisons between vendors
C. Mail Trends
STAFF RECOMMENDATION:
Authorize the Mayor and City Clerk to sign a contract with Diamond Marketing Solutions, Inc. for postal metering and
delivery for a three-year period.
AGENDA ITEM #8. c)
AGREEMENT FOR MAIL METERING/PRESORT SERVICE
THIS AGREEMENT, dated August 1st, 2018, is by and between the City of Renton (the “City”), a
Washington municipal corporation, and Diamond Marketing Solutions Group, Inc.
(“Consultant”), a Delaware Corporation with principal place of business at 700 SW 34th Street,
Renton WA. The City and the Consultant are referred to collectively in this Agreement as the
“Parties.” Once fully executed by the Parties, this Agreement is effective as of the last date
signed by both parties.
1. Scope of Work: Consultant agrees to provide presort services, mail metering, and
submission of mail to USPS as specified in Exhibit A, which is attached and incorporated
herein and may hereinafter be referred to as the “Work.”
2. Changes in Scope of Work: The City, without invalidating this Agreement, may order
changes to the Work consisting of additions, deletions or modifications. Any such
changes to the Work shall be ordered by the City in writing and the Compensation shall
be equitably adjusted consistent with the rates set forth in Exhibit A or as otherwise
mutually agreed by the Parties.
3.Time of Performance: Consultant shall commence performance of the Agreement
pursuant to the schedule(s) set forth in Exhibit A.
4. Compensation:
A. Amount. Total compensation to Consultant for Work provided pursuant to this
Agreement shall not exceed $350,000.00 plus any applicable state and local sales
taxes. Compensation shall be paid based upon Work actually performed according to
the rate(s) or amounts specified in Exhibit A. The Consultant agrees that any hourly
or flat rate charged by it for its Work shall remain locked at the negotiated rate(s)
unless otherwise agreed to in writing or provided in Exhibit A. Except as specifically
provided herein, the Consultant shall be solely responsible for payment of any taxes
imposed as a result of the performance and payment of this Agreement.
B. Method of Payment. On a monthly or no less than quarterly basis during any quarter
in which Work is performed, the Consultant shall submit a voucher or invoice in a
form specified by the City, including a description of what Work has been
performed. Payment shall be made by the City for Work performed within thirty
(30) calendar days after receipt and approval by the appropriate City representative
AGENDA ITEM #8. c)
PAGE 2 OF 11
of the voucher or invoice. If the Consultant’s performance does not meet the
requirements of this Agreement, the Consultant will correct or modify its
performance to comply with the Agreement. The City may withhold payment for
work that does not meet the requirements of this Agreement.
C. Effect of Payment. Payment for any part of the Work shall not constitute a waiver by
the City of any remedies it may have against the Consultant for failure of the
Consultant to perform the Work or for any breach of this Agreement by the
Consultant.
D. Non-Appropriation of Funds. If sufficient funds are not appropriated or allocated for
payment under this Agreement for any future fiscal period, the City shall not be
obligated to make payments for Work or amounts incurred after the end of the
current fiscal period, and this Agreement will terminate upon the completion of all
remaining Work for which funds are allocated. No penalty or expense shall accrue to
the City in the event this provision applies.
5. Termination:
A. The City reserves the right to terminate this Agreement at any time, with or without
cause by giving ten (10) calendar days’ notice to the Consultant in writing. In the
event of such termination or suspension, all finished or unfinished documents, data,
studies, worksheets, models and reports, or other material prepared by the
Consultant pursuant to this Agreement shall be submitted to the City, if any are
required as part of the Work.
B. In the event this Agreement is terminated by the City, the Consultant shall be
entitled to payment for all Work performed to the effective date of termination, less
all payments previously made. If the Agreement is terminated by the City after
partial performance of Work for which the agreed compensation is a fixed fee, the
City shall pay the Consultant an equitable share of the fixed fee. This provision shall
not prevent the City from seeking any legal remedies it may have for the violation or
nonperformance of any of the provisions of this Agreement and such charges due to
the City shall be deducted from the final payment due the Consultant. No payment
shall be made by the City for any expenses incurred or work done following the
effective date of termination unless authorized in advance in writing by the City.
6. Warranties And Right To Use Work Product: Consultant represents and warrants that
Consultant will perform all Work identified in this Agreement in a professional and
workmanlike manner and in accordance with all reasonable and professional standards
and laws. Compliance with professional standards includes, as applicable, performing
the Work in compliance with applicable City standards or guidelines (e.g. design criteria
and Standard Plans for Road, Bridge and Municipal Construction). Professional
AGENDA ITEM #8. c)
PAGE 3 OF 11
engineers shall certify engineering plans, specifications, plats, and reports, as applicable,
pursuant to RCW 18.43.070. Consultant further represents and warrants that all final
work product created for and delivered to the City pursuant to this Agreement shall be
the original work of the Consultant and free from any intellectual property
encumbrance which would restrict the City from using the work product. Consultant
grants to the City a non-exclusive, perpetual right and license to use, reproduce,
distribute, adapt, modify, and display all final work product produced pursuant to this
Agreement. The City’s or other’s adaptation, modification or use of the final work
products other than for the purposes of this Agreement shall be without liability to the
Consultant. The provisions of this section shall survive the expiration or termination of
this Agreement.
7. Record Maintenance: The Consultant shall maintain accounts and records, which
properly reflect all direct and indirect costs expended and Work provided in the
performance of this Agreement and retain such records for as long as may be required
by applicable Washington State records retention laws, but in any event no less than six
years after the termination of this Agreement. The Consultant agrees to provide access
to and copies of any records related to this Agreement as required by the City to audit
expenditures and charges and/or to comply with the Washington State Public Records
Act (Chapter 42.56 RCW). The provisions of this section shall survive the expiration or
termination of this Agreement.
8. Public Records Compliance: To the full extent the City determines necessary to comply
with the Washington State Public Records Act, Consultant shall make a due diligent
search of all records in its possession or control relating to this Agreement and the
Work, including, but not limited to, e-mail, correspondence, notes, saved telephone
messages, recordings, photos, or drawings and provide them to the City for production.
In the event Consultant believes said records need to be protected from disclosure, it
may, at Consultant’s own expense, seek judicial protection. Consultant shall indemnify,
defend, and hold harmless the City for all costs, including attorneys’ fees, attendant to
any claim or litigation related to a Public Records Act request for which Consultant has
responsive records and for which Consultant has withheld records or information
contained therein, or not provided them to the City in a timely manner. Consultant shall
produce for distribution any and all records responsive to the Public Records Act request
in a timely manner, unless those records are protected by court order. The provisions of
this section shall survive the expiration or termination of this Agreement.
9. Independent Contractor Relationship:
A. The Consultant is retained by the City only for the purposes and to the extent set
forth in this Agreement. The nature of the relationship between the Consultant and
the City during the period of the Work shall be that of an independent contractor,
not employee. The Consultant, not the City, shall have the power to control and
AGENDA ITEM #8. c)
PAGE 4 OF 11
direct the details, manner or means of Work. Specifically, but not by means of
limitation, the Consultant shall have no obligation to work any particular hours or
particular schedule, unless otherwise indicated in the Scope of Work or where
scheduling of attendance or performance is mutually arranged due to the nature of
the Work. Consultant shall retain the right to designate the means of performing the
Work covered by this agreement, and the Consultant shall be entitled to employ
other workers at such compensation and such other conditions as it may deem
proper, provided, however, that any contract so made by the Consultant is to be
paid by it alone, and that employing such workers, it is acting individually and not as
an agent for the City.
B. The City shall not be responsible for withholding or otherwise deducting federal
income tax or Social Security or contributing to the State Industrial Insurance
Program, or otherwise assuming the duties of an employer with respect to
Consultant or any employee of the Consultant.
C. If the Consultant is a sole proprietorship or if this Agreement is with an individual,
the Consultant agrees to notify the City and complete any required form if the
Consultant retired under a State of Washington retirement system and agrees to
indemnify any losses the City may sustain through the Consultant’s failure to do so.
10. Hold Harmless: The Consultant agrees to release, indemnify, defend, and hold harmless
the City, elected officials, employees, officers, representatives, and volunteers from any
and all claims, demands, actions, suits, causes of action, arbitrations, mediations,
proceedings, judgments, awards, injuries, damages, liabilities, taxes, losses, fines, fees,
penalties, expenses, attorney’s or attorneys’ fees, costs, and/or litigation expenses to or
by any and all persons or entities, arising from, resulting from, or related to the
negligent acts, errors or omissions of the Consultant in its performance of this
Agreement or a breach of this Agreement by Consultant, except for that portion of the
claims caused by the City’s sole negligence.
Should a court of competent jurisdiction determine that this agreement is subject to
RCW 4.24.115, (Validity of agreement to indemnify against liability for negligence
relative to construction, alteration, improvement, etc., of structure or improvement
attached to real estate…) then, in the event of liability for damages arising out of bodily
injury to persons or damages to property caused by or resulting from the concurrent
negligence of the Consultant and the City, its officers, officials, employees and
volunteers, Consultant’s liability shall be only to the extent of Consultant’s negligence.
It is further specifically and expressly understood that the indemnification provided in
this Agreement constitute Consultant’s waiver of immunity under the Industrial
Insurance Act, RCW Title 51, solely for the purposes of this indemnification. The Parties
AGENDA ITEM #8. c)
PAGE 5 OF 11
have mutually negotiated and agreed to this waiver. The provisions of this section shall
survive the expiration or termination of this Agreement.
11. Gifts and Conflicts: The City’s Code of Ethics and Washington State law prohibit City
employees from soliciting, accepting, or receiving any gift, gratuity or favor from any
person, firm or corporation involved in a contract or transaction. To ensure compliance
with the City’s Code of Ethics and state law, the Consultant shall not give a gift of any
kind to City employees or officials. Consultant also confirms that Consultant does not
have a business interest or a close family relationship with any City officer or employee
who was, is, or will be involved in selecting the Consultant, negotiating or administering
this Agreement, or evaluating the Consultant’s performance of the Work.
12. City of Renton Business License: The Consultant shall obtain a City of Renton Business
License prior to performing any Work and maintain the business license in good
standing throughout the term of this agreement with the City.
Information regarding acquiring a city business license can be found at:
http://www.rentonwa.gov/cms/One.aspx?portalId=7922741&pageId=9824882
Information regarding State business licensing requirements can be found at:
http://dor.wa.gov/doing-business/register-my-business
13. Insurance: Consultant shall secure and maintain:
A. Commercial general liability insurance in the minimum amounts of $1,000,000 for
each occurrence/$2,000,000 aggregate for the Term of this Agreement.
B. In the event that Work delivered pursuant to this Agreement either directly or
indirectly involve or require Professional Services, Professional Liability, Errors and
Omissions coverage shall be provided with minimum limits of $1,000,000 per
occurrence. "Professional Services", for the purpose of this section, shall mean any
Work provided by a licensed professional or Work that requires a professional
standard of care.
C. Workers’ compensation coverage, as required by the Industrial Insurance laws of
the State of Washington, shall also be secured.
D. Commercial Automobile Liability for owned, leased, hired or non-owned with
minimum limits of $1,000,000 per occurrence combined single limit, if there will be
any use of Consultant’s vehicles on the City’s Premises by or on behalf of the City,
beyond normal commutes.
AGENDA ITEM #8. c)
PAGE 6 OF 11
E. Consultant shall name the City as an Additional Insured on its commercial general
liability policy on a non-contributory primary basis. The City’s insurance policies shall
not be a source for payment of any Consultant liability, nor shall the maintenance of
any insurance required by this Agreement be construed to limit the liability of
Consultant to the coverage provided by such insurance or otherwise limit the City’s
recourse to any remedy available at law or in equity.
F. Subject to the City’s review and acceptance, a certificate of insurance showing the
proper endorsements, shall be delivered to the City before performing the Work.
G. Consultant shall provide the City with written notice of any policy cancellation,
within two (2) business days of their receipt of such notice.
14. Delays: Consultant is not responsible for delays caused by factors beyond the
Consultant’s reasonable control. When such delays beyond the Consultant’s reasonable
control occur, the City agrees the Consultant is not responsible for damages, nor shall
the Consultant be deemed to be in default of the Agreement.
15. Successors and Assigns: Neither the City nor the Consultant shall assign, transfer or
encumber any rights, duties or interests accruing from this Agreement without the
written consent of the other.
16. Notices: Any notice required under this Agreement will be in writing, addressed to the
appropriate party at the address which appears below (as modified in writing from time
to time by such party), and given personally, by registered or certified mail, return
receipt requested, by facsimile or by nationally recognized overnight courier service.
Time period for notices shall be deemed to have commenced upon the date of receipt,
EXCEPT facsimile delivery will be deemed to have commenced on the first business day
following transmission. Email and telephone may be used for purposes of administering
the Agreement, but should not be used to give any formal notice required by the
Agreement.
CITY OF RENTON
Karl Hurst
1055 South Grady Way
Renton, WA 98057
Phone: (425) 430-6975
khurst@rentonwa.gov
Fax: (425) 430-6523
CONSULTANT
David O’Malley
710 SW 34th Street
Renton WA 98057-4816
Phone: 425-251-0833 ext. 385
domalley@dmsolutions.com
AGENDA ITEM #8. c)
PAGE 7 OF 11
17. Discrimination Prohibited: Except to the extent permitted by a bona fide occupational
qualification, the Consultant agrees as follows:
A. Consultant, and Consultant’s agents, employees, representatives, and volunteers
with regard to the Work performed or to be performed under this Agreement, shall
not discriminate on the basis of race, color, sex, religion, nationality, creed, marital
status, sexual orientation or preference, age (except minimum age and retirement
provisions), honorably discharged veteran or military status, or the presence of any
sensory, mental or physical handicap, unless based upon a bona fide occupational
qualification in relationship to hiring and employment, in employment or application
for employment, the administration of the delivery of Work or any other benefits
under this Agreement, or procurement of materials or supplies.
B. The Consultant will take affirmative action to insure that applicants are employed
and that employees are treated during employment without regard to their race,
creed, color, national origin, sex, age, sexual orientation, physical, sensory or mental
handicaps, or marital status. Such action shall include, but not be limited to the
following employment, upgrading, demotion or transfer, recruitment or recruitment
advertising, layoff or termination, rates of pay or other forms of compensation and
selection for training.
C. If the Consultant fails to comply with any of this Agreement’s non-discrimination
provisions, the City shall have the right, at its option, to cancel the Agreement in
whole or in part.
D. The Consultant is responsible to be aware of and in compliance with all federal,
state and local laws and regulations that may affect the satisfactory completion of
the project, which includes but is not limited to fair labor laws, worker's
compensation, and Title VI of the Federal Civil Rights Act of 1964, and will comply
with City of Renton Council Resolution Number 4085.
18. Miscellaneous: The parties hereby acknowledge:
A. The City is not responsible to train or provide training for Consultant.
B. Consultant will not be reimbursed for job related expenses except to the extent
specifically agreed within the attached exhibits.
C. Consultant shall furnish all tools and/or materials necessary to perform the Work
except to the extent specifically agreed within the attached exhibits.
D. In the event special training, licensing, or certification is required for Consultant to
provide Work he/she will acquire or maintain such at his/her own expense and, if
Consultant employs, sub-contracts, or otherwise assigns the responsibility to
AGENDA ITEM #8. c)
PAGE 8 OF 11
perform the Work, said employee/sub-contractor/assignee will acquire and or
maintain such training, licensing, or certification.
E. This is a non-exclusive agreement and Consultant is free to provide his/her Work to
other entities, so long as there is no interruption or interference with the provision
of Work called for in this Agreement.
F. Consultant is responsible for his/her own insurance, including, but not limited to
health insurance.
G. Consultant is responsible for his/her own Worker’s Compensation coverage as well
as that for any persons employed by the Consultant.
19. Other Provisions:
A. Approval Authority. Each individual executing this Agreement on behalf of the City
and Consultant represents and warrants that such individuals are duly authorized to
execute and deliver this Agreement on behalf of the City or Consultant.
B. General Administration and Management. The City’s project manager is Karl Hurst
or current Print/Mail Supervisor. In providing Work, Consultant shall coordinate with
the City’s contract manager or his/her designee.
C. Amendment and Modification. This Agreement may be amended only by an
instrument in writing, duly executed by both Parties.
D. Conflicts. In the event of any inconsistencies between Consultant proposals and this
Agreement, the terms of this Agreement shall prevail. Any exhibits/attachments to
this Agreement are incorporated by reference only to the extent of the purpose for
which they are referenced within this Agreement. To the extent a Consultant
prepared exhibit conflicts with the terms in the body of this Agreement or contains
terms that are extraneous to the purpose for which it is referenced, the terms in the
body of this Agreement shall prevail and the extraneous terms shall not be
incorporated herein.
E. Governing Law. This Agreement shall be made in and shall be governed by and
interpreted in accordance with the laws of the State of Washington and the City of
Renton. Consultant and all of the Consultant’s employees shall perform the Work in
accordance with all applicable federal, state, county and city laws, codes and
ordinances.
F. Joint Drafting Effort. This Agreement shall be considered for all purposes as
prepared by the joint efforts of the Parties and shall not be construed against one
AGENDA ITEM #8. c)
PAGE 9 OF 11
party or the other as a result of the preparation, substitution, submission or other
event of negotiation, drafting or execution.
G. Jurisdiction and Venue. Any lawsuit or legal action brought by any party to enforce
or interpret this Agreement or any of its terms or covenants shall be brought in the
King County Superior Court for the State of Washington at the Maleng Regional
Justice Center in Kent, King County, Washington, or its replacement or successor.
H. Severability. A court of competent jurisdiction’s determination that any provision or
part of this Agreement is illegal or unenforceable shall not cancel or invalidate the
remainder of this Agreement, which shall remain in full force and effect.
I. Sole and Entire Agreement. This Agreement contains the entire agreement of the
Parties and any representations or understandings, whether oral or written, not
incorporated are excluded.
J. Time is of the Essence. Time is of the essence of this Agreement and each and all of
its provisions in which performance is a factor. Adherence to completion dates set
forth in the description of the Work is essential to the Consultant’s performance of
this Agreement.
K. Third-Party Beneficiaries. Nothing in this Agreement is intended to, nor shall be
construed to give any rights or benefits in the Agreement to anyone other than the
Parties, and all duties and responsibilities undertaken pursuant to this Agreement
will be for the sole and exclusive benefit of the Parties and no one else.
L. Binding Effect. The Parties each bind themselves, their partners, successors, assigns,
and legal representatives to the other party to this Agreement, and to the partners,
successors, assigns, and legal representatives of such other party with respect to all
covenants of the Agreement.
M. Waivers. All waivers shall be in writing and signed by the waiving party. Either
party’s failure to enforce any provision of this Agreement shall not be a waiver and
shall not prevent either the City or Consultant from enforcing that provision or any
other provision of this Agreement in the future. Waiver of breach of any provision of
this Agreement shall not be deemed to be a waiver of any prior or subsequent
breach unless it is expressly waived in writing.
N. Counterparts. The Parties may execute this Agreement in any number of
counterparts, each of which shall constitute an original, and all of which will
together constitute this one Agreement.
AGENDA ITEM #8. c)
PAGE 10 OF 11
IN WITNESS WHEREOF, the Parties have voluntarily entered into this Agreement as of the date
last signed by the Parties below.
CITY OF RENTON
By:_____________________________
CONSULTANT
By:____________________________
Denis Law
Mayor
David O’Malley
V.P. Communication Services
_____________________________
Date
_____________________________
Date
Attest
_____________________________
Jason A. Seth
City Clerk
Approved as to Legal Form
_____________________________
Shane Moloney
Renton City Attorney
Contract Template Updated 04/10/2018
AGENDA ITEM #8. c)
PAGE 11 OF 11
Exhibit A
Scope of Work
Diamond Marketing Solutions Group, Inc. (“Diamond”) and City of Renton (“Client”) are
entering into a contract where Diamond will provide the following services commencing
September 1, 2018 for a term of three years through August 31, 2021.
1. Metering $.05 per piece
2. Presorting $.02 per piece
3. Processing files for print $.03 per item Optional
4. Printing $.03 per image Optional
5. Mailing service (folding, inserting metering, sorting) $.04 per envelope
Optional
6. Monthly Minimum $100.00
Diamond shall provide metering and presort services each weekday (excluding city holidays),
and processed mail will be submitted by Diamond to the USPS on the same day received. City or
its agent shall deliver mail to Diamond no later than 4pm daily.
Diamond and Client both agree to these services and prices as outlined above.
AGENDA ITEM #8. c)
Complete year of Charged Mail Services (most recent)
Date Billing Period Vendor Invoice#Amount Actual Postage Service Costs #Days Serv Pieces
7/10/2017 Jun-17 Postal Express P1706862 $10,432.86 $8,041.06 $2,391.80 22 14,222
8/7/2017 Jul-17 Postal Express P1707855 $8,328.68 $6,184.61 $2,144.07 20 10,566
9/7/2017 Aug-17 Postal Express P1708591 $9,553.16 $7,052.65 $2,500.51 23 12,903
10/6/2017 Sep-17 Postal Express P1709397 $9,578.67 $7,639.58 $1,939.09 20 12,902
11/6/2017 Oct-17 Postal Express P1710404 $9,102.59 $6,819.51 $2,283.08 21 11,609
12/20/2017 Nov-17 Postal Express P1711704 $8,951.80 $6,886.16 $2,065.64 19 12,723
1/2/2018 Dec-17 Postal Express P1712313 $9,533.71 $7,498.36 $2,035.35 19 13,758 154,299 12 month 1st Class Office mail pieces
2/7/2018 Jan-18 Postal Express P1801552 $9,667.19 $7,492.83 $2,174.36 20 13,256
3/2/2018 Feb-18 Postal Express P1802802 $11,418.76 $9,353.12 $2,065.64 19 16,522
4/4/2018 Mar-18 Postal Express P1803702 $9,300.77 $7,252.96 $2,047.81 22 12,689
5/8/2018 Apr-18 Postal Express P1804909 $8,907.08 $6,732.72 $2,174.36 20 11,589
6/11/2018 May-18 Postal Express P1805352 $9,188.51 $6,796.71 $2,391.80 22 11,560
$113,963.78 $87,750.27
Same year, Metering Service portion Separated Delivery Charges
Date Billing Period Daily Rate Amount #Days Serv #Charged Days (from serv costs above - in future independent contractor to be determined
7/10/2017 Jun-17 $48.13 $1,058.86 22 22 $1,332.94
8/7/2017 Jul-17 $48.13 $962.60 20 20 $1,181.47
9/7/2017 Aug-17 $48.13 $1,106.99 23 23 $1,393.52
10/6/2017 Sep-17 $48.13 $818.21 20 17 $1,120.88
11/6/2017 Oct-17 $48.13 $1,010.73 21 21 $1,272.35
12/20/2017 Nov-17 $48.13 $914.47 19 19 $1,151.17
1/2/2018 Dec-17 $48.13 $914.47 19 19 $1,120.88
2/7/2018 Jan-18 $48.13 $962.60 20 20 $1,211.76
3/2/2018 Feb-18 $48.13 914.47 19 19 $1,151.17
4/4/2018 Mar-18 $48.13 $866.34 21 18 $1,181.47
5/8/2018 Apr-18 $48.13 $962.60 20 20 $1,211.76
6/11/2018 May-18 $48.13 $1,056.86 22 22 $1,334.94
$11,549.20 246 $14,664.31
Diamond Metering Contract
Based on one year of past data above, a years cost for mail metering and postage was $99,299.47
In new contract all costs will be included in one piece rate at $0.07, multiplied by the same past year would be $10,800.93 for service and the actual postage ($87,750.27) to Total - $98,551.20 approx per year
3 years - $295,653.60
I forsee slightly more manageable postage costs in the future, even with postal increases. Office mail volumes have been slowly decreasing despite an uptick last year. See Exhibit D (mail trends).
Another indicator that office mail numbers will decrease is is that we have been woking with Admin Services to automate utility late notices.
These have historically been mailed as office mail, and mailing them as an automated mailing each month will take those quantities from the office mail totals.
Approx 2000 pieces a month, which will be paid for on permit 20 (utility bills) and funded directly by Admin Services. The first mailing went out in July this year.
Delivery Services (not in this contract)
For delivery services - Verbal quotes with Thuder Dog were $16.00 am, and $25.00 pm, for $41.00 per service day.
At 246 service days per year would be $10,086.00. Compare to past delivery costs above of $14,664.31
Yet to negotiate contract if needed. Need more comparables.AGENDA ITEM #8. c)
2016-2017 Mail Comparisons
Category 2016 2017 Incr/Decr % Change Notes
Bulk Mail (Permit 137) 327,815 298,779 -29,036 -8.9% 43 mailings 2016, 39 mailings 2017
1st Class (Office) Mail 141,544 155,073 13,529 9.6% Includes letters, flats, and parcels, outsourced for metering
Utility Bills Mailed 264,216 254,196 -10,020 -3.8% Permit 20, 1st Class
Inserting Equip Pieces 331,265 341,608 10,343 3.1%
Many mail pieces (especially bulk) are prepared as self-mailers which are not processed through the inserting equipment.
This practice helps keep costs down by eliminating envelopes.
The increase in pieces processed through the inserter reflects the office mail increase.
Maintain Fed Ex account for time sensitive/express mail, and lower costs for insured parcels.
Watching rising outsource metering costs vs possible inhouse metering equipment.
2009 2010 2011 2012 2013 2014 2015 2016 2017
Bulk Mail (Permit 137) 271,925 257,789 249,089 284,274 299,910 303,367 299,584 327,815 298,779
1st Class (Office) Mail 195,081 180,788 169,027 151,354 152,842 146,145 145,336 141,544 155,073
Utility Bills Mailed 269,079 296,166 301,297 305,731 295,197 270,611 267,051 264,216 254,196
Inserting Equip Pieces 401,719 438,774 390,176 393,908 349,398 347,853 331,265 341,608
Mail Trends
0
50,000
100,000
150,000
200,000
250,000
300,000
350,000
400,000
450,000
500,000
2009 2010 2011 2012 2013 2014 2015 2016 2017
Bulk Mail (Permit 137)1st Class (Office) Mail
Utility Bills Mailed Inserting Equip Pieces
0
50,000
100,000
150,000
200,000
250,000
300,000
350,000
400,000
450,000
500,000
2009 2010 2011 2012 2013 2014 2015 2016 2017
Bulk Mail (Permit 137)
1st Class (Office) Mail
Utility Bills Mailed
Inserting Equip Pieces
AGENDA ITEM #8. c)
AB - 2203
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Agreement between City of Renton and RRFA-Responsibilities for
Developing Fire Station #15
RECOMMENDED ACTION: Council Concur
DEPARTMENT: Executive
STAFF CONTACT: Robert Harrison, Chief Administrative Officer
EXT.: 6500
FISCAL IMPACT SUMMARY:
City of Renton's responsibility for development costs shall not exceed the sum of $5,671,809, including
applicable sales tax. In addition, the City's responsibility for Fire Station #15 furnishings and equipment (as
shown in Exhibit C of the Agreement) shall not exceed $1,000,000, including applicable sales tax. These
amounts will be dispersed from the General Government Capital Improvement Program fund.
SUMMARY OF ACTION:
In 2016, voters approved the Regional Renton Fire Authority Plan ("Plan"). The Plan approved the creation of
the RRFA and committed the City and RRFA to certain cost-sharing arrangements. The Plan requires the City to
pay for up to $5,671,809 for a new fire station, referred to as Fire Station #15. This agreement outlines the
responsibilities and requirements of each party with regards to the development of Fire Station #15.
EXHIBITS:
A. Agreement
STAFF RECOMMENDATION:
Authorize the Mayor and City Clerk to execute the agreement with Renton Regional Fire Authority clarifying
responsibilities for the development of Fire Station #15.
AGENDA ITEM #8. d)
AGREEMENTBETWEENTHECITYOFRENTONANDTHERENTONREGIONALFIREAUTHORITYCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#15THISAGREEMENTdatedthe________dayof_________,2018,isbetweentheCityofRenton,aWashingtonmunicipalcorporation(the“City”),andtheRentonRegionalFireAuthority,aWashingtonmunicipalcorporation(“RRFA”)(collectively,theCityandtheRRFAarethe“Parties”).RECITALS1.In2016,votersapprovedtheRegionalFireAuthorityPlan(“thePlan”).ThePlanapprovedthecreationoftheRRFAandcommittedtheCityandRRFAtocertaincostsharingarrangements.ThePlanrequirestheCitytobuildtheRRFAanewfirestation,referredtoasFireStation15.Withregardtocostsharing,thePlanprovidesasfollows:1.1.ThecostofdevelopingofFireStation15,includingallcostssuchassurvey,design,permit,constructionandanyassociatedactivitiesrequiredtobringthestationtooperationalstatus,inanamountnottoexceed$5.5million.Thecostisbasedona2015estimateandshallbeadjustedbytheSeattleAreaConstructionCostindexaspublishedbyEngineeringNewsRecord(ENR.COM)annuallythereafteruntiltheprojectconstructionbidisawarded.1.2.ThecostoffurnishingandequippingFireStation15isnottoexceed$1million.2.TheCityhasawardedthebidforFireStation15.TheRRFAapprovedtheplansforFireStation15inadvanceofthebidbeingawarded.TheCityandtheRRFAdesiretoenterintothisAgreementforthepurposesofsettingforththeresponsibilitiesandrequirementsofthePartieswithregardtoDevelopmentofFireStation#15.NOW,THEREFORE,inconsiderationofthemutualpromisesherein,thePartiesagreeasfollows:AGREEMENTI.ADOPTIONOFRECITALSTheforegoingrecitalsareadoptedandincorporatedhereinastermsofthisAgreement.Il.SPECIFICTERMSOFTHISAGREEMENTA.Property.TheCityownsanundividedparcelcommonlyknownas1404N30th5,Renton,WA(the“Property”),aslegallydescribedinExhibitA,whichisattachedandincorporatedhereinbyreference.TheCitywillbeconstructingFireStation15onthesoutherlyportionoftheAGREEMENTCRIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page1of13AGENDA ITEM #8. d)
parcelandaCityownedwaterreservoirandrelatedutilityprojectonthenortherlyportionoftheparcel.PriortotransferofFireStation15totheRRFA,theCitywillcompleteasubdivisionofthepropertytoretainaportionofthepropertyforCitypurposesandtransfertotheRRFAonlythatportionofthepropertynecessarytosupportFireStation15.EasementswillbereservedtoallowtheRRFAandCitytoshareuseofaportionofthepropertyforcompatiblepurposes.B.Project-FireStation15.TheCitywillbeconstructingFireStation15onthesoutherlyportionoftheProperty(the“Project”)andaCityownedwaterreservoirandrelatedutilityprojectonthenortherlyportionoftheProperty.TheProjectwillbecompletedintwophases.ThefirstphaseoftheProjectwillincludeconstructionofthebuildingandthefrontdrivewaysufficienttoallowinitialoperationofFireStation15.Thefirstphasewillnotprovideaccesstoarearparkinglotorreargaragedoors.ThesecondphaseoftheProject,includingthepavingfortherearparkinglotcurbingandwestdriveway,RFFAparkinglotstriping,andassociatedlightingandlandscapingwillbecompletedinconjunctionwiththeCity’swaterutilityproject.ThecurrentSitePlanandSiteSequencingPlanfortheProjectisattachedandincorporatedhereinforreferencepurposesasExhibitB.Area1,aslabeledontheSiteSequencingPlan,willbedevelopedintheProject’sfirstphasebytheCity’sFacilitiesDivisionintheCommunityServicesDepartment.Area2,aslabeledontheSiteSequencingPlan,willbecompletedinthesecondphasebytheCity’sUtilitiesDivisionofthePublicWorksDepartmentinconjunctionwithitswaterreservoirproject.TheCityandRRFAcollaboratedinthedesignofFireStation15,includingtheSiteSequencingPlan.C.CityCosts.1.TheCitywillinitiallypaythecostsofdevelopingFireStation15,includingbutnotlimitedtoallplanning,site,groundwork,andbuildingcostsincludingsurvey,design,permit,constructionandanyassociatedactivitiesrequiredtobringthestationtooperationalstatusandsuchthatFireStation15andthesubdividedportionofthepropertymaybetransferredtotheRRFA’sownership(“DevelopmentCosts”).ThecontemplatedDevelopmentCostsincludebutarenotlimitedtothoseitemsdescribedintheattachedExhibitC,whichisincorporatedhereinbythisreference.CostsofdevelopingthesecondphaseoftheProject,constructedaspartoftheCity’swaterreservoirprojectasdescribedaboveandgenerallydepictedasoccurringinArea2intheSiteSequencingPlan,willnotcountasDevelopmentCosts,unlessotherwisespecifiedherein.AGREEMENTCL4RIFYINGTHEPARTIEsRESPONSIBILITIESFORDEvELoPINGFIRESTATION#1502-01-2018Page2of13AGENDA ITEM #8. d)
2.TheCity’sultimateresponsibilityforDevelopmentCostsshallnotexceedthesumof$5,671,809,includingapplicablesalestax(“City’sMaximumDevelopmentCosts”).AnyDevelopmentCostsexceedingtheCity’sMaximumDevelopmentCostsshallbereimbursedbytheRRFAassetforthherein.TheCityshallusereasonableeffortstoobtainRRFAinputpriortomakingdecisionsthatgenerateRRFACosts.IfthetotalDevelopmentCostsarelessthantheCity’sMaximumDevelopmentCosts,theCityshallretainsuchsavingsandtheCityhasnoobligationtosharethosesavingswiththeRRFA.3.TheRRFAshallhavetherighttoattendallregularlyscheduledconstructionmeetings.TheCityshallnotifytheRRFArepresentativebyemailofanynon-regularlyscheduledmeetingsatwhichchangestotheplansaretobediscussedsothatRRFApersonnelhaveanopportunitytoattendsuchmeetings.4.SeparatefromDevelopmentCosts,theCitywillpayuptoonemilliondollars($1,000,000),includingapplicablesalestax,tofurnishandequipFireStation15(“City’sMaximumFurnishingCosts”).TheCity’spaymentmaybethroughdirectpurchasesorreimbursementtotheRRFA.FurnishingsshallbeselectedorapprovedinwritinginadvancebytheRRFAandmayincludefurniture,fixtures,orotherequipmenttobeusedinFireStation15(“FF&E”).ThecontemplatedFF&ECostsincludebutarenotlimitedtothosedescribedintheattachedExhibitC.5.IfthetotalFF&EcostsarelessthantheCity’sMaximumFurnishingCosts,theCityshallremittheremainderofthe$1,000,000toRRFA.TheCitywillnotpayfororadvanceanyfurnishingcoststhatcumulativelyexceedtheCity’sMaximumFurnishingCosts.D.RRFACosts.1.Exceptforasotherwiseprovidedherein,theRRFAagreestopayfororreimbursetheCityforallDevelopmentCoststhatexceedtheCity’sMaximumDevelopmentCosts.ThisspecificallyincludesanyDevelopmentCoststhatariseoutofchangeordersorotherDevelopmentCoststhatmayhavebeenunexpectedorunplannedatthetimeFireStationwasdesignedorputoutforbid.AsDevelopmentCostsareincurredthatexceedtheCity’sMaximumDevelopmentCosts,theCitywillinvoicetheRRFAandtheRRFAwillpaysuchinvoiceswithin45daysofreceipt.2.TheRRFAissolelyresponsibleforallFF&EcoststhatexceedtheCity’sMaximumFurnishingCosts.E.SharedDevelopmentCosts1.Thecostofparkinglotlightfixturesthatwillbepurchasedaspartofthephase1CommunityServicesProjectandinstalledbythewaterutilityaspartofitsprojectshallbechargeableasDevelopmentCostsforpurposesofdeterminingtheCity’sMaximumAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page3of13AGENDA ITEM #8. d)
DevelopmentCosts.However,installationofsuchlightingshallnotbechargeableasDevelopmentCosts.2.AnycostsaddedtotheCitywaterutility’sreservoirprojectattherequestoftheRRFAorforthesolebenefitoftheRRFA,beyondthescopeoftheCity’sprojectsiteplansfortheprojectassetforthinattachedExhibitB,shallbepaidforbytheRRFA,within45daysofreceiptofinvoicefromtheCity,unlessotherwiseagreedbytheparties.E.PropertyTransferandOccupation.1.TheCitywilltransfertitletoFireStation15andtheunderlyingsubdividedpropertyonlyafterallCitycostsexceedingtheCity’sMaximumCostsarereimbursedandthepropertyhasbeensubdivided.2.UponcompletionofthefirstphaseoftheProject,theCityintendstoprovidetheRRFAatemporarylicensetooccupyFireStation15providedatemporaryoccupancypermithasbeenissuedandtheRRFAiscurrentonallreimbursementobligationsherein.TheRRFAwillberesponsibleforinsuringFireStation15andallcontentsthereinuponitbeinggivenalicensetooccupythestation.Duringthetemporarylicenseperiod,theRRFAwillnothaveaccesstoArea2intheSiteSequencingPlan.TheCitywillcoordinatewiththeRRFAtoprovideagreedtemporaryparkingsolutions,whichmayincludeaddingdedicatedon-streetparking,andmodifyingthepreviouslyapproveddevelopmentplanstodelayonsitelandscapingandconstructtemporaryparkinginplaceofsuchlandscaping.Costsincurredtoprovideagreedtemporaryparkingsolutionsandrestoration/installationoflandscapinginplaceoftemporaryparkingshallcounttowardstheCity’sMaximumCosts.Citywillpayforthecostofsuchagreedtemporaryparkingsolutionsupto,butnottoexceed,theCity’sMaximumDevelopmentCosts.3.TheCityintendstotransferownershipofFireStation15totheRRFAaftertheProjectandtheCity’scoordinatedwaterreservoirprojectiscompleteandthePropertyhasbeensubdivided.TransferofownershiptotheRRFAshallbebyquitclaimdeedwithnowarrantiesandwitheasementsreserved,orjointownershipagreementsnegotiated,asnecessarytosupporttheRRFAandCity’scontinuedcoordinatedjointuseofArea2,aslabeledintheSiteSequencingPlan.AsaconditionofpropertytransferandupontheRRFA’sacceptanceoftheproperty,theRRFAwillreleasetheCityfromallongoingliabilityandresponsibilitytoRRFAwithrespecttothedevelopmentofFireStation15ortheongoingmaintenancethereof.4.TheRRFAmaychoosetoobtainandpayforabuyers’titlepolicypriortoacceptingtransferoftheproperty.5.TheCityagreestocleantheexteriorofStation15attheconclusionofthePhase2attheCity’scost.AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page4of13AGENDA ITEM #8. d)
Ill.GENERALTERMSA.ThisAgreementmayonlybeamendedinwriting,andanyamendmentshallbecomeeffectiveonlywhenthegoverningbodyofeachpartyhasapprovedawrittenamendmentoraddendumtothisAgreement.B.ThisAgreementshallremainineffectuntilallprojectsarecomplete,thesubdivisionofthepropertyisfinalized,andtheCityhastransferownershipofFireStation15andpropertywitheasementstoRRFAwithfullRRFAreleasetotheCity,andtheRRFAhasfullypaidforanycostsdueandowingtotheCity.C.TimeisoftheessenceforeachandallofthisAgreement’sprovisionsinwhichperformanceisafactor.D.IfeitherpattyfailstoreimbursetheotherpartybythetimerequiredinthisAgreement,interestontheoverdueamountsshallaccrueandbepaidatarateof2.5%perannum.E.Eachpartyagreestocomplywithalllocal,federal,andstatelaws,rules,andregulationsthatarenoweffectiveorinthefuturebecomeapplicabletothisAgreement.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.Nolawsuitmaybefileduntilthecomplainingprovidesnolessthan60dayswrittennoticeofitsintenttofilealawsuitandonlyafterattemptingingoodfaithtonegotiatearesolutionandallowtheotherpartytocuretheperceiveddefauIt.F.ThefailureofeitherpartytoinsistuponstrictperformanceofanyofthecovenantsandagreementscontainedinthisAgreement,ortoexerciseanyoptionconferredbythisAgreementinoneormoreinstancesshallnotbeconstruedtobeawaiverorrelinquishmentofthosecovenants,agreements,oroptions,andthesameshallbeandremaininfullforceandeffect.G.IfanysectionofthisAgreementisadjudicatedtobeinvalid,suchactionshallnotaffectthevalidityofanysectionnotsoadjudicated.H.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.AGREEMENTCIRIFvINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page5of13AGENDA ITEM #8. d)
IV.INDEMNIFICATIONANDHOLDHARMLESS/INSURANCEA.Eachpartyagreestodefend,indemnify,andholdharmlesstheotherpartyandeachofitsemployees,officials,agents,andvolunteersfromanyandalllosses,claims,liabilities,lawsuits,orlegaljudgmentsarisingoutofitsbreachofthis’Agreementoranynegligentorwillfullytortiousactionsorinactionsbytheperformingpartyoranyofitsemployees,officials,agents,orvolunteers,whileactingwithinthescopeofthedutiesrequiredbythisAgreement.ThisprovisionshallsurvivetheexpirationofthisAgreement.ThisprovisionshallalsosurviveandremainineffectintheeventthatacourtorotherentitywithjurisdictiondeterminesthatthisAgreementoranyportionthereofisnotenforceable.B.Itisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedhereinconstituteseachparty’swaiverofimmunityunderindustrialinsurance,Title51RCW,solelytocarryoutthepurposesofthisindemnificationclause.Thepartiesfurtheracknowledgethattheyhavemutuallynegotiatedthiswaiver.C.Insurance.Eachpartyshallcarryandmaintaininsurancecoverageasdescribedbelow.CoveragesshallbewrittenwithaninsurancecarrieradmittedintheStateofWashington.General.Automobile,andDirector&OfficerLiabilityInsurance:Coveragefordamagescausedresultinginpersonalinjury,propertydamageoradvertisingliabilityshallbeprovided.Coverageshallbeinanamountnotlessthanfivemilliondollars($5,000,000)perOccurrence.Theinsurancepoliciesofeachpartyshallnametheotherpartyanditsofficials,officers,employees,andvolunteers,whoareactingwithinthescopeofthisAgreementasadditionalinsuredsforanyandallactionstakenbyeachparty,itsofficials,officers,employees,andvolunteersinthescopeoftheirdutiespursuanttothisAgreement.V.NOTICEAllcommunications,includingnotices,regardingthisAgreementshallbesenttotheParties’representativesattheaddresseslistedbelow:TheCity’srepresentativeshallbeandnoticesshallbesentto:RobertHarrison,ChiefAdministrativeOfficer1055GradyAvenueSouthRenton,WA98057425.430.6500TheRRFA’srepresentativeshallbeandnoticesshallbesentto:FireChief24611116thAveSE.AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page6of13AGENDA ITEM #8. d)
Renton,WA98030425.430.7000Anywrittennoticeshallbecomeeffectiveupon(a)personalserviceor(b)three(3)businessdaysafterthedateofmailingbyregisteredorcertifiedmailandfirst-classmail,andshallbedeemedsufficientlygivenifsenttotheaddressstatedinthisAgreement,ortosuchotheraddressasmaybespecifiedinwritingbyaparty.Eitherpartymaychangeitsrepresentativesbynotifyingtheotherinwriting.XII.ENTIREAGREEMENTThePartiesagreethatthisAgreementisthecompleteexpressionofthetermsheretoandanyoralrepresentationsorunderstandingsnotincorporatedhereinareexcluded.BothPartiesrecognizethattimeisoftheessenceintheperformanceoftheprovisionsofthisAgreement.Waiverofanydefaultshallnotbedeemedtobeawaiverofanysubsequentdefault.XIII.COUNTERPARTSThisAgreementmaybeexecutedinoneormorecounterparts,eachofwhichshallbedeemedanoriginal,butallofwhichtogethershallconstituteoneandthesameinstrument.INWITNESS,thePartiesbelowexecutethisAgreement,whichshallbecomeeffectiveonthelastdateenteredbelow.RENTONREGIONALFIREAUTHORITYBy:Its:FireChiefDated:APPROVEDASTOFORM:BrianSnureAttorneyforRRFAAGREEMENTCLARIFYINGTHEPARTIESRESPoNSIBILITIEsFORDEvELoPINGFIRESTATION#1502-01-2018Page7of13AGENDA ITEM #8. d)
CITYOFRENTONBy:DenisLawIts:MayorDated:_________AttestJasonSethRentonCityClerkAPPROVEDASTOFORM:ShaneMoloney,CityAttorneyAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page8Of13AGENDA ITEM #8. d)
EXHIBITALEGALDESCRIPTION(OFENTIREPROPERTY)TRACT38OFHILLMAN’SLAKEWASHINGTONGARDENOFEDENADDITIONTOSEATTLENO.1,ACCORDINGTOTHEPLATTHEREOFRECORDEDINVOLUME11OFPLATS,PAGE63,RECORDSOFKINGCOUNTY,WASHINGTON;EXCEPTTHEEAST100FEETTHEREOF;SITUATEINTHECITYOFRENTON,COUNTYOFKING,STATEOFWASHINGTONKingCountyAssessor’sTaxParcelNo.3342103245AGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page9of13AGENDA ITEM #8. d)
EXHIBITB1.Constructionlimits,spotelevations,gradesandsiteutilitiesindicatedforreferenceonlySeeCivildrawings2.Pavingindicatedforreferenceonly.SeeCivilandLandscapedrawings.3.RefertoCivildrawingsforpavementscoringpattems&requirements.ProvideexpansionandcontroljointsperCivilplans4.Landscapingindicatedforreferenceonly.SeeLandscapedrawings.5.Electricalsiteutilitiesdescribedforreferenceonly.SeeElectricaldrawings.6.ComplywithCilyofRentonrequirementsforallWorkinROW.7.Provideconstructionfenceatlimitsofconstructiontosecuresite.Minimumfenceheightshallbesicfeet.Providegatesasnecessary.6.FieldverifyallrelevantexistingconditionsanddimensionspriortothestartofWorfc.NotifyArchitectimmediatelyofanydiscrepancies.9.ProtectallexistingconditionstoremainonsiteandadjacenttoWorkarea.NotifyArchitectofanydamagetoexistingcondtionstoremainandrestoreorreplacetooriginalcondition10.ConfirmallundergroundutilitylocationspriortothestartofWorkandprotectallexistingconditionstoremain.11.Confirmlocationsofadjacentoverheadutilitesandprotectallexistingconditionstoremain.12.Coordinatesequencingwithdrawingsfromalltrades.AllworkshowninArea1isinthecontractRefertoeachtradeforworkinArea2thatisinthecontract.NoworkinArea3isinthecontract.RESERVOIRIL3IEOEHETLPE0CLTE‘FivEFiOHTRpeoprnnPruriNo1Lil.5TOP—I‘A1C2,•r”mA’,PARCEL,iiFiRE/ryEAlTl.Cl—‘3342103245TruvIZONE:CNI-‘.Ai6T.IENCLCVSVEII‘CIR1NlI.sIvrvovwsa)‘rnEpiGxInp,—‘vourvvsov.1Esrn,,j,_..•/II/(Frvnn.jurovwsnsnTve’—,“JI/iAM1U.J:LiNEiZANE‘El//,————NIIrvrv.SEE3-.covcvrrrwNiNTEsvNcrCIViLAl02.uneiPvsEviLsisoIrrvivoorn.norCIVIL————BFIRESTATION15—vrwrovcrCovCvErEI—FrELEVATIA5212e=e-n’‘4pvoprvnyovennsr-ILINEAITINiELECTRICALMETERI••PvTIOvEEELECT-,I\0-0CONCRETELOCATEEUILEINOAT/PAD.SEECIVIL‘IAvIDivnrvsrCniovIir—-FENCEI..-A102O7OEECIAIL——,IN/ACCESS—SASMETER.—L6.SEEiS/A102—_i_.rvvvoo—souIEISSLSE_________tt;E11/=_j______/EDERACK57-----iE4voAownErmoNSlOELXwvroevnrcen-—“I____________FIREHASRANTr:/--WlCSRARRANATSOATH-SPAIN.PROPERTYLI5ESEECIVILROWCL0NORTH30THSTREETCientPmjectNn:CAC-17-046SiteSequencingPlanNFKjiJSoals:l”=20’-O’1SitePlanNAl.0lSCab1’=20-0’SSWArchfteots17001PlsleofNoDateDecnmber22,2017A1.O1Inn,-113/4’SiteNoteslW-II3/4”111ARCHITECTSSCHREIBERSTARLINGWHITEHEAD901FIFTHAVEA3l0OSEATTLE,WA90164206-602-0300SSWARCHITECTS(OHi=-.SitePlanLegend4199SJSflDOJIhwonian—.—PROPERTYLINEE.EXISTINGTOPOLINES-SEESURVEYUTILITIES-SEECIVILNON-PERMEABLECONCRETEPAVING-SEECIVILFPERMEABLECONCRETEPAVING-SEECIVILFJASPHALTPAVING-SEECIVILSiteSequencingPlanLegendAREASEPARATIONLINESAREA1:FIRESTATION15AREAOFWORKAREA2:WORKSCOPESHAREDBETWEENFIRESTATION15&RESERVOIRAREA3:(NIC)RESERVOIRPROJECT1-NORTH30THSTREET:.Wi.FireStation15ContractDocumentsSitePlansAGENDA ITEM #8. d)
EXHIBITC1.ExamplesofDevelopmentCostsAttributabletowardstheCity’sMaximumDevelopmentCosts($5,671,809total)ProfessionalServices:ArchitectCivilEngineerLandscapeArchitectCostEstimatingSignageCommissioningMiscellaneous:LandUsePermittingMeetingsandPresentationsConstructionAdministrationSiteStructuralGeotechnica)RecordDrawingsReimbursableExpensesTestingandInspectionsOtherDevelopmentCosts:ConstructionHVACandotherfixturesnecessarytooperatebuildingProjectManagement(includingCitystaffassignedtoproject)PublicArtPermits,BuildingPermits,CivilPlanCheckPrintingInstalledSignageProjectredesignandconstructionrelatedtoaccommodationoftemporaryparkingduringPhase2Miscellaneousinstalleditems:DishwasherRangeHoodRangeCompressorFireExtinguishersFireExtinguisherCabinetsAGREEMENTCLARIFYINGTHEPARTIESRESPONSIBILITIESFORDEvELoPINGFIRESTATION#15O2-O12O18Page110113AGENDA ITEM #8. d)
GarbageDisposalHoseReelsMarkerboardsRollerShadesSoapDispensersTackboardsWaterHeaterWallMirrorParkinglotlightfixtures2.ExamplesofFF&E:($1,000,000total)Furniture:TablesChairsCouchesBeds/rnattressesDressersTelevisionsLampsAppliances:Washingmachine/dryerRefrigeratorMicrowaveDryerCabinet,GearExtractorFireproofCabinetHoseDryingRackPull-UpBarSoapContainerIThardwarethatisnotfixedtothebuilding:*ComputersMonitorsPrintersTelephonesRacksServersSwitchesAlertingAGREEMENTCRIFvINGTHEPARTIESRESPONSIBILITIESFORDEVELOPINGFIRESTATION#1502-01-2018Page12of13AGENDA ITEM #8. d)
*Note:ITServicesforRRFAarecurrentlycoveredunderILACAG-16-116betweentheCityandtheRRFA,Exhibit2,section4.b.“UniqueSupportServiceRequests”andsection5.“AdditionalStaffServiceCost.”litheRRFAisgoingtorequireITservicesandsupportforFS15therewillbeadditionalsupportandservicescoststhatwillneedtobeaddressedinILACAG-16-116andnotaspartofthe“project”costassociatedwiththisagreement.Fitnessequipmentincludinganycostsassociatedwithdedicatedcircuitelectricalrequirements.AEDequipmentforthefacility.Smoke&carbonmonoxidedetectors.FireEngine/truck.AGREEMENTCRIFvINGTHEPARTIESREsPoNsIBILITIEsFORDEVELOPINGFIRESTATION#1502-01-2018Page13of13AGENDA ITEM #8. d)
AB - 2201
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Ratification of the Second Addendum to the Indemnification
Agreement CAG-18-150 with The Boeing Company for Occupation of a
Portion of the Renton Municipal Airport’s Taxiway “B”
RECOMMENDED ACTION: Council Concur
DEPARTMENT: Public Works Administration
STAFF CONTACT: Gregg Zimmerman, Public Works Department Administrator
EXT.: 7311
FISCAL IMPACT SUMMARY:
Approval of the Second Addendum to the Indemnification Agreement CAG-18-150 with The Boeing Company
has no fiscal impact. Should Boeing exercise the portion of the Second Addendum permitting expanded
operating hours of the Airport tower, Boeing will reimburse the city and Federal Aviation Administration (FAA)
for any costs incurred to extend the tower’s operating hours.
SUMMARY OF ACTION:
On August 6, 2018 Council ratified the City's Indemnification Agreement CAG -18-150 and the First Addendum
to the agreement with The Boeing Company. The agreement allows Boeing to occupy a portion of the Renton
Municipal Airport’s Taxiway “B” for airplane storage for up to 90 days. The First Addendum to the agreement
outlines parameters to allow Boeing personnel to provide appropriate security on Taxiway “B” at times during
which airplanes are stored on the taxiway.
After entry into the agreement and first addendum, the parties identified and negotiated additional terms to
facilitate administration of the agreement. Subject to objection by the FAA or air traffic control, the attached
Second Addendum to the Indemnification Agreement authorizes Boeing’s 737 airplanes to depart from the
Airport without the need or requirement to move its parked airplanes.
The Second Addendum establishes additional criteria regarding the temporary closure and utilization by
Boeing of a portion of Taxiway “B.” Key provisions of the Second Addendum include:
1. Substitution of Exhibit A with Exhibit A-1, providing an updated layout of the affected area and parking
positions.
2. Detailed criteria for departures and arrivals of Boeing and other aircraft while airplanes are parked on
the taxiway.
3. Acknowledgment of potential closure of the runway to aircraft with a wingspan exceeding 79 feet or
approach speeds greater than 120 knots when the Airport tower is not staffed.
4. The city will provide Boeing at least 115 minutes notice that tenants or transient operators will depart
or land aircraft with a wingspan exceeding 79 feet or approach speeds greater than 120 knots. Boeing
will move parked aircraft and equipment outside of the runway object free area before departure or
landing of the aircraft.
AGENDA ITEM #8. e)
5. Boeing will install steel plates under 737 airplanes parked on the taxiway to minimize or avoid damage
to the asphalt, and the parties will exchange pre-use assessments of the pavement's condition to
assure Boeing pays for any damage arising out of its use.
6. Boeing will participate in one or more public open house meetings for airport tenants, subtenants and
anyone with an Airport interest to discuss the Taxiway “B” closure. Boeing will coordinate with the City
through a formal complaint process to accommodate other airport users that are affected by the
taxiway closure.
The Addendum also provides that if the FAA recommends or requires the hours of the air traffic control tower
to be expanded as a result of the taxiway closure, Boeing will pa y the costs of the extended hours.
EXHIBITS:
A. Second Addendum to Indemnification Agreement CAG-18-150
B. Layout of Airport with Taxiway Parking and B1s (Labeled as Exhibit A -1)
STAFF RECOMMENDATION:
Ratify the Second Addendum to the Indemnification Agreement CAG-18-150 with The Boeing Company.
AGENDA ITEM #8. e)
SECONDADDENDUMTOINDEMNIFICATIONAGREEMENTTHISSECONDADDENDUM(‘Addendum’),madeonthelastdatewrittenbelow,amendstheIndemnificationAgreementmadebyandbetweenTheBoeingCompany,aDelawarecorporation(‘Boeing),andCityofRenton,aWashingtonmunicipalcorporation(“Renton”),datedJuly27,2018(asamendedbytheFirstAddendum,the‘Agreement”).Forandinconsiderationofthemutualbenefitstobederivedandothervaluableconsiderationthesufficiencyofwhichisherebyacknowledged,thepartiesherebyagreeasfollows.1.ExhibitAtotheAgreementshallbereplacedwithExhibitA-I,attachedandincorporatedbythisreference.2.TheAgreement’sdefinitionofthe“Property”isherebyamendedtomeanthatportionofTaxiway“B”locatedattheRentonMunicipalAirportdepictedinExhibitA-i.3.SubjecttoobjectionbytheFAAortheFAAcontractedAirporttowerpersonnel,BoeingaircraftareauthorizedtodepartfromtheAirportwithouttheneedorrequirementforBoeingtomoveanyofits737aircraftparkedwithintheRunwayObjectFreeAreaontheProperty.BoeingacknowledgesthattheAirporttowermaynotformally“clear”BoeingaircraftfortakeoffundersuchconditionsandthatBoeinganditspilotswilldeparttheAirportattheirownrisk.NotwithstandingtheexpectationthatBoeingaircraftmaydeparttheAirportwhileitsownafrcraftareparkedwithintheRunwayObjectFreeAreaatitsonrisk,pilotsofBoeingaircraft)illcommunicatewiththetowerandfollowallinstructionsand1ordersissuedbyAirporttowerand/orAirportmanagement.4.BoeingunderstandsthatRentonmayclosetheAirportrunwaytoaircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots,includingBoeingaircraft,duringhoursinwhichtheAirporttowerisnotstaffed.IftheFAArequiresorrecommendsexpandedtowerhoursinordertoavoidorminimizerunwayclosurestoaircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots,Boeingagreestocontractwiththetowermanagementcompany(SercoInc.)topaythecostofsuchexpandedoperationand/orreimbursetheCityandFAAforanycoststhoseentitiesincurtoextendthetower’soperatinghours.5.BoeingwillmoveallofitsaircraftandotherpropertyandequipmentparkedonthePropertyoutoftheRunwayObjectFreeAreapriortoitlandingBoeing737sorotheraircraftwithawingspanexceeding79feetoranapproachspeedgreaterthan120knots.6.RentonwillprovideBoeingatleast115minutes’noticethattenantsortransientoperatorswilldepartorlandaircraftwithawingspanlargerthan79feetoranapproachspeedgreaterthan120knotsattheAirport.BoeingwillprovideRentonadesignatedmonitoredphonenumbertoprovidesuchnotificationswithaworkingvoicemailforRentontoleaveamessageifthephoneisnotanswered.Renton’sleavingsuchmessageormakingdirectcontactwithBoeingpersonnelwhoanswerthatnumberwillinitiatethenoticeperiod.Boeingwill,withinthenoticeperiod,temporarilyremoveitsparkedaircraftandotherpropertyoutofthe400footRunwayObjectRentonMunicipalAirport-TheBoeingCompany-SecondAddendumtoIndemnIficationAgreement—Page1AGENDA ITEM #8. e)
FreeAreatoaccommodatesuchtenantsortransientoperators.BoeingunderstandsthatitsfailuretotimelymoveitsaircraftoutoftheRunwayObjectFreeAreamaydelayorpreventaircraftfromdepartingorarrivingandcreateahazardforenrouteaircraft.Accordingly,intheeventofBoeing’sfailuretotimelyremoveparkedaircraft,Boeing’srighttoparkaircraftonthePropertyshallbeimmediatelysuspendeduntilBoeinghasassuredRentonthefailurewillnotberepeatedandRentongiveswrittenauthorizationtoBoeingforittoresumeparkingaircraftontheProperty.7.Paragraph1(d)oftheAgreementisamendedtoreadasfollows:“Boeingagreestotemporarilyinstallsteelplatesunder737aircraftparkedontheProperty,inorderminimizeimpactstothetaxiwaysurface.BoeingshallnotmakeanyotherimprovementsoralterationstothePropertywithoutwrittenauthorizationfromRenton.Priortoinstallingsuchplates,BoeingshallchalkofftheareasaircraftwillbeparkedandallowRentonanopportunitytoinspecttheconditionoftheexistingpavementconditions.BoeingandRentonshalleachprovidetotheotheracopyofallinformationeachhasorobtainsabouttheProperty’spavementconditions.BoeingshallholdRentonandthePropertyharmlessfromandagainstanyliensofcontractors,subcontractors,orotherpersonssupplyinggoods,services,equipment,materials,orlabortooronbehalfofBoeingattheProperty.AttherequestofRenton,Boeingshalldischargeanysuchliens.”8.Paragraph2oftheFirstAddendumtotheAgreementisamendedtoreadasfollows:“BoeingacknowledesthatanypersonsonthePropertymaybewithintheRunwayObjectFreeAreaandwhatwoulcotherwisebeadesignatedmovementareaifthetaxiwaywaslnotclosed.Accordingly,allpersonnelandoperatorsofnon-pilotedvehiclesshallmonitortheairtrafficcontrolgroundcontrolfrequencyandremainwithinanybarriersmarkingtheclosedareaofthetaxiway.AnypilotorotherpersonnelwishingtoexittheclosedareaofthetaxiwayandenteranactivemovementareaoftheAirportshallcoordinatewithairtrafficcontrolandmonitorradioforairtraffic.Boeingshalltrainandcontrolallpersonnelandvehiclestocomplywiththerequirementsofthisparagraph.9.Boeingwillparticipateinoneormorepublicopen-housemeetingsforAirporttenants,subtenants,transientoperators,andanyonewithanAirportinterest,tobeco-hostedbytheCityofRenton,Boeing,andtheAirporttowertodiscussAirportTaxiwayBclosure.Rentonwillcreateaformalcomplaintsubmittalprocess.RentonmaytenderanycomplaintsreceivedtoBoeing,atRenton’ssolediscretion.BoeingwillprovideawritteninitialresponsetoRentonwithinonebusinessdayofreceiptofeachtenderedcomplaintwithanestimateofwhenaformalresponsewillbeprovided;BoeingwillprovideawrittenformalresponsetoRentonwithin10daysofreceiptofeachtenderedcomplaint.Inadditiontoprovidingaresponse,BoeingwillreasonablyandexpedientlyaccommodatelegitimateconcernsraisedineachtenderedcomplainttotheextentsuchcomplaintsarisefromBoeing’suseoftheProperty.BoeingwillprovideaplantoRentonforeachplannedaccommodationandwillnotifyRentonifBoeingdeclinestoaccommodateonthebasisthataccommodationwouldnotbereasonableorthattheconcernisnotlegitimateorboth.TheprovisionsofthisparagraphareintendedtosupplementtheindemnificationprovisionsoftheAgreementandshallnotbeconstruedtolimitRentonMurncipalAirport-TheBoeingCompany.SecondAddendumtondemnfcationAgreement—Page2AGENDA ITEM #8. e)
inanywaysuchindemnificationprovisions.10.BoeingshallpaytoRentontheleaseholdexcisetaxasestablishedbyRCWchapter82.29A,asamended,oranyreplacementthereof,whichtaxshallbeinadditiontothemonthlyfeesetforthinSection3oftheAgreementandotherchargespayableundertheAgreementandshallbepaidatthesametimethemonthlyfeeisdue.IftheStateofWashingtonoranyothergovernmentalauthorityhavingjurisdictionthereovershallhereafterlevyorimposeanysimilartaxorchargeonthisAgreementortheProperty,thenBoeingshallpaysuchtaxorchargewhendue.SuchtaxorchargeshallbeinadditiontothemonthlyfeeandotherchargespayableundertheAgreement.AsmodifiedbythisAddendum,theAgreementcontinuesinfullforceandeffect.ThisAddendumisexecutedbyBoeingandRentonasofthedateswrittenbelow.TheBoeingCompanyCityofRentonBy:_______________By:___________________________JeffreyNunnDenisLawItsDirectorofPlanning&ealEstateItsMayorDateSigned:/iô)iSDateSigned:____________________Attest:__________________________________JasonSeth,CityClerkApprovedastoForm:____________________ShaneMoloney,CityAttorneyRentonMuncipoIAirport-ToeBoeingcompanySecondAddendumtoIndemnificationAgreement—Page3AGENDA ITEM #8. e)
inanywaysuchindemnificationprovisions.10.BoeingshallpaytoRentontheleaseholdexcisetaxasestablishedbyRCWchapter82.29A,asamended,oranyreplacementthereof,whichtaxshallbeinadditiontothemonthlyfeesetforthInSection3oftheAgreementandotherchargespayableundertheAgreementandshallbepaidatthesametimethemonthlyfeeIsdue.IftheStateofWashingtonoranyothergovernmentalauthorityhavingjurisdictionthereovershallhereafterlevyorimposeanysimilartaxorchargeonthisAgreementortheProperty,thenBoeingshallpaysuchtaxorchargewhendue.SuchtaxorchargeshallbeinadditiontothemonthlyfeeandotherchargespayableundertheAgreement.AsmodifiedbythisAddendum,theAgreementcontinuesInfuilforceandeffect.ThisAddendumIsexecutedbyBoeingandRentonasofthedateswrittenbelow.TheBoeingCompanyCityaRenonBy:_________________By:JeffreyNunnDenisLawItsDirectorofPlanning&RealEstateItsMayorDateSigned:_____________DateSigned:_________________Attest:sonSeth,CityClerkApprovedastoForm:ShaneMoloney,CityAttorneyReritonMunIcipiAirport-TheBoeingCompany.SecondAddendumtoIndemnificationAgreement—Page3AGENDA ITEM #8. e)
Supply Chain &Operations Facilities &Asset Management
Proposed Process:Exhibit A-i
Layout of Airport wI Taxiway Parking &BI ‘s
Taxiway Barrier
____
I Taxiway B limited to fourTaxiwayParkingPositionI1TaxiwayFireLaneparkingpositions,to
I I Runway Area support clearing taxiway
Standard Parking Position
_____
within two hours
I I Hold Short Line (Includes Solid Red Line)
--
—-v-’-__
__
4•_A
--A A
-
‘/TiAA
_—
-
-
D —
-‘—r .--
Data Owner
Data as of 0811012018Copyntht‘Rong AI ights t1 AGENDA ITEM #8. e)
AB - 2196
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Agreement with Northwest Hydraulic Consultants, Inc. for the Annual
Cedar River Sediment Survey and Analysis
RECOMMENDED ACTION: Refer to Utilities Committee
DEPARTMENT: Utility Systems Division
STAFF CONTACT: Joseph Farah, Surface Water Utility Engineer
EXT.: 7205
FISCAL IMPACT SUMMARY:
The Cedar River Gravel Removal Project and all subsequent post-dredging mitigation, monitoring and
reporting work, including sediment surveying and monitoring, are entirely funded by the King County Flood
Control District Capital Improvement Project budget ($13,171,131) per CAG-13-009 Addendum #1-16. The
adjusted 2018 project budget is $3,197,816. There is sufficient funding in the 2018 Surfac e Water Utility
Capital Improvement Program budget (427.475193) for the agreement.
SUMMARY OF ACTION:
In 2016, the Surface Water Utility completed maintenance dredging of the lower 1.25 miles of the Cedar River,
from the mouth at Lake Washington to the Williams Avenue South bridge. Ongoing sediment deposition along
the lower river gradually reduces conveyance capacity and reduces flood protection over time. As part of the
city’s agreement with the U.S. Army Corps of Engineers (following construction of t he levees and floodwalls
and the initial dredging project in 1998) the city is responsible for monitoring sediment levels in order to:
• Understand and characterize deposition rates throughout a dredging cycle.
• Evaluate how close the river bed is getting to the “maximum bed profile,” and if reached, would
require a new maintenance dredge project.
• Determine the flow based upon which Boeing would need to raise the South Boeing Bridge. This flow is
updated annually and a new rating curve is established and sent to Boeing.
The Surface Water Utility evaluated the statements of qualifications of 10 consultant firms on the Municipal
Research and Services Center (MRSC) roster that offered services in basin modeling hydrology and hydraulics,
sediment investigation and analysis and stream sediment and substrate analyses. Northwest Hydraulic
Consultants, Inc. scored the highest and was selected to perform the sediment survey and analysis from 2018
to 2022.
EXHIBITS:
A. Agreement
STAFF RECOMMENDATION:
Execute the agreement with Northwest Hydraulic Consultants, Inc. in the amount of $132,377 for the Annual
Cedar River Sediment Survey and Analysis.
AGENDA ITEM #8. f)
THISAGREEMENT,datedJuly27,2018,isbyandbetweentheCityofRenton(the“City”),aWashingtonmunicipalcorporation,andNorthwestHydraulicConsultants(“Consultant”),aWashingtoncorporation.TheCityandtheConsultantarereferredtocollectivelyinthisAgreementasthe“Parties.”OncefullyexecutedbytheParties,thisAgreementiseffectiveasofthelastdatesignedbybothparties.1.ScopeofWork:Consultantagreestoprovidesurveying,hydraulicmodeling,andreportingasspecifiedinExhibitA,whichisattachedandincorporatedhereinandmayhereinafterbereferredtoasthe“Work.”2.ChangesinScopeofWork:TheCity,withoutinvalidatingthisAgreement,mayorderchangestotheWorkconsistingofadditions,deletionsormodifications.AnysuchchangestotheWorkshallbeorderedbytheCityinwritingandtheCompensationshallbeequitablyadjustedconsistentwiththeratessetforthinExhibitBorasotherwisemutuallyagreedbytheParties.3.TimeofPerformance:ConsultantshallcommenceperformanceoftheAgreementpursuanttotheschedule(s)setforthinExhibitC.AllWorkshallbeperformedbynolaterthanMarch31,2023.4.Compensation:A.Amount.TotalcompensationtoConsultantforWorkprovidedpursuanttothisAgreementshallnotexceed$132,377,plusanyapplicablestateandlocalsalestaxes.CompensationshallbepaidbaseduponWorkactuallyperformedaccordingtotherate(s)oramountsspecifiedinExhibitB.TheConsultantagreesthatanyhourlyorflatratechargedbyitforitsWorkshallremainlockedatthenegotiatedrate(s)unlessotherwiseagreedtoinwritingorprovidedinExhibitB.Exceptasspecificallyprovidedherein,theConsultantshallbesolelyresponsibleforpaymentofanytaxesimposedasaresultoftheperformanceandpaymentofthisAgreement.B.MethodofPayment.OnamonthlyornolessthanquarterlybasisduringanyquarterinwhichWorkisperformed,theConsultantshallsubmitavoucherorinvoiceinaformspecifiedbytheCity,includingadescriptionofwhatWorkhasbeenAGREEMENTFORANNUALCEDARRIVERSEDIMENTSURVEYANDANALYSISAGENDA ITEM #8. f)
performed,thenameofthepersonnelperformingsuchWork,andanyhourlylaborchargerateforsuchpersonnel.TheConsultantshallalsosubmitafinalbilluponcompletionofallWork.PaymentshallbemadebytheCityforWorkperformedwithinthirty(30)calendardaysafterreceiptandapprovalbytheappropriateCityrepresentativeofthevoucherorinvoice.IftheConsultant’sperformancedoesnotmeettherequirementsofthisAgreement,theConsultantwillcorrectormodifyitsperformancetocomplywiththeAgreement.TheCitymaywithholdpaymentforworkthatdoesnotmeettherequirementsofthisAgreement.C.EffectofPayment.PaymentforanypartoftheWorkshallnotconstituteawaiverbytheCityofanyremediesitmayhaveagainsttheConsultantforfailureoftheConsultanttoperformtheWorkorforanybreachofthisAgreementbytheConsultant.D.Non-AppropriationofFunds.IfsufficientfundsarenotappropriatedorallocatedforpaymentunderthisAgreementforanyfuturefiscalperiod,theCityshallnotbeobligatedtomakepaymentsforWorkoramountsincurredaftertheendofthecurrentfiscalperiod,andthisAgreementwillterminateuponthecompletionofallremainingWorkforwhichfundsareallocated.NopenaltyorexpenseshallaccruetotheCityintheeventthisprovisionapplies.5.Termination:A.TheCityreservestherighttoterminatethisAgreementatanytime,withorwithoutcausebygivingten(10)calendardays’noticetotheConsultantinwriting.Intheeventofsuchterminationorsuspension,allfinishedorunfinisheddocuments,data,studies,worksheets,modelsandreports,orothermaterialpreparedbytheConsultantpursuanttothisAgreementshallbesubmittedtotheCity,ifanyarerequiredaspartoftheWork.B.IntheeventthisAgreementisterminatedbytheCity,theConsultantshallbeentitledtopaymentforallhoursworkedtotheeffectivedateoftermination,lessallpaymentspreviouslymade.IftheAgreementisterminatedbytheCityafterpartialperformanceofWorkforwhichtheagreedcompensationisafixedfee,theCityshallpaytheConsultantanequitableshareofthefixedfee.ThisprovisionshallnotpreventtheCityfromseekinganylegalremediesitmayhavefortheviolationornonperformanceofanyoftheprovisionsofthisAgreementandsuchchargesduetotheCityshallbedeductedfromthefinalpaymentduetheConsultant.NopaymentshallbemadebytheCityforanyexpensesincurredorworkdonefollowingtheeffectivedateofterminationunlessauthorizedinadvanceinwritingbytheCity.6.WarrantiesAndRightToUseWorkProduct:ConsultantrepresentsandwarrantsthatConsultantwillperformallWorkidentifiedinthisAgreementinaprofessionaland0PAGE2OF10AGENDA ITEM #8. f)
workmanlikemannerandinaccordancewithallreasonableandprofessionalstandardsandlaws.Compliancewithprofessionalstandardsincludes,asapplicable,performingtheWorkincompliancewithapplicableCitystandardsorguidelines(e.g.designcriteriaandStandardPlansforRoad,BridgeandMunicipalConstruction).Professionalengineersshallcertifyengineeringplans,specifications,plats,andreports,asapplicable,pursuanttoRCW18.43.070.ConsultantfurtherrepresentsandwarrantsthatallfinalworkproductcreatedforanddeliveredtotheCitypursuanttothisAgreementshallbetheoriginalworkoftheConsultantandfreefromanyintellectualpropertyencumbrancewhichwouldrestricttheCityfromusingtheworkproduct.ConsultantgrantstotheCityanon-exclusive,perpetualrightandlicensetouse,reproduce,distribute,adapt,modify,anddisplayallfinalworkproductproducedpursuanttothisAgreement.TheCity’sorother’sadaptation,modificationoruseofthefinalworkproductsotherthanforthepurposesofthisAgreementshallbewithoutliabilitytotheConsultant.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.7.RecordMaintenance:TheConsultantshallmaintainaccountsandrecords,whichproperlyreflectalldirectandindirectcostsexpendedandWorkprovidedintheperformanceofthisAgreementandretainsuchrecordsforaslongasmayberequiredbyapplicableWashingtonStaterecordsretentionlaws,butinanyeventnolessthansixyearsaftertheterminationofthisAgreement.TheConsultantagreestoprovideaccesstoandcopiesofanyrecordsrelatedtothisAgreementasrequiredbytheCitytoauditexpendituresandchargesand/ortocomplywiththeWashingtonStatePublicRecordsAct(Chapter42.56RCW).TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.8.PublicRecordsCompliance:TothefullextenttheCitydeterminesnecessarytocomplywiththeWashingtonStatePublicRecordsAct,ConsultantshallmakeaduediligentsearchofallrecordsinitspossessionorcontrolrelatingtothisAgreementandtheWork,including,butnotlimitedto,e-mail,correspondence,notes,savedtelephonemessages,recordings,photos,ordrawingsandprovidethemtotheCityforproduction.IntheeventConsultantbelievessaidrecordsneedtobeprotectedfromdisclosure,itmay,atConsultant’sownexpense,seekjudicialprotection.Consultantshallindemnify,defend,andholdharmlesstheCityforallcosts,includingattorneys’fees,attendanttoanyclaimorlitigationrelatedtoaPublicRecordsActrequestforwhichConsultanthasresponsiverecordsandforwhichConsultanthaswithheldrecordsorinformationcontainedtherein,ornotprovidedthemtotheCityinatimelymanner.ConsultantshallproducefordistributionanyandallrecordsresponsivetothePublicRecordsActrequestinatimelymanner,unlessthoserecordsareprotectedbycourtorder.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.9.IndependentContractorRelationship:0PAGE3OF10AGENDA ITEM #8. f)
A.TheConsultantisretainedbytheCityonlyforthepurposesandtotheextentsetforthinthisAgreement.ThenatureoftherelationshipbetweentheConsultantandtheCityduringtheperiodoftheWorkshallbethatofanindependentcontractor,notemployee.TheConsultant,nottheCity,shallhavethepowertocontrolanddirectthedetails,mannerormeansofWork.Specifically,butnotbymeansoflimitation,theConsultantshallhavenoobligationtoworkanyparticularhoursorparticularschedule,unlessotherwiseindicatedintheScopeofWorkorwhereschedulingofattendanceorperformanceismutuallyarrangedduetothenatureoftheWork.ConsultantshallretaintherighttodesignatethemeansofperformingtheWorkcoveredbythisagreement,andtheConsultantshallbeentitledtoemployotherworkersatsuchcompensationandsuchotherconditionsasitmaydeemproper,provided,however,thatanycontractsomadebytheConsultantistobepaidbyitalone,andthatemployingsuchworkers,itisactingindividuallyandnotasanagentfortheCity.B.TheCityshallnotberesponsibleforwithholdingorotherwisedeductingfederalincometaxorSocialSecurityorcontributingtotheStateIndustrialInsuranceProgram,orotherwiseassumingthedutiesofanemployerwithrespecttoConsultantoranyemployeeoftheConsultant.C.IftheConsultantisasoleproprietorshiporifthisAgreementiswithanindividual,theConsultantagreestonotifytheCityandcompleteanyrequiredformiftheConsultantretiredunderaStateofWashingtonretirementsystemandagreestoindemnifyanylossestheCitymaysustainthroughtheConsultant’sfailuretodoso.10.HoldHarmless:TheConsultantagreestorelease,indemnify,defend,andholdharmlesstheCity,electedofficials,employees,officers,representatives,andvolunteersfromanyandallclaims,demands,actions,suits,causesofaction,arbitrations,mediations,proceedings,judgments,awards,injuries,damages,liabilities,taxes,losses,fines,fees,penalties,expenses,attorney’sorattorneys’fees,costs,and/orlitigationexpensestoorbyanyandallpersonsorentities,arisingfrom,resultingfrom,orrelatedtothenegligentacts,errorsoromissionsoftheConsultantinitsperformanceofthisAgreementorabreachofthisAgreementbyConsultant,exceptforthatportionoftheclaimscausedbytheCity’ssolenegligence.ShouldacourtofcompetentjurisdictiondeterminethatthisagreementissubjecttoRCW4.24.115,(Validityofagreementtoindemnifyagainstliabilityfornegligencerelativetoconstruction,alteration,improvement,etc.,ofstructureorimprovementattachedtorealestate...)then,intheeventofliabilityfordamagesarisingoutofbodilyinjurytopersonsordamagestopropertycausedbyorresultingfromtheconcurrentnegligenceoftheConsultantandtheCity,itsofficers,officials,employeesandvolunteers,Consultant’sliabilityshallbeonlytotheextentofConsultant’snegligence.0PAGE4OF10AGENDA ITEM #8. f)
ItisfurtherspecificallyandexpresslyunderstoodthattheindemnificationprovidedinthisAgreementconstituteConsultant’swaiverofimmunityundertheIndustrialInsuranceAct,RCWTitle51,solelyforthepurposesofthisindemnification.ThePartieshavemutuallynegotiatedandagreedtothiswaiver.TheprovisionsofthissectionshallsurvivetheexpirationorterminationofthisAgreement.11.GiftsandConflicts:TheCity’sCodeofEthicsandWashingtonStatelawprohibitCityemployeesfromsoliciting,accepting,orreceivinganygift,gratuityorfavorfromanyperson,firmorcorporationinvolvedinacontractortransaction.ToensurecompliancewiththeCity’sCodeofEthicsandstatelaw,theConsultantshallnotgiveagiftofanykindtoCityemployeesorofficials.ConsultantalsoconfirmsthatConsultantdoesnothaveabusinessinterestoraclosefamilyrelationshipwithanyCityofficeroremployeewhowas,is,orwillbeinvolvedinselectingtheConsultant,negotiatingoradministeringthisAgreement,orevaluatingtheConsultant’sperformanceoftheWork.12.CityofRentonBusinessLicense:TheConsultantshallobtainaCityofRentonBusinessLicensepriortoperforminganyWorkandmaintainthebusinesslicenseingoodstandingthroughoutthetermofthisagreementwiththeCity.Informationregardingacquiringacitybusinesslicensecanbefoundat:http://www.rentonwa.gov/cms/One.aspx?portalld=7922741&pageld=9824882InformationregardingStatebusinesslicensingrequirementscanbefoundat:http://dor.wa.gov/doing-business/register-my-business13.Insurance:Consultantshallsecureandmaintain:A.Commercialgeneralliabilityinsuranceintheminimumamountsof$1,000,000foreachoccurrence/$2,000,000aggregatefortheTermofthisAgreement.B.IntheeventthatWorkdeliveredpursuanttothisAgreementeitherdirectlyorindirectlyinvolveorrequireProfessionalServices,ProfessionalLiability,ErrorsandOmissionscoverageshallbeprovidedwithminimumlimitsof$1,000,000peroccurrence.“ProfessionalServices”,forthepurposeofthissection,shallmeananyWorkprovidedbyalicensedprofessionalorWorkthatrequiresaprofessionalstandardofcare.C.Workers’compensationcoverage,asrequiredbytheIndustrialInsurancelawsoftheStateofWashington,shallalsobesecured.D.CommercialAutomobileLiabilityforowned,leased,hiredornon-owned,leased,hiredornon-owned,withminimumlimitsof$1,000,000peroccurrencecombined0PAGE5OF10AGENDA ITEM #8. f)
singlelimit,iftherewillbeanyuseofConsultant’svehiclesontheCity’sPremisesbyoronbehalfoftheCity,beyondnormalcommutes.E.ConsultantshallnametheCityasanAdditionalInsuredonitscommercialgeneralliabilitypolicyonanon-contributoryprimarybasis.TheCity’sinsurancepoliciesshallnotbeasourceforpaymentofanyConsultantliability,norshallthemaintenanceofanyinsurancerequiredbythisAgreementbeconstruedtolimittheliabilityofConsultanttothecoverageprovidedbysuchinsuranceorotherwiselimittheCity’srecoursetoanyremedyavailableatlaworinequity.F.SubjecttotheCity’sreviewandacceptance,acertificateofinsuranceshowingtheproperendorsements,shallbedeliveredtotheCitybeforeperformingtheWork.G.ConsultantshallprovidetheCitywithwrittennoticeofanypolicycancellation,withintwo(2)businessdaysoftheirreceiptofsuchnotice.14.Delays:ConsultantisnotresponsiblefordelayscausedbyfactorsbeyondtheConsultant’sreasonablecontrol.WhensuchdelaysbeyondtheConsultant’sreasonablecontroloccur,theCityagreestheConsultantisnotresponsiblefordamages,norshalltheConsultantbedeemedtobeindefaultoftheAgreement.15.SuccessorsandAssigns:NeithertheCitynortheConsultantshallassign,transferorencumberanyrights,dutiesorinterestsaccruingfromthisAgreementwithoutthewrittenconsentoftheother.16.Notices:AnynoticerequitedunderthisAgreementwillbeinwriting,addressedtotheappropriatepartyattheaddresswhichappearsbelow(asmodifiedinwritingfromtimetotimebysuchparty),andgivenpersonally,byregisteredorcertifiedmail,returnreceiptrequested,byfacsimileorbynationallyrecognizedovernightcourierservice.Timeperiodfornoticesshallbedeemedtohavecommenceduponthedateofreceipt,EXCEPTfacsimiledeliverywillbedeemedtohavecommencedonthefirstbusinessdayfollowingtransmission.EmailandtelephonemaybeusedforpurposesofadministeringtheAgreement,butshouldnotbeusedtogiveanyformalnoticerequiredbytheAgreement.CITYOFRENTONCONSULTANTJosephFarahErikRowland1055SouthGradyWay12787GatewayDriveSouthRenton,WA98057Seattle,WA98168Phone:(425)430-7205Phone:(206)241-6000jfarah@rentonwa.goverowland@nhcweb.comFax:(425)430-7241Fax:(425)439-24200PAGE6OF10AGENDA ITEM #8. f)
17.DiscriminationProhibited:Excepttotheextentpermittedbyabonafideoccupationalqualification,theConsultantagreesasfollows:A.Consultant,andConsultant’sagents,employees,representatives,andvolunteerswithregardtotheWorkperformedortobeperformedunderthisAgreement,shallnotdiscriminateonthebasisofrace,color,sex,religion,nationality,creed,maritalstatus,sexualorientationorpreference,age(exceptminimumageandretirementprovisions),honorablydischargedveteranormilitarystatus,orthepresenceofanysensory,mentalorphysicalhandicap,unlessbaseduponabonafideoccupationalqualificationinrelationshiptohiringandemployment,inemploymentorapplicationforemployment,theadministrationofthedeliveryofWorkoranyotherbenefitsunderthisAgreement,orprocurementofmaterialsorsupplies.B.TheConsultantwilltakeaffirmativeactiontoinsurethatapplicantsareemployedandthatemployeesaretreatedduringemploymentwithoutregardtotheirrace,creed,color,nationalorigin,sex,age,sexualorientation,physical,sensoryormentalhandicaps,ormaritalstatus.Suchactionshallinclude,butnotbelimitedtothefollowingemployment,upgrading,demotionortransfer,recruitmentorrecruitmentadvertising,layoffortermination,ratesofpayorotherformsofcompensationandselectionfortraining.C.litheConsultantfailstocomplywithanyofthisAgreement’snon-discriminationprovisions,theCityshallhavetheright,atitsoption,tocanceltheAgreementinwholeorinpart.D.TheConsultantisresponsibletobeawareofandincompliancewithallfederal,stateandlocallawsandregulationsthatmayaffectthesatisfactorycompletionoftheproject,whichincludesbutisnotlimitedtofairlaborlaws,worker’scompensation,andTitleVIoftheFederalCivilRightsActof1964,andwillcomplywithCityofRentonCouncilResolutionNumber4085.18.Miscellaneous:Thepartiesherebyacknowledge:A.TheCityisnotresponsibletotrainorprovidetrainingforConsultant.B.Consultantwillnotbereimbursedforjobrelatedexpensesexcepttotheextentspecificallyagreedwithintheattachedexhibits.C.Consultantshallfurnishalltoolsand/ormaterialsnecessarytoperformtheWorkexcepttotheextentspecificallyagreedwithintheattachedexhibits.D.Intheeventspecialtraining,licensing,orcertificationisrequiredforConsultanttoprovideWorkhe/shewillacquireormaintainsuchathis/herownexpenseand,if0PAGE70F1OAGENDA ITEM #8. f)
Consultantemploys,sub-contracts,orotherwiseassignstheresponsibilitytoperformtheWork,saidemployee/sub-contractor/assigneewillacquireandormaintainsuchtraining,hcensing,orcertification.E.Thisisanon-exclusiveagreementandConsultantisfreetoprovidehis/herWorktootherentities,solongasthereisnointerruptionorinterferencewiththeprovisionofWorkcalledforinthisAgreement.F.Consultantisresponsibleforhis/herowninsurance,including,butnotlimitedtohealthinsurance.G.Consultantisresponsibleforhis/herownWorker’sCompensationcoverageaswellasthatforanypersonsemployedbytheConsultant.19.OtherProvisions:A.ApprovalAuthority.EachindividualexecutingthisAgreementonbehalfoftheCityandConsultantrepresentsandwarrantsthatsuchindividualsaredulyauthorizedtoexecuteanddeliverthisAgreementonbehalfoftheCityorConsultant.B.GeneralAdministrationandManagement.TheCity’sprojectmanagerisJosephFarah,SurfaceWaterUtilityEngineer.InprovidingWork,ConsultantshallcoordinatewiththeCity’scontractmanagerorhis/herdesignee.C.AmendmentandModification.ThisAgreementmaybeamendedonlybyaninstrumentinwriting,dulyexecutedbybothParties.D.Conflicts.IntheeventofanyinconsistenciesbetweenConsultantproposalsandthisAgreement,thetermsofthisAgreementshallprevail.Anyexhibits/attachmentstothisAgreementareincorporatedbyreferenceonlytotheextentofthepurposeforwhichtheyarereferencedwithinthisAgreement.TotheextentaConsultantpreparedexhibitconflictswiththetermsinthebodyofthisAgreementorcontainstermsthatareextraneoustothepurposeforwhichitisreferenced,thetermsinthebodyofthisAgreementshallprevailandtheextraneoustermsshallnotbeincorporatedherein.E.GoverningLaw.ThisAgreementshallbemadeinandshallbegovernedbyandinterpretedinaccordancewiththe‘awsoftheStateofWashingtonandtheCityofRenton.ConsultantandalloftheConsultant’semployeesshallperformtheWorkinaccordancewithallapplicablefederat,state,countyandcitylaws,codesandordinances.F.JointDraftingEffort.ThisAgreementshallbeconsideredforallpurposesaspreparedbythejointeffortsofthePattiesandshallnotbeconstruedagainstone0PAGE8OF10AGENDA ITEM #8. f)
partyortheotherasaresultofthepreparation,substitution,submissionorothereventofnegotiation,draftingorexecution.G.JurisdictionandVenue.AnylawsuitorlegalactionbroughtbyanypartytoenforceorinterpretthisAgreementoranyofitstermsorcovenantsshallbebroughtintheKingCountySuperiorCourtfortheStateofWashingtonattheMalengRegionalJusticeCenterinKent,KingCounty,Washington,oritsreplacementorsuccessor.H.Severability.Acourtofcompetentjurisdiction’sdeterminationthatanyprovisionorpartofthisAgreementisillegalorunenforceableshallnotcancelorinvalidatetheremainderofthisAgreement,whichshallremaininfullforceandeffect.SoleandEntireAgreement.ThisAgreementcontainstheentireagreementofthePartiesandanyrepresentationsorunderstandings,whetheroralorwritten,notincorporatedareexcluded.J.TimeisoftheEssence.TimeisoftheessenceofthisAgreementandeachandallofitsprovisionsinwhichperformanceisafactor.AdherencetocompletiondatessetforthinthedescriptionoftheWorkisessentialtotheConsultant’sperformanceofthisAgreement.Consultant,however,willnotbeheldresponsiblefordelayscausedbyfailureoftheCityofRentonoritsagentstoprovidedirectionandinformation,orreviewofinterimproducts.K.Third-PartyBeneficiaries.NothinginthisAgreementisintendedto,norshallbeconstruedtogiveanyrightsorbenefitsintheAgreementtoanyoneotherthantheParties,andalldutiesandresponsibilitiesundertakenpursuanttothisAgreementwillbeforthesoleandexclusivebenefitofthePartiesandnooneelse.L.BindingEffect.ThePartieseachbindthemselves,theirpartners,successors,assigns,andlegalrepresentativestotheotherpartytothisAgreement,andtothepartners,successors,assigns,andlegalrepresentativesofsuchotherpartywithrespecttoallcovenantsoftheAgreement.M.Waivers.Allwaiversshallbeinwritingandsignedbythewaivingparty.Eitherparty’sfailuretoenforceanyprovisionofthisAgreementshallnotbeawaiverandshallnotpreventeithertheCityorConsultantfromenforcingthatprovisionoranyotherprovisionofthisAgreementinthefuture.WaiverofbreachofanyprovisionofthisAgreementshallnotbedeemedtobeawaiverofanypriororsubsequentbreachunlessitisexpresslywaivedinwriting.0PAGE9OF10AGENDA ITEM #8. f)
N.Counterparts.ThePartiesmayexecutethisAgreementinanynumberofcounterparts,eachofwhichshallconstituteanoriginal,andallofwhichwilltogetherconstitutethisoneAgreement.INWITNESSWHEREOF,thePartieshavevoluntarilyenteredintothisAgreementasofthedatelastsignedbythePartiesbelow.CITYOFRENTONCONSULTANTBy:______________________________By:_________________DenisLawErikRowlandMayorPrincipal-in-ChargeDateDateAttestJasonA.SethCityClerkApprovedastoLegalFormShaneMoloneyRentonCityAttorneyNon-standard08/03/18clb(473)0PAGE10OF10AGENDA ITEM #8. f)
nbcnorthwesthydraulicconsultantsNHCRef.No.P02004153July25,2018CityofRentonPublicWorks—SurfaceWaterUtility1055SouthGradyWay—5thFloorRenton,WA98057Attention:JosephFarah,P.E.Viaemail:JFarah@Rentonwa.govRe:INTRODUCTION12787GatewayDriveSouthISeattle,WA9816$I206.241.6000Iwww.nhcweb.comExhibitA2018-2022CedarRiverSedimentSurveysTheCityofRentonDepartmentofPublicWorksSurfaceWaterUtility(City)hasaskedNorthwestHydraulicConsultants(NHC)toprepareascopeofworkandbudgetestimatetoprovideannualchannelsurvey,hydraulicmodeling,andsedimentationanalysisservices,relatedtothemonitoringeffortneededaspartoftheCedarRiverMaintenanceDredgingProject.ThefollowingscopeofworkandtheattachedcostestimatehavebeenpreparedinresponsetotheCity’srequest.ThepurposeofthisstudyistomonitoranddocumentsedimentaccumulationwithinthelowertwomilesoftheCedarRiverasitpassesthroughtheCityofRenton.In2016,theCitydredgedthelower1.3milesoftheCedarRiver.AspartoftheCedarRiverSection205FloodHazardReductionproject,theCityisrequiredtomonitorsedimentlevelswithinthelowerCedarRiver,inordertodeterminewhenmaintenancedredgingbecomesnecessary.ThefollowingscopeofworkoutlinesservicestobeconductedbyNHCannuallyoverthenextfiveyears(2018-2022).Task1—Cross-SectionSurveysNHCwillsurveyapproximately40channelcross-sectionsbeginningattheNorthBoeingBridge(RM0.0)andextendingupstreamtoRM2.1.Cross-sectionlocationswillbethesameasthoseestablishedduringprevioussurveys.Bothendsofeachcross-sectionwillextendtothetopoftheexistingbank,berm,orfloodwall.NHCwillpost-processthesurveypointstocreatecross-sectionviewsateachlocation.EachsectionwillbesurveyedatthelocationsmonumentedeitherbyPACEin1999orNHC(insubsequentyears)andateachbridge.SCOPEOFWORKwaterresourcespecialistsAGENDA ITEM #8. f)
ExhibitAiilicNHCwillusetotalstationequipmenttosurveycross-sections.Existingverticalbenchmarkswillbereoccupiedtomaintainconsistencywithpastsurveys.Cross-sectionssurveyswillbereferencedtoknownhorizonalandverticaldatums,WAStatePlaneNorth-NAD83andNAVD1988,respectively.Itisassumedcross-sectionsatbridgefaceswillbesurveyedwithatotalstationratherthansoundingsfrombridgerails,aswasperformedpriorto2017.Task2—UpdateHEC-RASModelNHCwillupdatetheexistingHEC-RASmodelofthestudyreachusingnewlysurveyedcross-sectionsfromTask1.Themodelwillbeusedtoestimatethe2-,10-,25-,and100-yearwatersurfaceprofilesandcorrespondingleveefreeboardelevations.Beginningin2018,newlycomputedfloodfrequencydischargesandmodifiedallowableaveragebedelevationswillbeprovidedtoNHCbytheCityandusedinthehydraulicandfreeboardanalysis.Task3—SedimentAnalysisTohelptheCitymonitorsedimentaccumulationwithinthedredgedreach(downstreamofWilliamsAvenue5),NHCwillusethecurrentyear’ssurveyeddata(fromTask1),andthepreviousyear’ssurveydatato:1)estimatethechangeinsedimentvolume,2)determineaveragebedelevations,and3)calculatetheremainingstoragecapacity.RemainingstoragevolumewillbecomputedbydeterminingthedifferencebetweentheallowablebedestablishedbytheCityandmodifiedaveragebedelevationscalculatedinTask2.Task4—SouthBoeingBridgeAnalysisandMemoNHCwillusetheHEC-RASmodeltocreateastage-dischargeratingcurveattheupstreamfaceoftheSouthBoeingBridge.AsecondratingcurvewillbeplottedonthisfigurethatrepresentstheLandsburgstreamgage.Theratingcurvedatawillbepresentedinbothgraphicalandtabularformats.NHCwillusethemodelresultstoestimatethedischargesattheSouthBoeingBridgeandattheLandsburggagethatproduceawatersurfaceelevationthat:1)touchesthebridgelowchord,and2)isonefootbelowthelowchord.ThisinformationwillbesummarizedinamemorandumthattheCitycandistributetokeyfloodprotectionpartners.Task5—ChannelSurveyReportingAbriefreportwillbepreparedinwhicheachofthetaskitemsaresummarizedanddocumentedwithsupportingtablesandfigures.Keyelementsofthereportwillinclude:•Plotsofthecurrentandpreviousyear’saveragebedprofilescomparedtheestablishedallowablebedelevationprofile,andthe2016post-dredgeprofile.•Resultsanddiscussionofsedimentanalysisandaccumulationrates.•SouthBoeingBridgefloodstageanalysisandmemo.•ResultsfromtheHEC-RASmodel,includingplotsof100-yearwaterlevelsandadiscussionofremainingfreeboardalongthefloodcontrolprojectandbridges,andotherfloodingconcerns.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f)
nbcExhibitANHCwillelectronicallytransmitthereportandsupportingdata(e.g.HEC-RASmodel,photos,...)totheCity.UpontherequestoftheCity,one(1)hardcopywouldbeprovided.Task6—ProjectManagementNHCwillcoordinatethesurveywiththeCityandensurethattheprojectiscompletedontimeandwithinbudget.InvoiceswillbesentmonthlyandNHC’sprojectmanagerwillbeavailabletotheCityforprojectupdates.CLOSURENHCappreciatesthisopportunitytoprovidecontinuedservicetotheCityaspartoftheCedarRiverMaintenanceDredgeProject.DISCLAIMERThisdocumenthasbeenpreparedbyNorthwestHydraulicConsultantsInc.inaccordancewithgenerallyacceptedengineeringpracticesandisintendedfortheexclusiveuseandbenefitoftheCityofRentonandtheirauthorizedrepresentativesforspecificapplicationtotheCedarRiverMaintenanceDredgingProjectinRenton,Washington.Thecontentsofthisdocumentarenottoberelieduponorused,inwholeorinpart,byorforthebenefitofotherswithoutspecificwrittenauthorizationfromNorthwestHydraulicConsultantsInc.Nootherwarranty,expressedorimplied,ismade.NorthwestHydraulicConsultantsInc.anditsofficers,directors,employees,andagentsassumenoresponsibilityfortherelianceuponthisdocumentoranyofitscontentsbyanypartiesotherthantheCityofRenton.Sincerely,NorthwestHydraulicConsultantsInc.PeterBrooks,P.E.ErikRowland,P.E.Sr.EngineerPrincipalProjectManagerPrincipal-in-ChargeAttachments:ExhibitB—BudgetExhibitC—Schedule2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f)
ExhibitB—Budget2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018nbcNorthwestHydraulicConsultantsInc.12787GatewayDriveS.Seattle,WA98168Tel.(206)241-6000Fax(206)439-2420EstimateofProfessionalServicesPreparedfor:CityofRentonProject:2018-2022CedarRiverSedimentSurveysDate:07/2512018Project#:P02004153PreparedBy:PeterBrooks!ErikRowlandDirectExpenseDetailTflT1nierrrpPRtImrcCostSummaryeudgetestimateIoncurrentyear(2010)YearTask20182019202020212022TotalCedarRiverSedimentSurvey$24934$25,682$26,452$27,246$28,063$132,377Budgetestimatesincluding3%annualescalationafter2018.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityGISSr.Doc.contactTASKDESCRIPTIONPa.Sr.Eng.IEng.IJr.Eng.AnalystSpclst.Admin.TotalsTask1Cross-SectionSurvey1.1SL.rvey24848$11,8391.2PostProcessing2105$1,881Task2UpdateHEC-RASModel128$1.43fTask3SedimentAnatis3.1Cross-SectionCompadson/VolumeCalctiations14164$3,0143.2SedimentProBes2—42$975Task4SouthBoeingBndgeAnalysis&Memo1241$1125Task5ChannelSurveyReporting46844$3688Task6ProjectManagement221TotalHoursandDirectSalaryCost(DSC)9.022.048.098.015.05.01.0LaborRate($/hr)240.28185.24135.83103.0995.87101.81136.67TOTALLABORCOSTI$23,957UnitsMileage0545527TotalStation5150$750Reproduction540$200Rate50.!jICost.TotalLabor$2395TotalDirectEspertses..-TOTALCOrAGENDA ITEM #8. f)
nbcSCHEDULEOFSTANDARDCHARGES(Effective1ian2018)LaborFeeRateCategory($US/hour)PrinUpal240.28PrindpalT3223.71Sr.ProjectEngineer/Saenfist200.00Sr.Engineer1185.24Sr.Engineer/Sdentist2156.52Engineer1135.83Scientist1121.69Engineer/Sdentist2111.66Jr.Engineer103.09GISSpedalist130.23GISAnalyst95.87Sr.EngineeringTechnician131.90Sr.LaboratoryTechnician100.00LaboratoryTechnician75.32Sr.ContractAdministrator136.67Sr.TechnicalEditor135.00Sr.DocumentProduction/flnanceSpecialist101.81DocumentProductionSpecialist80.00HandlingChargesIFeesPhotocopies$/sheetB&W81hx11$010MarkuponSubconsultants10%B&W11x17$0.15MarkuponReimbutsables10%Color81Axli$1.00MarkuponTravel/Subsistence.lO%Colorlix17$2.00Plotting$/sheetPlots,bond,lix17$2.00Plots,bond,Dsize$4.00Plots,oversize(runningfoot).$2.00LaborcostssubjecttoannualescalationadjustmentinOctobertoreflectcostoflivingandmeritsalaryincreases.Refertoseparateschedulesforfieldandlaboratoryequipmentcharges.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f)
nbcExhibitC—Schedule2018-2022CedarRiverSedimentSurveysNorthwestHydraulicConsultantsJuly25,2018NHCwillperformthecross-sectionsurveysduringlowwaterinAugustand/orSeptember.FivecopiesofthesummaryreportincludingsurveydataforthisreachalongwiththesedimentvolumeinformationwillbeprovidedtotheCitybyOctober31ofthecurrentyear.Allworkandrevisionswillbecompletedbeforethefinalprojectcloseoutdateattheendofthecurrentcalendaryear.FinalinvoicesshallbeprovidedbyorbeforeDecember31stoftheyearthattheworkwasperformed.2018-2022CedarRiverSedimentSurveysCityofRenton—SurfaceWaterUtilityAGENDA ITEM #8. f)
AB - 2197
City Council Regular Meeting - 20 Aug 2018
SUBJECT/TITLE: Water Quality Grant Agreement WQC-2017-Renton-00002 with the
Department of Ecology for the Heather Downs Detention Pond Water
Quality Retrofit Project
RECOMMENDED ACTION: Refer to Utilities Committee
DEPARTMENT: Utility Systems Division
STAFF CONTACT: Ron Straka, Surface Water Utility Engineering Manager
EXT.: 7248
FISCAL IMPACT SUMMARY:
The grant agreement provides $93,000 of grant funding into the approved 2018 Surface Water Utility Capital
Improvement Program budget for the Heather Downs Detention Pond Water Quality Retrofit Project
(425.475511). The grant funding for this project was included in the city’s second quarter budget adjustment.
The grant requires $31,000 of matching funds for a total grant agreement amount of $124,000. There is
sufficient funding in the project budget for the required matching funds.
SUMMARY OF ACTION:
The City of Renton has been awarded $93,000 in grant funds from the State of Washington Department of
Ecology for the Heather Downs Detention Pond Water Quality Retrofit Project. This project will improve water
quality in Maplewood Creek, tributary to the Cedar River, through design of a combined detention pond and
wetpond at Union Avenue SE and SE 4th Street. This project will provide treatment for total suspended solid
(TSS) and will reduce flows to Maplewood Creek by increasing stormwater infiltration and providing
stormwater detention. The Ecology grant includes the preparation of State En vironmental Policy Act (SEPA)
and cultural resource review requirements, development of an Inadvertent Discovery Plan (IDP), development
of a project design report and construction plans and specifications that will allow the future construction of
the project to treat stormwater runoff in the Heather Downs residential neighborhood. The project design and
preparation of the construction plans and specifications will be completed prior to the grant agreement
expiration date of December 31, 2020.
EXHIBITS:
A. Agreement
B. Vicinity Map
STAFF RECOMMENDATION:
Authorize the Mayor to execute the Water Quality Grant Agreement WQC-2017-Renton-00002 with the
Department of Ecology to accept $93,000 in grant funds for the Heather Downs Detention Pond Water Quality
Retrofit Project.
AGENDA ITEM #8. g)
Agreement No. WQC-2017-Renton-00002
WATER QUALITY COMBINED FINANCIAL ASSISTANCE AGREEMENT
BETWEEN
THE STATE OF WASHINGTON DEPARTMENT OF ECOLOGY
AND
CITY OF RENTON
This is a binding Agreement entered into by and between the state of Washington, Department of Ecology,
hereinafter referred to as “ECOLOGY,” and City of Renton, hereinafter referred to as the “RECIPIENT,” to carry out
with the provided funds activities described herein.
Heather Downs Detention Pond Water Quality
Retrofit Project
GENERAL INFORMATION
Project Title:
Total Cost:
Total Eligible Cost:
Ecology Share:
Recipient Share:
The Effective Date of this Agreement is:
The Expiration Date of this Agreement is no later than:
Project Type:
Project Short Description:
This project will improve water quality in Maplewood Creek, tributary to the Cedar River, through design of a
combined detention and wetpond at Union Avenue SE and SE 4th Street in the city of Renton. This project will
provide treatment for total suspended solids (TSS) and will also reduce flows to Maplewood Creek by
increasing stormwater infiltration and/or providing stormwater detention.
Project Long Description:
Stormwater runoff from approximately 30 acres of predominately impervious area including driveways, streets,
building roofs, and other impervious areas collects in catch basins and pipes and flows to Heather Downs
detention pond. The pond currently provides no treatment for stormwater runoff. Stormwater runoff contains
various mixtures of hydrocarbons, oils, metals and sediments and can ultimately impair downstream
waterbodies. The pond discharges to Maplewood Creek, a tributary to the Cedar River, and ultimately Lake
Washington. The Cedar River is a 303(d) listed water body for temperature, pH, fecal coliform and ammonia.
$124,000.00
$124,000.00
$93,000.00
$31,000.00
01/01/2018
12/31/2020
Stormwater Facility
AGENDA ITEM #8. g)
Page 2 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
The RECIPIENT will complete the planning and design work needed to convert the existing detention pond
located at Union Ave SE and SE 4th Street in the city of Renton into a combined detention and wetpond facility.
The water quality retrofits will reduce water quality problems in Maplewood Creek and the Cedar River by
providing basic water quality treatment prior to discharging into the river. The pond will consist of two
treatment cells and will provide both water quality treatment through dead storage in the wetpool and flow
control through live storage above the wetpool, which will reduce peak flows to the outfall system, and reduce
erosion and gullying downstream of the pond.
Overall Goal:
This project will help protect and restore water quality in Washington by reducing stormwater impacts from
existing infrastructure and development.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 3 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
RECIPIENT INFORMATION
Organization Name:
Federal Tax ID:
DUNS Number:
Mailing Address:
Physical Address:
Contacts
Organization Email:
City of Renton
91-6001271
949697221
Renton City Hall, 5th Floor, 1055 South Grady Way
Renton, WA 98057-3232
Renton City Hall, 5th Floor
1055 South Grady Way
Renton, Washington 98057-3232
Ken Srilofung
Surface Water Utility Engineer 3 - Project Manager
1055 South Grady Way, 5th Floor
Renton, Washington 98057
Email: ksrilofung@rentonwa.gov
Phone: (425) 430-7247
Authorized
Signatory
Ken Srilofung
Surface Water Utility Engineer 3 - Project Manager
1055 South Grady Way, 5th Floor
Renton, Washington 98057
Email: ksrilofung@rentonwa.gov
Phone: (425) 430-7247
Billing Contact
Project Manager
Authorized
Signatory
Denis W Law
Mayor
1055 S. Grady Way
Renton, Washington 98057
Email: dlaw@rentonwa.gov
Phone: (425) 430-6500
phintz@rentonwa.gov
Version 10/30/2015
AGENDA ITEM #8. g)
Page 4 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Contacts
Project
Manager
Financial
Manager
Technical
Advisor
Melisa Snoeberger
3190 - 160th Ave SE
Bellevue, Washington 98008-5452
Email: msno461@ecy.wa.gov
Phone: (425) 649-7047
Frances Carver
PO Box 47600
Olympia, Washington 98504-7600
Email: fcar461@ecy.wa.gov
Phone: (360) 407-6564
Amanda Heye
PO Box 47600
Olympia, Washington 98504-7600
Email: ahey461@ecy.wa.gov
Phone: (360) 407-6457
ECOLOGY INFORMATION
Mailing Address:
Physical Address:
Department of Ecology
Water Quality
PO BOX 47600
Olympia, WA 98504-7600
Water Quality
300 Desmond Drive SE
Lacey, WA 98503
Version 10/30/2015
AGENDA ITEM #8. g)
Page 5 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
AUTHORIZING SIGNATURES
RECIPIENT agrees to furnish the necessary personnel, equipment, materials, services, and otherwise do all things
necessary for or incidental to the performance of work as set forth in this Agreement.
RECIPIENT acknowledges that they had the opportunity to review the entire Agreement, including all the terms and
conditions of this Agreement, Scope of Work, attachments, and incorporated or referenced documents, as well as all
applicable laws, statutes, rules, regulations, and guidelines mentioned in this Agreement. Furthermore, the
RECIPIENT has read, understood, and accepts all requirements contained within this Agreement.
This Agreement contains the entire understanding between the parties, and there are no other understandings or
representations other than as set forth, or incorporated by reference, herein.
No subsequent modifications or amendments to this agreement will be of any force or effect unless in writing, signed
by authorized representatives of the RECIPIENT and ECOLOGY and made a part of this agreement. ECOLOGY and
RECIPIENT may change their respective staff contacts without the concurrence of either party.
This Agreement shall be subject to the written approval of Ecology’s authorized representative and shall not be
binding until so approved.
The signatories to this Agreement represent that they have the authority to execute this Agreement and bind their
respective organizations to this Agreement.
IN WITNESS WHEREOF: the parties hereto, having read this Agreement in its entirety, including all attachments, do
agree in each and every particular and have thus set their hands hereunto.
Washington State
Department of Ecology
Water Quality
Date Date
City of Renton
Heather R. Bartlett
Mayor
Denis W Law
By:By:
Template Approved to Form by
Attorney General's Office
Program Manager
Version 10/30/2015
AGENDA ITEM #8. g)
Page 6 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Clerk Date
Jason A. Seth
Attorney Date
Shane Moloney
Version 10/30/2015
AGENDA ITEM #8. g)
Page 7 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
SCOPE OF WORK
Task Number:1 Task Cost: $12,400.00
Task Title:Project Administration/Management
Task Description:
A. The RECIPIENT shall carry out all work necessary to meet ECOLOGY grant or loan administration requirements.
Responsibilities include, but are not limited to: maintenance of project records; submittal of requests for
reimbursement and corresponding backup documentation; progress reports; and a recipient closeout report (including
photos).
B. The RECIPIENT shall maintain documentation demonstrating compliance with applicable procurement,
contracting, and interlocal agreement requirements; application for, receipt of, and compliance with all required
permits, licenses, easements, or property rights necessary for the project; and submittal of required performance items.
C. The RECIPIENT shall manage the project. Efforts include, but are not limited to: conducting, coordinating, and
scheduling project activities and assuring quality control. Every effort will be made to maintain effective
communication with the RECIPIENT's designees; ECOLOGY; all affected local, state, or federal jurisdictions; and any
interested individuals or groups. The RECIPIENT shall carry out this project in accordance with any completion dates
outlined in this agreement.
Task Goal Statement:
Properly managed and fully documented project that meets ECOLOGY’s grant or loan administrative requirements.
Task Expected Outcome:
* Timely and complete submittal of requests for reimbursement, quarterly progress reports, and RECIPIENT closeout
report.
* Properly maintained project documentation
Recipient Task Coordinator: Ken Srilofung
Deliverables
Project Administration/Management
Number Description Due Date
1.1 Quarterly Progress Reports
1.2 Recipient Closeout Report
1.3 Project Outcome Summary Report
Version 10/30/2015
AGENDA ITEM #8. g)
Page 8 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
SCOPE OF WORK
Task Number:2 Task Cost: $111,600.00
Task Title:Design Plans and Specs, Environmental Review
Task Description:
The RECIPIENT shall ensure the following items are completed and provide the associated deliverables to ECOLOGY
The RECIPIENT must approve all materials prior to submitting them to ECOLOGY for acceptance.
A.The RECIPIENT will coordinate the preparation and submittal of State Environmental Policy Act (SEPA)
documentation.
B.The RECIPIENT is responsible for application of, receipt of, and compliance with all required local, state, tribal
and federal permits, licenses, easements, or property rights necessary for the project.
C.The RECIPIENT will comply with Executive Order (05-05) cultural resources review requirements. To initiate
cultural resources review the RECIPIENT will:
1.Submit an ECOLOGY 05-05/106 Form, or a cultural resources survey or assessment completed by a licensed
archaeologist to ECOLOGY. All submitted materials must conform to the Washington State Standards for Cultural
Resource Reporting (DAHP February 2014).
2.Develop and submit an Inadvertent Discovery Plan (IDP) to ECOLOGY. The RECIPIENT will ensure that all
contractors and subcontractors have a copy of the completed IDP prior to and while working on-site. An IDP template
may be found on the ECOLOGY website.
Ground disturbing work (including geotechnical investigations) completed prior to receiving written notice to proceed
from ECOLOGY shall not be eligible for reimbursement.
D.The RECIPIENT will develop a project Design Report. Projects must be designed in accordance with the
Stormwater Management Manual for Eastern Washington, Stormwater Management Manual for Western Washington,
or equivalent manual. Project must be reviewed and accepted in writing by ECOLOGY to be eligible for
reimbursement.
The RECIPIENT will upload a digital copy of the items listed below to EAGL for review. Reduce design figures to
11x17 inches in size and ensure they are legible.
1.Design Report. For a complete list of required design report elements refer to the ECOLOGY website.
The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology Design
Report Acceptance Letter prior to proceeding to 90 Percent design.
2.90 Percent Design Package. At a minimum, this package must include 90 percent plans, specifications, engineer’s
opinion of cost which includes a schedule of eligible costs, and project construction schedule. For current bid inserts
and specifications refer to the ECOLOGY website.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 9 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
The RECIPIENT agrees to respond to ECOLOGY comments. The RECIPIENT must receive an Ecology 90 Percent
Design Acceptance Letter prior to proceeding Final Design.
3.The RECIPIENT will upload a digital copy of the Final Bid Package to EAGL for review and acceptance prior to
advertising the project. The Final Bid Package includes: project plans, specifications, engineer’s opinion of cost
including a schedule of eligible costs, and project construction schedule.
Task Goal Statement:
The RECIPIENT will complete all design, environmental review, and permitting tasks and respond to ECOLOGY
comments in a timely manner.
Task Expected Outcome:
The project will meet the requirements set forth by the State Environmental Policy Act, cultural resource protection
requirements, ECOLOGY water quality facility design standards, and all other applicable federal, state and local laws
and regulations.
The project will produce a bid ready set of plans and specifications that will allow the the construction of an
aesthetically pleasing, low cost, and effective solution to treat stormwater in the Heather Downs residential
neighborhood.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 10 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Recipient Task Coordinator: Ken Srilofung
Deliverables
Design Plans and Specs, Environmental Review
Number Description Due Date
2.1 Copy of SEPA determination documentation. Upload to EAGL and
notify ECOLOGY when upload is complete.
2.2 Submit ECOLOGY 05-05/106 Form and any supplemental cultural
resources documentation including Cultural Resource surveys directly to
the Ecology Project Manager. Upload the Final Determination Letter to
EAGL.
2.3 Inadvertent Discovery Plan. Upload to EAGL and notify ECOLOGY
when upload is complete.
2.4 Design Report. Upload to EAGL and notify ECOLOGY when upload is
complete.
2.5 Responses to ECOLOGY Design Report comments. Upload to EAGL
and notify ECOLOGY when upload is complete.
2.6 Ecology Design Report Acceptance Letter. Upload to EAGL and notify
ECOLOGY when upload is complete.
2.7 90 Percent Design Package. Upload to EAGL and notify ECOLOGY
when upload is complete.
2.8 Responses to ECOLOGY 90 Percent Design Plan comments. Upload to
EAGL and notify ECOLOGY when upload is complete.
2.9 Ecology 90 Percent Design Acceptance Letter. Upload to EAGL and
notify ECOLOGY when upload is complete.
2.10 List of permits acquired, and environmental review documents. Upload
to EAGL and notify ECOLOGY when upload is complete.
2.11 Final Bid Package. Upload to EAGL and notify ECOLOGY when upload
is complete.
2.12 Ecology Final Bid Package Acceptance Letter. Upload to EAGL and
notify ECOLOGY when upload is complete.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 11 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
BUDGET
Funding Distribution EG180582
NOTE: The above funding distribution number is used to identify this specific agreement and budget on payment
remittances and may be referenced on other communications from ECOLOGY. Your agreement may have multiple
funding distribution numbers to identify each budget.
Title:
State
SFAP - SFY17
100%
Environmental Legacy Stewardship Account (ELSA) - State
Type:
Funding Source %:
Description:
Approved Indirect Costs Rate:
Recipient Match %:
InKind Interlocal Allowed:
InKind Other Allowed:
Is this Funding Distribution used to match a federal grant? No
Approved State Indirect Rate: 0%
25%
No
No
Funding Title:
Funding Source:
Funding Expiration Date:
Funding Type:
Funding Effective Date:
SFAP
01/01/2018 12/31/2020
Grant
SFAP Task Total
Project Administration/Management 12,400.00$
Design Plans and Specs, Environmental Review 111,600.00$
124,000.00$Total:
Version 10/30/2015
AGENDA ITEM #8. g)
Page 12 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Funding Distribution Summary
Recipient / Ecology Share
Recipient Share Ecology Share TotalRecipient Match %Funding Distribution Name
$$$%93,000.00 124,000.0031,000.0025.00SFAP
Total $$31,000.00 93,000.00 $124,000.00
AGREEMENT SPECIFIC TERMS AND CONDITIONS
N/A
SPECIAL TERMS AND CONDITIONS
SECTION 1: DEFINITIONS
Unless otherwise provided, the following terms will have the respective meanings for all purposes of this agreement:
“Administration Charge” means a charge established in accordance with Chapter 90.50A RCW and Chapter 173-98
WAC, to be used to pay Ecology’s cost to administer the State Revolving Fund by placing a percentage of the interest
earned in an Administrative Charge Account.
“Administrative Requirements” means the effective edition of ECOLOGY's Administrative Requirements for
Recipients of Ecology Grants and Loans at the signing of this agreement.
“Annual Debt Service” for any calendar year means for any applicable bonds or loans including the loan, all interest
plus all principal due on such bonds or loans in such year.
“Average Annual Debt Service” means, at the time of calculation, the sum of the Annual Debt Service for the
remaining years of the loan to the last scheduled maturity of the loan divided by the number of those years.
“Centennial Clean Water Program” means the state program funded from various state sources.
“Contract Documents” means the contract between the RECIPIENT and the construction contractor for construction of
the project.
“Cost Effective Analysis” means a comparison of the relative cost-efficiencies of two or more potential ways of
solving a water quality problem as described in Chapter 173-98-730 WAC.
“Defease” or “Defeasance” means the setting aside in escrow or other special fund or account of sufficient investments
and money dedicated to pay all principal of and interest on all or a portion of an obligation as it comes due.
“Effective Date” means the earliest date on which eligible costs may be incurred.
“Effective Interest Rate” means the total interest rate established by Ecology that includes the Administrative Charge.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 13 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
“Estimated Loan Amount” means the initial amount of funds loaned to the RECIPIENT.
“Estimated Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the
Estimated Loan Amount.
“Equivalency” means projects designated by ECOLOGY to meet additional federal requirements.
“Final Accrued Interest” means the interest accrued beginning with the first disbursement of funds to the RECIPIENT
through such time as the loan is officially
closed out and a final loan repayment schedule is issued.
“Final Loan Amount” means all principal of and interest on the loan from the Project Start Date through the Project
Completion Date.
“Final Loan Repayment Schedule” means the schedule of loan repayments over the term of the loan based on the Final
Loan Amount.
“Forgivable Principal” means the portion of a loan that is not required to be paid back by the borrower.
“General Obligation Debt” means an obligation of the RECIPIENT secured by annual ad valorem taxes levied by the
RECIPIENT and by the full faith, credit,
and resources of the RECIPIENT.
“General Obligation Payable from Special Assessments Debt” means an obligation of the RECIPIENT secured by a
valid general obligation of the Recipient payable from special assessments to be imposed within the constitutional and
statutory tax limitations provided by law without a vote of the electors of the RECIPIENT on all of the taxable
property within the boundaries of the RECIPIENT.
“Gross Revenue” means all of the earnings and revenues received by the RECIPIENT from the maintenance and
operation of the Utility and all earnings from the investment of money on deposit in the Loan Fund, except (i) Utility
Local Improvement Districts (ULID) Assessments, (ii) government grants, (iii) RECIPIENT taxes, (iv) principal
proceeds of bonds and other obligations, or (v) earnings or proceeds (A) from any investments in a trust, Defeasance,
or escrow fund created to Defease or refund Utility obligations or (B) in an obligation redemption fund or account
other than the Loan Fund until commingled with other earnings and revenues of the Utility or (C) held in a special
account for the purpose of paying a rebate to the United States Government under the Internal Revenue Code.
“Guidelines” means the ECOLOGY's Funding Guidelines that that correlate to the State Fiscal Year in which the
project is funded.
“Initiation of Operation Date” means the actual date the Water Pollution Control Facility financed with proceeds of the
loan begins to operate for its intended purpose.
“Loan” means the Washington State Water Pollution Control Revolving Fund Loan or Centennial Clean Water Fund
(Centennial) Loan made pursuant to this loan agreement.
“Loan Amount” means either an Estimated Loan Amount or a Final Loan Amount, as applicable.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 14 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
“Loan Fund” means the special fund of that name created by ordinance or resolution of the RECIPIENT for the
repayment of the principal of and interest on the loan.
“Loan Security” means the mechanism by which the RECIPIENT pledges to repay the loan.
“Loan Term” means the repayment period of the loan.
“Maintenance and Operation Expense” means all reasonable expenses incurred by the RECIPIENT in causing the
Utility to be operated and maintained in good repair, working order, and condition including payments to other parties,
but will not include any depreciation or RECIPIENT levied taxes or payments to the RECIPIENT in lieu of taxes.
“Net Revenue” means the Gross Revenue less the Maintenance and Operation Expense.
“Original Engineer’s Estimate” means the engineer’s estimate of construction costs included with bid documents.
“Principal and Interest Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name
created in the loan fund to be first used to repay the principal of and interest on the loan.
“Project” means the project described in this agreement.
“Project Completion Date” means the date specified in the agreement on which the Scope of Work will be fully
completed.
“Project Schedule” means that schedule for the project specified in the agreement.
“Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, the account of that name created in the
loan fund to secure the payment of the principal of and interest on the loan.
“Revenue-Secured Debt” means an obligation of the RECIPIENT secured by a pledge of the revenue of a utility and
one not a general obligation of the RECIPIENT.
“Risk-Based Determination” means an approach to sub-recipient monitoring and oversight based on risk factors
associated to a RECIPIENT or project.
“Scope of Work” means the tasks and activities constituting the project.
“Section 319” means the section of the Clean Water Act that provides funding to address nonpoint sources of water
pollution.
“Senior Lien Obligations” means all revenue bonds and other obligations of the RECIPIENT outstanding on the date
of execution of this loan agreement (or subsequently issued on a parity therewith, including refunding obligations) or
issued after the date of execution of this loan agreement having a claim or lien on the Gross Revenue of the Utility
prior and superior to the claim or lien of the loan, subject only to Maintenance and Operation Expense.
“State Water Pollution Control Revolving Fund (Revolving Fund)” means the water pollution control revolving fund
established by Chapter 90.50A.020 RCW.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 15 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
“Termination Date” means the effective date of ECOLOGY’s termination of the agreement.
“Termination Payment Date” means the date on which the RECIPIENT is required to repay to ECOLOGY any
outstanding balance of the loan and all accrued interest.
“Total Eligible Project Cost” means the sum of all costs associated with a water quality project that have been
determined to be eligible for ECOLOGY grant or loan funding.
“Total Project Cost” means the sum of all costs associated with a water quality project, including costs that are not
eligible for ECOLOGY grant or loan funding.
“ULID” means any utility local improvement district of the RECIPIENT created for the acquisition or construction of
additions to and extensions and betterments of the Utility.
“ULID Assessments” means all assessments levied and collected in any ULID. Such assessments are pledged to be
paid into the Loan Fund (less any prepaid assessments permitted by law to be paid into a construction fund or
account). ULID Assessments will include principal installments and any interest or penalties which may be due.
“Utility” means the sewer system, stormwater system, or the combined water and sewer system of the RECIPIENT,
the Net Revenue of which is pledged to pay and secure the loan.
SECTION 2: THE FOLLOWING CONDITIONS APPLY TO ALL RECIPIENTS OF WATER QUALITY
COMBINED FINANCIAL ASSISTANCE FUNDING.
The Water Quality Financial Assistance Funding Guidelines are included in this agreement by reference and are
available on ECOLOGY’s Water Quality Program website.
A. Architectural and Engineering Services: The RECIPIENT certifies by signing this agreement that the requirements
of Chapter 39.80 RCW, “Contracts for Architectural and Engineering Services,” have been, or shall be, met in
procuring qualified architectural/engineering services. The RECIPIENT shall identify and separate eligible and
ineligible costs in the final architectural/engineering services contract and submit a copy of the contract to ECOLOGY.
B. Best Management Practices (BMP) Implementation: If the RECIPIENT installs BMPs that are not approved by
ECOLOGY prior to installation, the RECIPIENT assumes the risk that part or all of the reimbursement for that
activity may be delayed or ineligible. For more details regarding BMP Implementation, please reference the Water
Quality Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website.
C. Cultural Resources: The RECIPIENT shall:
1) The RECIPIENT shall comply with all applicable federal, state and local environmental laws, statutes, regulations,
executive orders, and permits.
2) The RECIPIENT shall comply with Ecology’s Archaeological Resource and Historic Property review process. The
RECIPIENT agrees that in no case shall construction activities, ground disturbance, or excavation of any kind, begin
until provisions of this process are complied with. The RECIPIENT is responsible for developing a complete
Inadvertent Discovery Plan (IDP). The IDP must be immediately available upon request by any party. The IDP must be
readily available and be implemented to address any discovery. The RECIPIENT shall implement the procedures in
Version 10/30/2015
AGENDA ITEM #8. g)
Page 16 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
the IDP, and immediately notify ECOLOGY, the Department of Archeology and Historic Preservation (DAHP), and
tribal representatives, if human remains, cultural, or archeological resources are discovered in the course of ground
disturbing activities. For more details regarding requirements under this provision, please reference the Water Quality
Financial Assistance Funding Guidelines available on ECOLOGY’s Water Quality Program funding website.
D. Electronic Fund Transfers: The RECIPIENT must register as a statewide vendor in order to receive payment
reimbursement. Washington State’s Department of Enterprise Services (DES) issues all payments. DES maintains a
central vendor file for Washington State agency use to process vendor payments. The RECIPIENT can complete the
registration process online at:
http://des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. This registration process
allows the RECIPIENT to sign up for direct deposit payments, also known as electronic fund transfers (EFT). If the
RECIPIENT has questions about the vendor registration process or setting up direct deposit payments contact DES
Payee Help Desk at (360) 664-7779 or payeehelpdesk@des.wa.gov.
E. Equipment Purchase: Equipment not included in the scope of work or the Ecology approved construction plans and
specifications, must be pre-approved by ECOLOGY’s project manager before purchase.
F. Funding Recognition: The RECIPIENT must inform the public about ECOLOGY or any EPA (see Section 3.B for
Section 319 funded or Section 5.E for SRF funded projects) funding participation in this project through the use of
project signs, acknowledgement in published materials, reports, the news media, websites, or other public
announcements. Projects addressing site-specific locations must utilize appropriately sized and weather-resistant
signs. Sign logos are available from ECOLOGY’s Financial Manager upon request.
G. Growth Management Planning: The RECIPIENT certifies by signing this agreement that it is in compliance with
the requirements of Chapter 36.70A RCW, “Growth Management Planning by Selected Counties and Cities.” If the
status of compliance changes, either through RECIPIENT or legislative action, the RECIPIENT shall notify
ECOLOGY in writing of this change within 30 days.
H. Interlocal: The RECIPIENT certifies by signing this agreement that all negotiated interlocal agreements necessary
for the project are, or shall be, consistent with the terms of this agreement and Chapter 39.34 RCW, “Interlocal
Cooperation Act.” The RECIPIENT shall submit a copy of each interlocal agreement necessary for the project to
ECOLOGY upon request.
I. Lobbying and Litigation: Costs incurred for the purposes of lobbying or litigation are not eligible for funding under
this agreement.
J. Post Project Assessment Survey: The RECIPIENT agrees to participate in a brief survey regarding the key project
results or water quality project outcomes and the status of long-term environmental results or goals from the project
approximately three years after project completion. A representative from ECOLOGY’s Water Quality Program may
contact the RECIPIENT to request this data. ECOLOGY may also conduct site interviews and inspections, and may
otherwise evaluate the project, as part of this assessment.
K. Project Status Evaluation: ECOLOGY may evaluate the status of this project 18 months from the effective date of
this agreement. ECOLOGY’s Project Manager and Financial Manager will meet with the RECIPIENT to review
spending trends, completion of outcome measures, and overall project administration and performance. If the
RECIPIENT fails to make satisfactory progress toward achieving project outcomes, ECOLOGY may change the scope
of work, reduce grant funds, or increase oversight measures.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 17 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
L. Technical Assistance: Technical assistance for agriculture activities provided under the terms of this agreement
shall be consistent with the current U.S. Natural Resource Conservation Service (“NRCS”) Field Office Technical
Guide for Washington State. However, ECOLOGY may accept as eligible technical assistance, proposed practices, or
project designs that do not meet these standards if approved in writing by the NRCS and ECOLOGY.
SECTION 3: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND ONLY CENTENNIAL CLEAN
WATER FUNDED PROJECTS BEING USED TO MATCH SECTION 319 FUNDS.
The RECIPIENT must submit the following documents to ECOLOGY before this agreement is signed by ECOLOGY:
1. Federal Funding Accountability and Transparency Act (FFATA) Form, available on the Water Quality Program
website.
2. Clean Water Act Section 319 Initial Data Reporting Sheet or the “Section 319 Initial Data Reporting” form in
EAGL.
A. Data Reporting: The RECIPIENT must complete the “Section 319 Initial Data Reporting” form in EAGL before
this agreement can be signed by Ecology. This form is used to gather general information about the project.
B. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the RECIPIENT
shall provide signage that informs the public that the project is funded by EPA. The signage shall contain the EPA
logo and follow usage requirements available at http://www2.epa.gov/stylebook/using-epa-seal-and-logo. To obtain
the appropriate EPA logo or seal graphic file, the RECIPIENT may sent a request to their Ecology’s Financial
Manager.
To increase public awareness of projects serving communities where English is not the predominant language,
RECIPIENTS are encouraged to provide their outreach strategies communication in non-English languages.
Translation costs for this purpose are allowable, provided the costs are reasonable.
The RECIPIENT shall use the following paragraph in all reports, documents, and signage developed under this
agreement:
“This project has been funded wholly or in part by the United States Environmental Protection Agency under an
assistance agreement to the Washington State Department of Ecology. The contents of this document do not
necessarily reflect the views and policies of the Environmental Protection Agency, nor does the mention of trade
names or commercial products constitute endorsement or recommendation for use.”
C. Load Reduction Reporting: The RECIPIENT shall complete the “Section 319 Annual Load Reduction Reporting”
form in EAGL by January 15 of each year and at project close-out. ECOLOGY may hold reimbursements until the
RECIPIENT has completed the form. This form is used to gather information on pollutant load reductions for each
best management practice (BMP) installed as a part of this project.
D. Time Extension: The RECIPIENT may request a one-time extension for up to 12 months. However, the time
extension cannot exceed the time limitation established in EPA’s assistance agreement. In the event a time extension
is requested and approved by ECOLOGY, the RECIPIENT must complete all eligible work performed under this
agreement by the expiration date.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 18 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
SECTION 4: THE FOLLOWING CONDITIONS APPLY TO SECTION 319 AND STATE REVOLVING FUND
(SRF) LOAN FUNDED PROJECTS ONLY.
A. Accounting Standards: The RECIPIENT shall maintain accurate records and accounts for the project (PROJECT
Records) in accordance with Generally Accepted Accounting Principles (GAAP) as issued by the Governmental
Accounting Standards Board (GASB), including standards related to the reporting of infrastructure assets or in
accordance with the standards in Chapter 43.09.200 RCW “Local Government Accounting – Uniform System of
Accounting”.
B. Audit Requirements: In accordance with 2 CFR 200.501(a), the RECIPIENT agrees to obtain a single audit from
an independent auditor, if their organization expends $750,000 or more in total Federal funds in their fiscal year. The
RECIPIENT must submit the form SF-SAC and a Single Audit Report Package within 9 months of the end of the
fiscal year or 30 days after receiving the report from an independent auditor. The SF-SAC and a Single Audit Report
Package MUST be submitted using the Federal Audit Clearinghouse’s Internet Data Entry System available at:
https://harvester.census.gov/fac/collect/ddeindex.html. For complete information on how to accomplish the single
audit submissions, go to the Federal Audit Clearinghouse Web site: http://harvester.census.gov/fac/.
C. Archaeological Resources and Historic Properties (Section 106): See Section 2.C of the terms and conditions of this
agreement, the RECIPIENT shall comply with the additional requirements under section 106 of the National Historic
Preservation Act (NHPA, 36 CFR 800).
D. Consultant Cap: The RECIPIENT shall ensure that loan or grant funds provided under this agreement to reimburse
for costs incurred by individual consultants (excluding overhead) is limited to the maximum daily rate for Level IV of
the Executive Schedule (formerly GS-18), to be adjusted annually. The Executive Schedule can be found at:
https://www.opm.gov/policy-data-oversight/pay-leave/salaries-wages/. This limit applies to consultation services of
designated individuals with specialized skills who are paid at a daily or hourly rate. This rate does not include
transportation and subsistence costs for travel performed. Contracts for services awarded using the procurement
requirements in Subpart D of 2 CFR 200 are not affected by this limitation unless the terms of the contract provide the
RECIPIENT with responsibility for the selection, direction, and control of the individuals who shall be providing
services under the contract at an hourly or daily rate of compensation. See 2 CFR 1500.9 for additional information.
E. Data Universal Numbering System (DUNS) and Central Contractor Registration (CCR) Requirements:
RECIPIENTs shall have a DUNS number. Unless exempted from this requirement under 2 CFR 25.110, the
RECIPIENT must ensure that the organization’s information in the System for Award Management (SAM),
https://www.sam.gov, is kept current through project closeout. This requires that the RECIPIENT reviews and updates
the information at least annually after the initial registration, and more frequently if information changes.
F. Disadvantaged Business Enterprise (DBE): General Compliance, 40 CFR, Part 33. The RECIPIENT agrees to
comply with the requirements of the Environmental Protection Agency’s Program for Utilization of Small, Minority,
and Women’s Business Enterprises (MBE/WBE) 40CFR, Part 33 in procurement under this agreement.
Six Good Faith Efforts, 40 CFR, Part 33, Subpart C. The RECIPIENT agrees to make the following good faith efforts
whenever procuring construction, equipment, services and supplies under this agreement. Records documenting
compliance with the following six good faith efforts shall be retained:
1) Ensure Disadvantaged Business Enterprises are made aware of contracting opportunities to the fullest extent
practicable through outreach and recruitment activities. For Indian Tribal, State and Local and Government
Version 10/30/2015
AGENDA ITEM #8. g)
Page 19 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
RECIPIENTs, this shall include placing Disadvantaged Business Enterprises on solicitation lists and soliciting them
whenever they are potential sources.
2) Make information on forthcoming opportunities available to Disadvantaged Business Enterprises and arrange time
frames for contracts and establish delivery schedules, where the requirements permit, in a way that encourages and
facilitates participation by Disadvantaged Business Enterprises in the competitive process. This includes, whenever
possible, posting solicitations for bids or proposals for a minimum of thirty (30) calendar days before the bid or
proposal closing date.
3) Consider in the contracting process whether firms competing for large contracts could subcontract with
Disadvantaged Business Enterprises. For Indian Tribal, and State and Local Government RECIPIENTs, this shall
include dividing total requirements when economically feasible into smaller tasks or quantities to permit maximum
participation by Disadvantaged Business Enterprises in the competitive process.
4) Encourage contracting with a consortium of Disadvantaged Business Enterprises when a contract is too large for
one of these firms to handle individually.
5) Use services and assistance of the Small Business Administration and the Minority Business Development Agency
of the Department of Commerce.
6) If the prime contractor awards subcontracts, require the prime contractor to take the five good faith efforts steps in
paragraphs 1 through 5 above.
The RECIPIENT agrees to submit ECOLOGY’s Contractor Participation Report Form D with each payment request.
Contract Administration Provisions, 40 CFR, Section 33.302. The RECIPIENT agrees to comply with the contract
administration provisions of 40 CFR, Section 33.302.
Non-discrimination Provision. The RECIPIENT shall not discriminate on the basis of race, color, national origin or
sex in the performance of this agreement. The RECIPIENT shall carry out applicable requirements of 40 CFR Part 33
in the award and administration of contracts awarded under EPA financial assistance agreements. Failure by the
RECIPIENT to carry out these requirements is a material breach of this agreement which may result in the termination
of this contract or other legally available remedies.
This does not preclude the RECIPIENT from enacting broader nondiscrimination protections.
The RECIPIENT shall comply with all federal and state nondiscrimination laws, including, but not limited to Title VI
and VII of the Civil Rights Act of 1964, Section 504 of the Rehabilitation Act of 1973, Title IX of the Education
Amendments of 1972, the Age Discrimination Act of 1975, and Chapter 49.60 RCW, Washington’s Law Against
Discrimination, and 42 U.S.C. 12101 et seq, the Americans with Disabilities Act (ADA).
In the event of the RECIPIENT’s noncompliance or refusal to comply with any applicable nondiscrimination law,
regulation, or policy, this agreement may be rescinded, canceled, or terminated in whole or in part, and the
RECIPIENT may be declared ineligible for further funding from ECOLOGY. The RECIPIENT shall, however, be
given a reasonable time in which to cure this noncompliance.
The RECIPIENT shall include the following terms and conditions in contracts with all contractors, subcontractors,
Version 10/30/2015
AGENDA ITEM #8. g)
Page 20 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
engineers, vendors, and any other entity for work or services pertaining to this agreement.
“The Contractor will not discriminate on the basis of race, color, national origin or sex in the performance of this
Contract. The Contractor will carry out applicable requirements of 40 CFR Part 33 in the award and administration of
contracts awarded under Environmental Protection Agency financial agreements. Failure by the Contractor to carry out
these requirements is a material breach of this Contract which may result in termination of this Contract or other
legally available remedies.”
Bidder List, 40 CFR, Section 33.501(b) and (c). The RECIPIENT agrees to create and maintain a bidders list. The
bidders list shall include the following information for all firms that bid or quote on prime contracts, or bid or quote
subcontracts, including both MBE/WBEs and non-MBE/WBEs.
1. Entity's name with point of contact
2. Entity's mailing address, telephone number, and e-mail address
3. The procurement on which the entity bid or quoted, and when
4. Entity's status as an MBE/WBE or non-MBE/WBE
G. Electronic and information Technology (EIT) Accessibility: RECIPIENTs shall ensure that loan funds provided
under this agreement for costs in the development or purchase of EIT systems or products provide individuals with
disabilities reasonable accommodations and an equal and effective opportunity to benefit from or participate in a
program, including those offered through electronic and information technology as per Section 504 of the
Rehabilitation Act, codified in 40 CFR Part 7. Systems or products funded under this agreement must be designed to
meet the diverse needs of users without barriers or diminished function or quality. Systems shall include usability
features or functions that accommodate the needs of persons with disabilities, including those who use assistive
technology.
H. Hotel-Motel Fire Safety Act: The RECIPIENT shall ensure that all space for conferences, meetings, conventions or
training seminars funded in whole or in part with federal funds complies with the protection and control guidelines of
the Hotel and Motel Fire Safety Act (15 USC 2225a, PL 101-391, as amended). Recipients may search the
Hotel-Motel National Master List at http://www.usfa.dhs.gov/applications/hotel/ to see if a property is in compliance,
or to find other information about the Act. Pursuant to 15 USC 2225a.
I. Trafficking In Persons: The RECIPIENT and RECIPIENT employees that are private entities shall not engage in
forms of trafficking in persons during the period of time this agreement is effective. This includes, but is not limited
to the procurement of a commercial sex act or forced labor. The RECIPIENT shall notify ECOLOGY immediately of
any information received from any source alleging a violation under this provision.
SECTION 5: THE FOLLOWING CONDITIONS APPLY TO STATE REVOLVING FUND (SRF) LOAN FUNDED
PROJECTS ONLY.
The RECIPIENT must submit the following documents/forms to ECOLOGY before this agreement is signed by
ECOLOGY:
1. Opinion of RECIPIENT’s Legal Council
2. Authorizing Ordinance or Resolution
3. Federal Funding Accountability and Transparency Act (FFATA) Form
4. CWSRF Federal Reporting Information form available in EAGL
Version 10/30/2015
AGENDA ITEM #8. g)
Page 21 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
5. Fiscal Sustainability Plan Certification (only required if the project includes construction of a wastewater or
stormwater facility construction)
A. Alteration and Eligibility of Project: During the term of this agreement, the RECIPIENT (1) shall not materially
alter the design or structural character of the project without the prior written approval of ECOLOGY and (2) shall
take no action which would adversely affect the eligibility of the project as defined by applicable funding program
rules and state statutes, or which would cause a violation of any covenant, condition, or provision herein.
B. American Iron and Steel (Buy American): This loan provision applies to projects for the construction, alteration,
maintenance, or repair of a “treatment works” as defined in the Federal Water Pollution Control Act (33 USC 1381 et
seq.) The RECIPIENT shall ensure that all iron and steel products used in the project are produced in the United
States. Iron and Steel products means the following products made primarily of iron or steel: lined or unlined pipes
and fittings, manhole covers and other municipal castings, hydrants, tanks, flanges, pipe clamps and restraints, valves,
structural steel, reinforced precast concrete, and construction materials. The RECIPIENT may request waiver from
this requirement from the Administrator of the Environmental Protection Agency. The RECIPIENT must coordinate
all waiver requests through ECOLOGY. This provision does not apply if the engineering plans and specifications for
the project were approved by ECOLOGY prior to January 17, 2014. ECOLOGY reserves the right to request
documentation of RECIPIENT’S compliance with this provision.
C. Authority of RECIPIENT: This agreement is authorized by the Constitution and laws of the state of Washington,
including the RECIPIENT’s authority, and by the RECIPIENT pursuant to the authorizing ordinance or resolution.
The RECIPIENT shall submit a copy of the authorizing ordinance or resolution to the ECOLOGY Financial Manager
before this agreement shall be signed by ECOLOGY.
D. Fiscal Sustainability Plan Certification: The RECIPIENT shall submit a completed Fiscal Sustainability Plan
Certification before this agreement is signed by ECOLOGY. The Fiscal Sustainability Plan Certification is available
from the ECOLOGY Financial Manager or on the Water Quality Program website.
E. Funding Recognition and Outreach: In addition to Section 2.F of these Terms and Conditions, the
RECIPIENT agrees to comply with the EPA SRF Signage Guidance in order to enhance public awareness of EPA
assistance agreements nationwide. The signage guidance can be found at:
http://www.ecy.wa.gov/programs/wq/funding/FundPrgms/CWSRF/SignageGuidanceJune2015.pdf.
F. Free Service: The RECIPIENT shall not furnish utility service to any customer free of charge if providing that free
service affects the RECIPIENT's ability to meet the obligations of this agreement.
G. Insurance: The RECIPIENT shall at all times carry fire and extended coverage, public liability, and property
damage, and such other forms of insurance with responsible insurers and with policies payable to the RECIPIENT on
such of the buildings, equipment, works, plants, facilities, and properties of the Utility as are ordinarily carried by
municipal or privately-owned utilities engaged in the operation of like systems, and against such claims for damages
as are ordinarily carried by municipal or privately-owned utilities engaged in the operation of like systems, or it shall
self-insure or participate in an insurance pool or pools with reserves adequate, in the reasonable judgment of the
RECIPIENT, to protect it against loss.
H. Loan Interest Rate and Terms: This loan agreement shall remain in effect until the date of final repayment of the
loan, unless terminated earlier according to the provisions herein.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 22 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
When the Project Completion Date has occurred, ECOLOGY and the RECIPIENT shall execute an amendment to this
loan agreement which details the final loan amount (Final Loan Amount), and ECOLOGY shall prepare a final loan
repayment schedule. The Final Loan Amount shall be the combined total of actual disbursements made on the loan
and all accrued interest to the computation date.
The Estimated Loan Amount and the Final Loan Amount (in either case, as applicable, a “Loan Amount”) shall bear
interest based on the interest rate identified in this agreement as the “Effective Interest Rate,” per annum, calculated on
the basis of a 365 day year. Interest on the Estimated Loan Amount shall accrue from and be compounded monthly
based on the date that each payment is mailed to the RECIPIENT. The Final Loan Amount shall be repaid in equal
installments semiannually over the term of this loan “Loan Term” as outlined in this agreement.
I. Loan Repayment:
Sources of Loan Repayment
1. Nature of RECIPIENT's Obligation. The obligation of the RECIPIENT to repay the loan from the sources
identified below and to perform and observe all of the other agreements and obligations on its part contained herein
shall be absolute and unconditional, and shall not be subject to diminution by setoff, counterclaim, or abatement of any
kind. To secure the repayment of the loan from ECOLOGY, the RECIPIENT agrees to comply with all of the
covenants, agreements, and attachments contained herein.
2. For General Obligation. This loan is a General Obligation Debt of the RECIPIENT.
3. For General Obligation Payable from Special Assessments. This loan is a General Obligation Debt of the
RECIPIENT payable from special assessments to be imposed within the constitutional and statutory tax limitations
provided by law without a vote of the electors of the RECIPIENT on all of the taxable property within the boundaries
of the RECIPIENT.
4. For Revenue-Secured: Lien Position. This loan is a Revenue-Secured Debt of the RECIPIENT’s Utility. This loan
shall constitute a lien and charge upon the Net Revenue junior and subordinate to the lien and charge upon such Net
Revenue of any Senior Lien Obligations.
In addition, if this loan is also secured by Utility Local Improvement Districts (ULID) Assessments, this loan shall
constitute a lien upon ULID Assessments in the ULID prior and superior to any other charges whatsoever.
5. Other Sources of Repayment. The RECIPIENT may repay any portion of the loan from any funds legally available
to it.
6. Defeasance of the Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT shall not be entitled to, and
shall not affect, an economic Defeasance of the loan. The RECIPIENT shall not advance refund the loan.
If the RECIPIENT defeases or advance refunds the loan, it shall be required to use the proceeds thereof immediately
upon their receipt, together with other available RECIPIENT funds, to repay both of the following:
(i) The Loan Amount with interest
(ii) Any other obligations of the RECIPIENT to ECOLOGY under this agreement, unless in its sole discretion
ECOLOGY finds that repayment from those additional sources would not be in the public interest.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 23 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Failure to repay the Loan Amount plus interest within the time specified in ECOLOGY’s notice to make such
repayment shall incur Late Charges and shall be treated as a Loan Default.
7. Refinancing or Early Repayment of the Project. So long as ECOLOGY shall hold this loan, the RECIPIENT shall
give ECOLOGY thirty days written notice if the RECIPIENT intends to refinance or make early repayment of the
loan.
Method and Conditions on Repayments
1. Semiannual Payments. Notwithstanding any other provision of this agreement, the first semiannual payment of
principal and interest on this loan shall be due and payable no later than one year after the project completion date or
initiation of operation date, whichever comes first.
Thereafter, equal payments shall be due every six months.
If the due date for any semiannual payment falls on a Saturday, Sunday, or designated holiday for Washington State
agencies, the payment shall be due on the next business day for Washington State agencies.
Payments shall be mailed to:
Department of Ecology
Cashiering Unit
P.O. Box 47611
Olympia WA 98504-7611
In lieu of mailing payments, electronic fund transfers can be arranged by working with ECOLOGY’s Financial
Manager.
No change to the amount of the semiannual principal and interest payments shall be made without a formal
amendment to this agreement. The RECIPIENT shall continue to make semiannual payments based on this agreement
until the amendment is effective, at which time the RECIPIENT’s payments shall be made pursuant to the amended
agreement.
2. Late Charges. If any amount of the Final Loan Amount or any other amount owed to ECOLOGY pursuant to this
agreement remains unpaid after it becomes due and payable, ECOLOGY may assess a late charge. The late charge
shall be one percent per month on the past due amount starting on the date the debt becomes past due and until it is
paid in full.
3. Repayment Limitations. Repayment of the loan is subject to the following additional limitations, among others:
those on defeasance, refinancing and advance refunding, termination, and default and recovery of payments.
4. Prepayment of Loan. So long as ECOLOGY shall hold this loan, the RECIPIENT may prepay the entire unpaid
principal balance of and accrued interest on the loan or any portion of the remaining unpaid principal balance of the
Loan Amount. Any prepayments on the loan shall be applied first to any accrued interest due and then to the
outstanding principal balance of the Loan Amount. If the RECIPIENT elects to prepay the entire remaining unpaid
balance and accrued interest, the RECIPIENT shall first contact ECOLOGY’s Revenue/Receivable Manager of the
Fiscal Office.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 24 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
J. Loan Security
Due Regard: For loans secured with a Revenue Obligation: The RECIPIENT shall exercise due regard for
Maintenance and Operation Expense and the debt service requirements of the Senior Lien Obligations and any other
outstanding obligations pledging the Gross Revenue of the Utility, and it has not obligated itself to set aside and pay
into the loan Fund a greater amount of the Gross Revenue of the Utility than, in its judgment, shall be available over
and above such Maintenance and Operation Expense and those debt service requirements.
Where collecting adequate gross utility revenue requires connecting additional users, the RECIPIENT shall require the
sewer system connections necessary to meet debt obligations and expected operation and maintenance expenses.
Levy and Collection of Taxes (if used to secure the repayment of the loan): For so long as the loan is outstanding, the
RECIPIENT irrevocably pledges to include in its budget and levy taxes annually within the constitutional and statutory
tax limitations provided by law without a vote of its electors on all of the taxable property within the boundaries of the
RECIPIENT in an amount sufficient, together with other money legally available and to be used therefore, to pay
when due the principal of and interest on the loan, and the full faith, credit and resources of the RECIPIENT are
pledged irrevocably for the annual levy and collection of those taxes and the prompt payment of that principal and
interest.
Not an Excess Indebtedness: For loans secured with a general obligation pledge or a general obligation pledge on
special assessments: The RECIPIENT agrees that this agreement and the loan to be made do not create an
indebtedness of the RECIPIENT in excess of any constitutional or statutory limitations.
Pledge of Net Revenue and ULID Assessments in the ULID (if used to secure the repayment of this loan): For so long
as the loan is outstanding, the RECIPIENT irrevocably pledges the Net Revenue of the Utility, including applicable
ULID Assessments in the ULID, to pay when due the principal of and interest on the loan.
Reserve Requirement: For loans that are Revenue-Secured Debt with terms greater than five years, the RECIPIENT
must accumulate a reserve for the loan equivalent to at least the Average Annual Debt Service on the loan during the
first five years of the repayment period of the loan. This amount shall be deposited in a Reserve Account in the Loan
Fund in approximately equal annual payments commencing within one year after the initiation of operation or the
project completion date, whichever comes first.
“Reserve Account” means, for a loan that constitutes Revenue-Secured Debt, an account of that name created in the
Loan Fund to secure the payment of the principal and interest on the loan. The amount on deposit in the Reserve
Account may be applied by the RECIPIENT (1) to make, in part or in full, the final repayment to ECOLOGY of the
loan amount or, (2) if not so applied, for any other lawful purpose of the RECIPIENT once the Loan Amount, plus
interest and any other amounts owing to ECOLOGY, have been paid in full.
Utility Local Improvement District (ULID) Assessment Collection (if used to secure the repayment of the loan): All
ULID Assessments in the ULID shall be paid into the loan Fund and used to pay the principal of and interest on the
loan. The ULID Assessments in the ULID may be deposited into the Reserve Account to satisfy a Reserve
Requirement if a Reserve Requirement is applicable.
K. Maintenance and Operation of a Funded Utility: The RECIPIENT shall at all times maintain and keep a funded
Utility in good repair, working order and condition and also shall at all times operate the Utility and the business in an
efficient manner and at a reasonable cost.
L. Opinion of RECIPIENT’s Legal Counsel: The RECIPIENT must submit an “Opinion of Legal Counsel to the
Version 10/30/2015
AGENDA ITEM #8. g)
Page 25 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
RECIPIENT” to ECOLOGY before this agreement shall be signed. ECOLOGY will provide the form.
M. Prevailing Wage (Davis-Bacon Act): The RECIPIENT agrees, by signing this agreement, to comply with the
Davis-Bacon Act prevailing wage requirements. This applies to the construction, alteration, and repair of treatment
works carried out in whole or in part with assistance made available by the State Revolving Fund as authorized by
Section 513, title VI of the Federal Water Pollution Control Act (33 U.S.C. 1372). Laborers and mechanics employed
by contractors and subcontractors shall be paid wages not less often than once a week and at rates not less than those
prevailing on projects of a character similar in the locality as determined by the Secretary of Labor.
The RECIPIENT shall obtain the wage determination for the area in which the project is located prior to issuing
requests for bids, proposals, quotes or other methods for soliciting contracts (solicitation). These wage determinations
shall be incorporated into solicitations and any subsequent contracts. The RECIPIENT shall ensure that the required
EPA contract language regarding Davis-Bacon Wages is in all contracts and sub contracts in excess of $2,000. The
RECIPIENT shall maintain records sufficient to document compliance with the Davis-Bacon Act, and make such
records available for review upon request.
The RECIPIENT also agrees, by signing this agreement, to comply with State Prevailing Wages on Public Works,
Chapter 39.12 RCW, as applicable. Compliance may include the determination whether the project involves “public
work” and inclusion of the applicable prevailing wage rates in the bid specifications and contracts. The RECIPIENT
agrees to maintain records sufficient to evidence compliance with Chapter 39.12 RCW, and make such records
available for review upon request.
N. Litigation; Authority: No litigation is now pending, or to the RECIPIENT’s knowledge, threatened, seeking to
restrain, or enjoin:
(i) the execution of this agreement; or
(ii) the fixing or collection of the revenues, rates, and charges or the formation of the ULID and the levy and collection
of ULID Assessments therein pledged to pay the principal of and interest on the loan (for revenue secured lien
obligations); or
(iii) the levy and collection of the taxes pledged to pay the principal of and interest on the loan (for general
obligation-secured loans and general obligation payable from special-assessment-secured loans); or
(iv) in any manner questioning the proceedings and authority under which the agreement, the loan, or the project are
authorized. Neither the corporate existence or boundaries of the RECIPIENT nor the title of its present officers to
their respective offices is being contested. No authority or proceeding for the execution of this agreement has been
repealed, revoked, or rescinded.
O. Representations and Warranties: The RECIPIENT represents and warrants to ECOLOGY as follows:
Application: Material Information. All information and materials submitted by the RECIPIENT to ECOLOGY in
connection with its loan application were, when made, and are, as of the date the RECIPIENT signs this agreement,
true and correct. There is no material adverse information relating to the RECIPIENT, the project, the loan, or this
agreement known to the RECIPIENT which has not been disclosed in writing to ECOLOGY.
Existence; Authority. It is a duly formed and legally existing municipal corporation or political subdivision of the
Version 10/30/2015
AGENDA ITEM #8. g)
Page 26 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
state of Washington or a federally recognized Indian Tribe. It has full corporate power and authority to execute,
deliver, and perform all of its obligations under this agreement and to undertake the project identified herein.
Certification. Each payment request shall constitute a certification by the RECIPIENT to the effect that all
representations and warranties made in this loan agreement remain true as of the date of the request and that no
adverse developments, affecting the financial condition of the RECIPIENT or its ability to complete the project or to
repay the principal of or interest on the loan, have occurred since the date of this loan agreement. Any changes in the
RECIPIENT’s financial condition shall be disclosed in writing to ECOLOGY by the RECIPIENT in its request for
payment.
P. Sale or Disposition of Utility: The RECIPIENT shall not sell, transfer, or otherwise dispose of any of the works,
plant, properties, facilities, or other part of the Utility or any real or personal property comprising a part of the Utility
unless:
1. The facilities or property transferred are not material to the operation of the Utility, or have become unserviceable,
inadequate, obsolete, or unfit to be used in the operation of the Utility or are no longer necessary, material, or useful to
the operation of the Utility; or
2. The aggregate depreciated cost value of the facilities or property being transferred in any fiscal year comprises no
more than three percent of the total assets of the Utility; or
3. The RECIPIENT receives from the transferee an amount equal to an amount which will be in the same proportion
to the net amount of Senior Lien Obligations and this LOAN then outstanding (defined as the total amount outstanding
less the amount of cash and investments in the bond and loan funds securing such debt) as the Gross Revenue of the
Utility from the portion of the Utility sold or disposed of for the preceding year bears to the total Gross Revenue for
that period.
4. Expressed written agreement by the DEPARTMENT.
The proceeds of any transfer under this paragraph must be used (1) to redeem promptly, or irrevocably set aside for the
redemption of, Senior Lien Obligations and to redeem promptly the loan, and (2) to provide for part of the cost of
additions to and betterments and extensions of the Utility.
Q. Sewer-Use Ordinance or Resolution: If not already in existence, the RECIPIENT shall adopt and shall enforce a
sewer-use ordinance or resolution. Such ordinance or resolution shall be submitted to ECOLOGY upon request.
The sewer use ordinance must include provisions to:
1) Prohibit the introduction of toxic or hazardous wastes into the RECIPIENT’s sewer system.
2) Prohibit inflow of stormwater.
3) Require that new sewers and connections be properly designed and constructed.
R. Termination and Default:
Termination and Default Events
1. For Insufficient ECOLOGY or RECIPIENT Funds. ECOLOGY may terminate this loan agreement for insufficient
ECOLOGY or RECIPIENT funds.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 27 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
2. For Failure to Commence Work. ECOLOGY may terminate this loan agreement for failure of the RECIPIENT to
commence project work.
3. Past Due Payments. The RECIPIENT shall be in default of its obligations under this loan agreement when any loan
repayment becomes 60 days past due.
4. Other Cause. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance in full
by the RECIPIENT of all of its obligations under this loan agreement. The RECIPIENT shall be in default of its
obligations under this loan agreement if, in the opinion of ECOLOGY, the RECIPIENT has unjustifiably failed to
perform any obligation required of it by this loan agreement.
Procedures for Termination. If this loan agreement is terminated prior to project completion, ECOLOGY shall provide
to the RECIPIENT a written notice of termination at least five working days prior to the effective date of termination
(the “Termination Date”). The written notice of termination by the ECOLOGY shall specify the Termination Date
and, when applicable, the date by which the RECIPIENT must repay any outstanding balance of the loan and all
accrued interest (the “Termination Payment Date”).
Termination and Default Remedies
No Further Payments. On and after the Termination Date, or in the event of a default event, ECOLOGY may, at its
sole discretion, withdraw the loan and make no further payments under this agreement.
Repayment Demand. In response to an ECOLOGY initiated termination event, or in response to a loan default event,
ECOLOGY may at its sole discretion demand that the RECIPIENT repay the outstanding balance of the Loan Amount
and all accrued interest.
Interest after Repayment Demand. From the time that ECOLOGY demands repayment of funds, amounts owed by the
RECIPIENT to ECOLOGY shall accrue additional interest at the rate of one percent per month, or fraction thereof.
Accelerate Repayments. In the event of a default, ECOLOGY may, in its sole discretion, declare the principal of and
interest on the loan immediately due and payable, subject to the prior lien and charge of any outstanding Senior Lien
Obligation upon the Net Revenue. That is, the loan is not subject to acceleration so long as any Senior Lien
Obligations are outstanding. Repayments not made immediately upon such acceleration will incur Late Charges.
Late Charges. All amounts due to ECOLOGY and not paid by the RECIPIENT by the Termination Payment Date or
after acceleration following a default event, as applicable, shall incur late charges.
Intercept State Funds. In the event of a default event and in accordance with Chapter 90.50A.060 RCW, “Defaults,”
any state funds otherwise due to the RECIPIENT may, at ECOLOGY’s sole discretion, be withheld and applied to the
repayment of the loan.
Property to ECOLOGY. In the event of a default event and at the option of ECOLOGY, any personal property
(equipment) acquired under this agreement may, in ECOLOGY’s sole discretion, become ECOLOGY’s property. In
that circumstance, ECOLOGY shall reduce the RECIPIENT’s liability to repay money by an amount reflecting the fair
value of such property.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 28 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
Documents and Materials. If this agreement is terminated, all finished or unfinished documents, data studies, surveys,
drawings, maps, models, photographs, and reports or other materials prepared by the RECIPIENT shall, at the option
of ECOLOGY, become ECOLOGY property. The RECIPIENT shall be entitled to receive just and equitable
compensation for any satisfactory work completed on such documents and other materials.
Collection and Enforcement Actions. In the event of a default event, the state of Washington reserves the right to take
any actions it deems necessary to collect the amounts due, or to become due, or to enforce the performance and
observance of any obligation by the RECIPIENT, under this agreement.
Fees and Expenses. In any action to enforce the provisions of this agreement, reasonable fees and expenses of
attorneys and other reasonable expenses (including, without limitation, the reasonably allocated costs of legal staff)
shall be awarded to the prevailing party as that term is defined in Chapter 4.84.330 RCW.
Damages. Notwithstanding ECOLOGY’s exercise of any or all of the termination or default remedies provided in this
agreement, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by ECOLOGY
and/or the state of Washington because of any breach of this agreement by the RECIPIENT. ECOLOGY may
withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from the
RECIPIENT is determined.
S. User-Charge System: The RECIPIENT certifies that it has the legal authority to establish and implement a
user-charge system and shall adopt a system of user-charges to assure that each user of the utility shall pay its
proportionate share of the cost of operation and maintenance, including replacement during the design life of the
project.
In addition, the RECIPIENT shall regularly evaluate the user-charge system, at least annually, to ensure the system
provides adequate revenues necessary to operate and maintain the utility, to establish a reserve to pay for replacement,
to establish the required Loan Reserve Account, and to repay the loan.
WATER QUALITY COMBINED FINANCIAL ASSISTANCE TERMS AND CONDITIONS LAST UPDATED ON
10/04/2016
GENERAL FEDERAL CONDITIONS
If a portion or all of the funds for this agreement are provided through federal funding sources or this
agreement is used to match a federal grant award, the following terms and conditions apply to you.
A. CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY
EXCLUSION:
1.The RECIPIENT/CONTRACTOR, by signing this agreement, certifies that it is not suspended, debarred,
proposed for debarment, declared ineligible or otherwise excluded from contracting with the federal
government, or from receiving contracts paid for with federal funds. If the RECIPIENT/CONTRACTOR is
unable to certify to the statements contained in the certification, they must provide an explanation as to why they
cannot.
2.The RECIPIENT/CONTRACTOR shall provide immediate written notice to ECOLOGY if at any time the
RECIPIENT/CONTRACTOR learns that its certification was erroneous when submitted or had become
erroneous by reason of changed circumstances.
3.The terms covered transaction, debarred, suspended, ineligible, lower tier covered transaction, participant,
Version 10/30/2015
AGENDA ITEM #8. g)
Page 29 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
person, primary covered transaction, principal, proposal, and voluntarily excluded, as used in this clause, have
the meaning set out in the Definitions and Coverage sections of rules implementing Executive Order 12549.
You may contact ECOLOGY for assistance in obtaining a copy of those regulations.
4.The RECIPIENT/CONTRACTOR agrees it shall not knowingly enter into any lower tier covered transaction
with a person who is proposed for debarment under the applicable Code of Federal Regulations, debarred,
suspended, declared ineligible, or voluntarily excluded from participation in this covered transaction.
5.The RECIPIENT/CONTRACTOR further agrees by signing this agreement, that it will include this clause titled
“CERTIFICATION REGARDING SUSPENSION, DEBARMENT, INELIGIBILITY OR VOLUNTARY
EXCLUSION” without modification in all lower tier covered transactions and in all solicitations for lower tier
covered transactions.
6.Pursuant to 2CFR180.330, the RECIPIENT/CONTRACTOR is responsible for ensuring that any lower tier
covered transaction complies with certification of suspension and debarment requirements.
7.RECIPIENT/CONTRACTOR acknowledges that failing to disclose the information required in the Code of
Federal Regulations may result in the delay or negation of this funding agreement, or pursuance of legal
remedies, including suspension and debarment.
8.RECIPIENT/CONTRACTOR agrees to keep proof in its agreement file, that it, and all lower tier recipients or
contractors, are not suspended or debarred, and will make this proof available to ECOLOGY before requests for
reimbursements will be approved for payment. RECIPIENT/CONTRACTOR must run a search in
<http://www.sam.gov> and print a copy of completed searches to document proof of compliance.
B. FEDERAL FUNDING ACCOUNTABILITY AND TRANSPARENCY ACT (FFATA) REPORTING
REQUIREMENTS:
CONTRACTOR/RECIPIENT must complete the FFATA Data Collection Form (ECY 070-395) and return it
with the signed agreement to ECOLOGY.
Any CONTRACTOR/RECIPIENT that meets each of the criteria below must report compensation for its five
top executives using the FFATA Data Collection Form.
·Receives more than $25,000 in federal funds under this award.
·Receives more than 80 percent of its annual gross revenues from federal funds.
·Receives more than $25,000,000 in annual federal funds.
Ecology will not pay any invoices until it has received a completed and signed FFATA Data Collection Form.
Ecology is required to report the FFATA information for federally funded agreements, including the required
DUNS number, at www.fsrs.gov <http://www.fsrs.gov/> within 30 days of agreement signature. The FFATA
information will be available to the public at www.usaspending.gov <http://www.usaspending.gov/>.
For more details on FFATA requirements, see www.fsrs.gov <http://www.fsrs.gov/>.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 30 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
GENERAL TERMS AND CONDITIONS
Pertaining to Grant and Loan Agreements With the state of Washington, Department of Ecology
GENERAL TERMS AND CONDITIONS AS OF LAST UPDATED 1/22/2018 VERSION
1.ADMINISTRATIVE REQUIREMENTS
a)RECIPIENT shall follow the "Administrative Requirements for Recipients of Ecology Grants and Loans – EAGL
Edition." (https://fortress.wa.gov/ecy/publications/SummaryPages/1701004.html)
b)RECIPIENT shall complete all activities funded by this Agreement and be fully responsible for the proper
management of all funds and resources made available under this Agreement.
c)RECIPIENT agrees to take complete responsibility for all actions taken under this Agreement, including ensuring
all subgrantees and contractors comply with the terms and conditions of this Agreement. ECOLOGY reserves the right
to request proof of compliance by subgrantees and contractors.
d)RECIPIENT’s activities under this Agreement shall be subject to the review and approval by ECOLOGY for the
extent and character of all work and services.
2.AMENDMENTS AND MODIFICATIONS
This Agreement may be altered, amended, or waived only by a written amendment executed by both parties. No
subsequent modification(s) or amendment(s) of this Agreement will be of any force or effect unless in writing and
signed by authorized representatives of both parties. ECOLOGY and the RECIPIENT may change their respective staff
contacts and administrative information without the concurrence of either party.
3.ARCHAEOLOGICAL AND CULTURAL RESOURCES
RECIPIENT shall take reasonable action to avoid, minimize, or mitigate adverse effects to archeological and historic
resources. The RECIPIENT must agree to hold harmless the State of Washington in relation to any claim related to
historical or cultural artifacts discovered, disturbed, or damaged due to the RECIPIENT’s project funded under this
Agreement.
RECIPIENT shall:
a)Contact the ECOLOGY Program issuing the grant or loan to discuss any Cultural Resources requirements for their
project:
•For capital construction projects or land acquisitions for capital construction projects, if required, comply with
Governor Executive Order 05-05, Archaeology and Cultural Resources.
•For projects with any federal involvement, if required, comply with the National Historic Preservation Act.
•Any cultural resources federal or state requirements must be completed prior to the start of any work on the project
site.
b)If required by the ECOLOGY Program, submit an Inadvertent Discovery Plan (IDP) to ECOLOGY prior to
implementing any project that involves ground disturbing activities. ECOLOGY will provide the IDP form.
RECIPIENT shall:
•Keep the IDP at the project site.
•Make the IDP readily available to anyone working at the project site.
•Discuss the IDP with staff and contractors working at the project site.
•Implement the IDP when cultural resources or human remains are found at the project site.
c)If any archeological or historic resources are found while conducting work under this Agreement:
•Immediately stop work and notify the ECOLOGY Program, the Department of Archaeology and Historic
Preservation at (360) 586-3064, any affected Tribe, and the local government.
d)If any human remains are found while conducting work under this Agreement:
Version 10/30/2015
AGENDA ITEM #8. g)
Page 31 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
•Immediately stop work and notify the local Law Enforcement Agency or Medical Examiner/Coroner’s Office, and
then the ECOLOGY Program.
e)Comply with RCW 27.53, RCW 27.44.055, and RCW 68.50.645, and all other applicable local, state, and federal
laws protecting cultural resources and human remains.
4.ASSIGNMENT
No right or claim of the RECIPIENT arising under this Agreement shall be transferred or assigned by the RECIPIENT.
5.COMMUNICATION
RECIPIENT shall make every effort to maintain effective communications with the RECIPIENT's designees,
ECOLOGY, all affected local, state, or federal jurisdictions, and any interested individuals or groups.
6.COMPENSATION
a)Any work performed prior to effective date of this Agreement will be at the sole expense and risk of the
RECIPIENT. ECOLOGY must sign the Agreement before any payment requests can be submitted.
b)Payments will be made on a reimbursable basis for approved and completed work as specified in this Agreement.
c)RECIPIENT is responsible to determine if costs are eligible. Any questions regarding eligibility should be clarified
with ECOLOGY prior to incurring costs. Costs that are conditionally eligible require approval by ECOLOGY prior to
expenditure.
d)RECIPIENT shall not invoice more than once per month unless agreed on by ECOLOGY.
e)ECOLOGY will not process payment requests without the proper reimbursement forms, Progress Report and
supporting documentation. ECOLOGY will provide instructions for submitting payment requests.
f)ECOLOGY will pay the RECIPIENT thirty (30) days after receipt of a properly completed request for payment.
g)RECIPIENT will receive payment through Washington State Department of Enterprise Services’ Statewide Payee
Desk. RECIPIENT must register as a payee by submitting a Statewide Payee Registration form and an IRS W-9 form
at the website, http://www.des.wa.gov/services/ContractingPurchasing/Business/VendorPay/Pages/default.aspx. For
any questions about the vendor registration process contact the Statewide Payee Help Desk at (360) 407-8180 or email
payeehelpdesk@watech.wa.gov.
h)ECOLOGY may, at its sole discretion, withhold payments claimed by the RECIPIENT if the RECIPIENT fails to
satisfactorily comply with any term or condition of this Agreement.
i)Monies withheld by ECOLOGY may be paid to the RECIPIENT when the work described herein, or a portion
thereof, has been completed if, at ECOLOGY's sole discretion, such payment is reasonable and approved according to
this Agreement, as appropriate, or upon completion of an audit as specified herein.
j)RECIPIENT must submit within thirty (30) days after the expiration date of this Agreement, all financial,
performance, and other reports required by this agreement. Failure to comply may result in delayed reimbursement.
7.COMPLIANCE WITH ALL LAWS
RECIPIENT agrees to comply fully with all applicable federal, state and local laws, orders, regulations, and permits
related to this Agreement, including but not limited to:
a)RECIPIENT agrees to comply with all applicable laws, regulations, and policies of the United States and the State
of Washington which affect wages and job safety.
b)RECIPIENT agrees to be bound by all applicable federal and state laws, regulations, and policies against
discrimination.
c)RECIPIENT certifies full compliance with all applicable state industrial insurance requirements.
d)RECIPIENT agrees to secure and provide assurance to ECOLOGY that all the necessary approvals and permits
required by authorities having jurisdiction over the project are obtained. RECIPIENT must include time in their project
timeline for the permit and approval processes.
Version 10/30/2015
AGENDA ITEM #8. g)
Page 32 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
ECOLOGY shall have the right to immediately terminate for cause this Agreement as provided herein if the
RECIPIENT fails to comply with above requirements.
If any provision of this Agreement violates any statute or rule of law of the state of Washington, it is considered
modified to conform to that statute or rule of law.
8.CONFLICT OF INTEREST
RECIPIENT and ECOLOGY agree that any officer, member, agent, or employee, who exercises any function or
responsibility in the review, approval, or carrying out of this Agreement, shall not have any personal or financial
interest, direct or indirect, nor affect the interest of any corporation, partnership, or association in which he/she is a part,
in this Agreement or the proceeds thereof.
9.CONTRACTING FOR GOODS AND SERVICES
RECIPIENT may contract to buy goods or services related to its performance under this Agreement. RECIPIENT shall
award all contracts for construction, purchase of goods, equipment, services, and professional architectural and
engineering services through a competitive process, if required by State law. RECIPIENT is required to follow
procurement procedures that ensure legal, fair, and open competition.
RECIPIENT must have a standard procurement process or follow current state procurement procedures. RECIPIENT
may be required to provide written certification that they have followed their standard procurement procedures and
applicable state law in awarding contracts under this Agreement.
ECOLOGY reserves the right to inspect and request copies of all procurement documentation, and review procurement
practices related to this Agreement. Any costs incurred as a result of procurement practices not in compliance with
state procurement law or the RECIPIENT's normal procedures may be disallowed at ECOLOGY’s sole discretion.
10.DISPUTES
When there is a dispute with regard to the extent and character of the work, or any other matter related to this
Agreement the determination of ECOLOGY will govern, although the RECIPIENT shall have the right to appeal
decisions as provided for below:
a)RECIPIENT notifies the funding program of an appeal request.
b)Appeal request must be in writing and state the disputed issue(s).
c)RECIPIENT has the opportunity to be heard and offer evidence in support of its appeal.
d)ECOLOGY reviews the RECIPIENT’s appeal.
e)ECOLOGY sends a written answer within ten (10) business days, unless more time is needed, after concluding the
review.
The decision of ECOLOGY from an appeal will be final and conclusive, unless within thirty (30) days from the date of
such decision, the RECIPIENT furnishes to the Director of ECOLOGY a written appeal. The decision of the Director or
duly authorized representative will be final and conclusive.
The parties agree that this dispute process will precede any action in a judicial or quasi-judicial tribunal.
Appeals of the Director's decision will be brought in the Superior Court of Thurston County. Review of the Director’s
decision will not be taken to Environmental and Land Use Hearings Office.
Pending final decision of a dispute, the RECIPIENT agrees to proceed diligently with the performance of this
Agreement and in accordance with the decision rendered.
Nothing in this Agreement will be construed to limit the parties’ choice of another mutually acceptable method, in
addition to the dispute resolution procedure outlined above.
11.ENVIRONMENTAL DATA STANDARDS
a)RECIPIENT shall prepare a Quality Assurance Project Plan (QAPP) for a project that collects or uses
environmental measurement data. RECIPIENTS unsure about whether a QAPP is required for their project shall contact
Version 10/30/2015
AGENDA ITEM #8. g)
Page 33 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
the ECOLOGY Program issuing the grant or loan. If a QAPP is required, the RECIPIENT shall:
•Use ECOLOGY’s QAPP Template/Checklist provided by the ECOLOGY, unless ECOLOGY Quality Assurance
(QA) officer or the Program QA coordinator instructs otherwise.
•Follow ECOLOGY’s Guidelines for Preparing Quality Assurance Project Plans for Environmental Studies, July
2004 (Ecology Publication No. 04-03-030).
•Submit the QAPP to ECOLOGY for review and approval before the start of the work.
b)RECIPIENT shall submit environmental data that was collected on a project to ECOLOGY using the
Environmental Information Management system (EIM), unless the ECOLOGY Program instructs otherwise. The
RECIPIENT must confirm with ECOLOGY that complete and correct data was successfully loaded into EIM, find
instructions at: http://www.ecy.wa.gov/eim.
c)RECIPIENT shall follow ECOLOGY’s data standards when Geographic Information System (GIS) data is collected
and processed. Guidelines for Creating and Accessing GIS Data are available at:
https://ecology.wa.gov/Research-Data/Data-resources/Geographic-Information-Systems-GIS/Standards. RECIPIENT,
when requested by ECOLOGY, shall provide copies to ECOLOGY of all final GIS data layers, imagery, related tables,
raw data collection files, map products, and all metadata and project documentation.
12.GOVERNING LAW
This Agreement will be governed by the laws of the State of Washington, and the venue of any action brought
hereunder will be in the Superior Court of Thurston County.
13.INDEMNIFICATION
ECOLOGY will in no way be held responsible for payment of salaries, consultant's fees, and other costs related to the
project described herein, except as provided in the Scope of Work.
To the extent that the Constitution and laws of the State of Washington permit, each party will indemnify and hold the
other harmless from and against any liability for any or all injuries to persons or property arising from the negligent act
or omission of that party or that party's agents or employees arising out of this Agreement.
14.INDEPENDENT STATUS
The employees, volunteers, or agents of each party who are engaged in the performance of this Agreement will continue
to be employees, volunteers, or agents of that party and will not for any purpose be employees, volunteers, or agents of
the other party.
15.KICKBACKS
RECIPIENT is prohibited from inducing by any means any person employed or otherwise involved in this Agreement
to give up any part of the compensation to which he/she is otherwise entitled to or receive any fee, commission, or gift
in return for award of a subcontract hereunder.
16.MINORITY AND WOMEN’S BUSINESS ENTERPRISES (MWBE)
RECIPIENT is encouraged to solicit and recruit, to the extent possible, certified minority-owned (MBE) and
women-owned (WBE) businesses in purchases and contracts initiated under this Agreement.
Contract awards or rejections cannot be made based on MWBE participation; however, the RECIPIENT is encouraged
to take the following actions, when possible, in any procurement under this Agreement:
a)Include qualified minority and women's businesses on solicitation lists whenever they are potential sources of goods
or services.
b)Divide the total requirements, when economically feasible, into smaller tasks or quantities, to permit maximum
participation by qualified minority and women's businesses.
c)Establish delivery schedules, where work requirements permit, which will encourage participation of qualified
Version 10/30/2015
AGENDA ITEM #8. g)
Page 34 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
minority and women's businesses.
d)Use the services and assistance of the Washington State Office of Minority and Women's Business Enterprises
(OMWBE) (866-208-1064) and the Office of Minority Business Enterprises of the U.S. Department of Commerce, as
appropriate.
17.ORDER OF PRECEDENCE
In the event of inconsistency in this Agreement, unless otherwise provided herein, the inconsistency shall be resolved
by giving precedence in the following order: (a) applicable federal and state statutes and regulations; (b) The
Agreement; (c) Scope of Work; (d) Special Terms and Conditions; (e) Any provisions or terms incorporated herein by
reference, including the "Administrative Requirements for Recipients of Ecology Grants and Loans"; and (f) the
General Terms and Conditions.
18.PRESENTATION AND PROMOTIONAL MATERIALS
ECOLOGY reserves the right to approve RECIPIENT’s communication documents and materials related to the
fulfillment of this Agreement:
a)If requested, RECIPIENT shall provide a draft copy to ECOLOGY for review and approval ten (10) business days
prior to production and distribution.
b)RECIPIENT shall include time for ECOLOGY’s review and approval process in their project timeline.
c)If requested, RECIPIENT shall provide ECOLOGY two (2) final copies and an electronic copy of any tangible
products developed.
Copies include any printed materials, and all tangible products developed such as brochures, manuals, pamphlets,
videos, audio tapes, CDs, curriculum, posters, media announcements, or gadgets with a message, such as a refrigerator
magnet, and any online communications, such as web pages, blogs, and twitter campaigns. If it is not practical to
provide a copy, then the RECIPIENT shall provide a description (photographs, drawings, printouts, etc.) that best
represents the item.
Any communications intended for public distribution that uses ECOLOGY’s logo shall comply with ECOLOGY’s
graphic requirements and any additional requirements specified in this Agreement. Before the use of ECOLOGY’s
logo contact ECOLOGY for guidelines.
RECIPIENT shall acknowledge in the communications that funding was provided by ECOLOGY.
19.PROGRESS REPORTING
a)RECIPIENT must satisfactorily demonstrate the timely use of funds by submitting payment requests and progress
reports to ECOLOGY. ECOLOGY reserves the right to amend or terminate this Agreement if the RECIPIENT does
not document timely use of funds.
b)RECIPIENT must submit a progress report with each payment request. Payment requests will not be processed
without a progress report. ECOLOGY will define the elements and frequency of progress reports.
c)RECIPIENT shall use ECOLOGY’s provided progress report format.
d)Quarterly progress reports will cover the periods from January 1 through March 31, April 1 through June 30, July 1
through September 30, and October 1 through December 31. Reports shall be submitted within thirty (30) days after
the end of the quarter being reported.
e)RECIPIENT must submit within thirty (30) days of the expiration date of the project, unless an extension has been
approved by ECOLOGY, all financial, performance, and other reports required by the agreement and funding program
guidelines. RECIPIENT shall use the ECOLOGY provided closeout report format.
20.PROPERTY RIGHTS
a)Copyrights and Patents. When the RECIPIENT creates any copyrightable materials or invents any patentable
property under this Agreement, the RECIPIENT may copyright or patent the same but ECOLOGY retains a royalty free,
nonexclusive, and irrevocable license to reproduce, publish, recover, or otherwise use the material(s) or property, and to
Version 10/30/2015
AGENDA ITEM #8. g)
Page 35 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
authorize others to use the same for federal, state, or local government purposes.
b)Publications. When the RECIPIENT or persons employed by the RECIPIENT use or publish ECOLOGY
information; present papers, lectures, or seminars involving information supplied by ECOLOGY; or use logos, reports,
maps, or other data in printed reports, signs, brochures, pamphlets, etc., appropriate credit shall be given to ECOLOGY.
c)Presentation and Promotional Materials. ECOLOGY shall have the right to use or reproduce any printed or graphic
materials produced in fulfillment of this Agreement, in any manner ECOLOGY deems appropriate. ECOLOGY shall
acknowledge the RECIPIENT as the sole copyright owner in every use or reproduction of the materials.
d)Tangible Property Rights. ECOLOGY's current edition of "Administrative Requirements for Recipients of Ecology
Grants and Loans," shall control the use and disposition of all real and personal property purchased wholly or in part
with funds furnished by ECOLOGY in the absence of state and federal statutes, regulations, or policies to the contrary,
or upon specific instructions with respect thereto in this Agreement.
e)Personal Property Furnished by ECOLOGY. When ECOLOGY provides personal property directly to the
RECIPIENT for use in performance of the project, it shall be returned to ECOLOGY prior to final payment by
ECOLOGY. If said property is lost, stolen, or damaged while in the RECIPIENT's possession, then ECOLOGY shall
be reimbursed in cash or by setoff by the RECIPIENT for the fair market value of such property.
f)Acquisition Projects. The following provisions shall apply if the project covered by this Agreement includes funds
for the acquisition of land or facilities:
1.RECIPIENT shall establish that the cost is fair value and reasonable prior to disbursement of funds provided for in
this Agreement.
2.RECIPIENT shall provide satisfactory evidence of title or ability to acquire title for each parcel prior to
disbursement of funds provided by this Agreement. Such evidence may include title insurance policies, Torrens
certificates, or abstracts, and attorney's opinions establishing that the land is free from any impediment, lien, or claim
which would impair the uses intended by this Agreement.
g)Conversions. Regardless of the Agreement expiration date, the RECIPIENT shall not at any time convert any
equipment, property, or facility acquired or developed under this Agreement to uses other than those for which
assistance was originally approved without prior written approval of ECOLOGY. Such approval may be conditioned
upon payment to ECOLOGY of that portion of the proceeds of the sale, lease, or other conversion or encumbrance
which monies granted pursuant to this Agreement bear to the total acquisition, purchase, or construction costs of such
property.
21.RECORDS, AUDITS, AND INSPECTIONS
RECIPIENT shall maintain complete program and financial records relating to this Agreement, including any
engineering documentation and field inspection reports of all construction work accomplished.
All records shall:
a)Be kept in a manner which provides an audit trail for all expenditures.
b)Be kept in a common file to facilitate audits and inspections.
c)Clearly indicate total receipts and expenditures related to this Agreement.
d)Be open for audit or inspection by ECOLOGY, or by any duly authorized audit representative of the State of
Washington, for a period of at least three (3) years after the final grant payment or loan repayment, or any dispute
resolution hereunder.
RECIPIENT shall provide clarification and make necessary adjustments if any audits or inspections identify
discrepancies in the records.
ECOLOGY reserves the right to audit, or have a designated third party audit, applicable records to ensure that the state
has been properly invoiced. Any remedies and penalties allowed by law to recover monies determined owed will be
enforced. Repetitive instances of incorrect invoicing or inadequate records may be considered cause for termination.
All work performed under this Agreement and any property and equipment purchased shall be made available to
ECOLOGY and to any authorized state, federal or local representative for inspection at any time during the course of
Version 10/30/2015
AGENDA ITEM #8. g)
Page 36 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
this Agreement and for at least three (3) years following grant or loan termination or dispute resolution hereunder.
RECIPIENT shall provide right of access to ECOLOGY, or any other authorized representative, at all reasonable times,
in order to monitor and evaluate performance, compliance, and any other conditions under this Agreement.
22.RECOVERY OF FUNDS
The right of the RECIPIENT to retain monies received as reimbursement payments is contingent upon satisfactory
performance of this Agreement and completion of the work described in the Scope of Work.
All payments to the RECIPIENT are subject to approval and audit by ECOLOGY, and any unauthorized expenditure(s)
or unallowable cost charged to this Agreement shall be refunded to ECOLOGY by the RECIPIENT.
RECIPIENT shall refund to ECOLOGY the full amount of any erroneous payment or overpayment under this
Agreement.
RECIPIENT shall refund by check payable to ECOLOGY the amount of any such reduction of payments or repayments
within thirty (30) days of a written notice. Interest will accrue at the rate of twelve percent (12%) per year from the
time ECOLOGY demands repayment of funds.
Any property acquired under this Agreement, at the option of ECOLOGY, may become ECOLOGY's property and the
RECIPIENT's liability to repay monies will be reduced by an amount reflecting the fair value of such property.
23.SEVERABILITY
If any provision of this Agreement or any provision of any document incorporated by reference shall be held invalid,
such invalidity shall not affect the other provisions of this Agreement which can be given effect without the invalid
provision, and to this end the provisions of this Agreement are declared to be severable.
24.STATE ENVIRONMENTAL POLICY ACT (SEPA)
RECIPIENT must demonstrate to ECOLOGY’s satisfaction that compliance with the requirements of the State
Environmental Policy Act (Chapter 43.21C RCW and Chapter 197-11 WAC) have been or will be met. Any
reimbursements are subject to this provision.
25.SUSPENSION
When in the best interest of ECOLOGY, ECOLOGY may at any time, and without cause, suspend this Agreement or
any portion thereof for a temporary period by written notice from ECOLOGY to the RECIPIENT. RECIPIENT shall
resume performance on the next business day following the suspension period unless another day is specified by
ECOLOGY.
26.SUSTAINABLE PRACTICES
In order to sustain Washington’s natural resources and ecosystems, the RECIPIENT is fully encouraged to implement
sustainable practices and to purchase environmentally preferable products under this Agreement.
a)Sustainable practices may include such activities as: use of clean energy, use of double-sided printing, hosting low
impact meetings, and setting up recycling and composting programs.
b)Purchasing may include such items as: sustainably produced products and services, EPEAT registered computers
and imaging equipment, independently certified green cleaning products, remanufactured toner cartridges, products
with reduced packaging, office products that are refillable, rechargeable, and recyclable, and 100% post-consumer
recycled paper.
For more suggestions visit ECOLOGY’s web page: Green Purchasing, ,
https://ecology.wa.gov/Regulations-Permits/Guidance-technical-assistance/Sustainable-purchasing.
27.TERMINATION
a)For Cause
ECOLOGY may terminate for cause this Agreement with a seven (7) calendar days prior written notification to the
Version 10/30/2015
AGENDA ITEM #8. g)
Page 37 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
RECIPIENT, at the sole discretion of ECOLOGY, for failing to perform an Agreement requirement or for a material
breach of any term or condition. If this Agreement is so terminated, the parties shall be liable only for performance
rendered or costs incurred in accordance with the terms of this Agreement prior to the effective date of termination.
Failure to Commence Work. ECOLOGY reserves the right to terminate this Agreement if RECIPIENT fails to
commence work on the project funded within four (4) months after the effective date of this Agreement, or by any date
mutually agreed upon in writing for commencement of work, or the time period defined within the Scope of Work.
Non-Performance. The obligation of ECOLOGY to the RECIPIENT is contingent upon satisfactory performance by the
RECIPIENT of all of its obligations under this Agreement. In the event the RECIPIENT unjustifiably fails, in the
opinion of ECOLOGY, to perform any obligation required of it by this Agreement, ECOLOGY may refuse to pay any
further funds, terminate in whole or in part this Agreement, and exercise any other rights under this Agreement.
Despite the above, the RECIPIENT shall not be relieved of any liability to ECOLOGY for damages sustained by
ECOLOGY and the State of Washington because of any breach of this Agreement by the RECIPIENT. ECOLOGY
may withhold payments for the purpose of setoff until such time as the exact amount of damages due ECOLOGY from
the RECIPIENT is determined.
b)For Convenience
ECOLOGY may terminate for convenience this Agreement, in whole or in part, for any reason when it is the best
interest of ECOLOGY, with a thirty (30) calendar days prior written notification to the RECIPIENT, except as noted
below. If this Agreement is so terminated, the parties shall be liable only for performance rendered or costs incurred in
accordance with the terms of this Agreement prior to the effective date of termination.
Non-Allocation of Funds. ECOLOGY’s ability to make payments is contingent on availability of funding. In the event
funding from state, federal or other sources is withdrawn, reduced, or limited in any way after the effective date and
prior to the completion or expiration date of this Agreement, ECOLOGY, at its sole discretion, may elect to terminate
the Agreement, in whole or part, or renegotiate the Agreement, subject to new funding limitations or conditions.
ECOLOGY may also elect to suspend performance of the Agreement until ECOLOGY determines the funding
insufficiency is resolved. ECOLOGY may exercise any of these options with no notification or restrictions, although
ECOLOGY will make a reasonable attempt to provide notice.
In the event of termination or suspension, ECOLOGY will reimburse eligible costs incurred by the recipient/contractor
through the effective date of termination or suspension. Reimbursed costs must be agreed to by ECOLOGY and the
recipient/contractor. In no event shall ECOLOGY’s reimbursement exceed ECOLOGY’s total responsibility under the
agreement and any amendments.
If payments have been discontinued by ECOLOGY due to unavailable funds, the RECIPIENT shall not be obligated to
repay monies which had been paid to the RECIPIENT prior to such termination.
RECIPIENT’s obligation to continue or complete the work described in this Agreement shall be contingent upon
availability of funds by the RECIPIENT's governing body.
c)By Mutual Agreement
ECOLOGY and the RECIPIENT may terminate this Agreement, in whole or in part, at any time, by mutual written
agreement.
d)In Event of Termination
All finished or unfinished documents, data studies, surveys, drawings, maps, models, photographs, reports or other
materials prepared by the RECIPIENT under this Agreement, at the option of ECOLOGY, will become property of
ECOLOGY and the RECIPIENT shall be entitled to receive just and equitable compensation for any satisfactory work
Version 10/30/2015
AGENDA ITEM #8. g)
Page 38 of 38State of Washington Department of Ecology
Agreement No:
Project Title:
Recipient Name:
WQC-2017-Renton-00002
Heather Downs Detention Pond Water Quality Retrofit Project
City of Renton
completed on such documents and other materials.
Nothing contained herein shall preclude ECOLOGY from demanding repayment of all funds paid to the RECIPIENT in
accordance with Recovery of Funds, identified herein.
28.THIRD PARTY BENEFICIARY
RECIPIENT shall ensure that in all subcontracts entered into by the RECIPIENT pursuant to this Agreement, the state
of Washington is named as an express third party beneficiary of such subcontracts with full rights as such.
29.WAIVER
Waiver of a default or breach of any provision of this Agreement is not a waiver of any subsequent default or breach,
and will not be construed as a modification of the terms of this Agreement unless stated as such in writing by the
authorized representative of ECOLOGY.
Version 10/30/2015
AGENDA ITEM #8. g)
AGENDA ITEM #8. g)
1
CITY OF RENTON, WASHINGTON
RESOLUTION NO. ________
A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, UPDATING AND
EXTENDING RENTON’S SIX‐YEAR TRANSPORTATION IMPROVEMENT PROGRAM
FOR 2019 – 2024.
WHEREAS, the City of Renton has adopted a Six‐Year Transportation Improvement
Program (“TIP”) pursuant to RCW 35.77.010 (Perpetual advanced six‐year plans for coordinated
transportation program expenditures), and the TIP has been updated, amended and modified
from time to time as authorized and required by law; and
WHEREAS, the City Council held a duly noticed public hearing on August 20, 2018, for the
purpose of considering updates to the TIP; and
WHEREAS, the City Council has reviewed the work accomplished under the TIP,
considered any public testimony given at the public hearing held on August 20, 2018, considered
proposed updates to the TIP, and determined current City transportation needs;
NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO
RESOLVE AS FOLLOWS:
SECTION I. The City of Renton’s 2019‐2024 Six‐Year Transportation Improvement
Program, attached as Exhibit A and fully incorporated herein by this reference, is adopted as the
City’s updated and extended TIP.
SECTION II. The updated and extended TIP, as attached, shall be and constitute
Renton’s 2019‐2024 Six‐Year Transportation Improvement Program for purposes of compliance
with RCW 35.77.010, and shall remain in full force and effect until further revised, amended, and
modified as provided by law.
AGENDA ITEM # 10. a)
RESOLUTION NO. ________
2
SECTION III. The Administrator of the Public Works Department and the City Clerk are
authorized and directed to file this resolution, together with Exhibit A, with the Washington State
Secretary of Transportation within 30 days of its adoption.
PASSED BY THE CITY COUNCIL this ____ day of _________________, 2018.
Jason A. Seth, City Clerk
APPROVED BY THE MAYOR this ____ day of ___________________, 2018.
Denis Law, Mayor
Approved as to form:
Shane Moloney, City Attorney
RES.1774:7/26/18:scr
AGENDA ITEM # 10. a)
EXHIBIT A
2019 – 2024
TRANSPORTATION IMPROVEMENT PROGRAM
AGENDA ITEM # 10. a)
Transportation Improvement Program
2019—2024 | Six-Year Adopted
August 2018
Department of Public Works
Transportation Systems Division
AGENDA ITEM # 10. a)
Acknowledgements
Mayor
Denis Law
City Council
Ed Prince, Council President
Don Persson, Council President Pro-tem
Randy Corman
Ryan McIrvin
Armondo Pavone
Ruth Pérez
Don Persson
Carol Ann Witschi
Chief Administrative Officer
Robert Harrison
Public Works
Gregg Zimmerman, Public Works Administrator
Jim Seitz, Transportatfon Systems Director
Vangie Garcia, Transportatfon Planning & Programming Manager
Bob Hanson, Transportatfon Design Manager
Chris Barnes, Transportatfon Operatfons Manager
Eric Cutshall, Transportatfon Maintenance Manager
Heather Gregersen, Program Development Coordinator
2019 – 2024 Transportation Improvement Program
1
AGENDA ITEM # 10. a)
Table of Contents
Section A – Introduction
Purpose of the Transportatfon Improvement Program 4
Renton Business Plan 5
Section B – Map and Location
Transportatfon Improvement Program Map 8
Map Index 9
Section C – Development and Prioritization
TIP Development Actfvitfes 11
General Programming Criteria 13
Summary of Projects and Prioritfzatfon 15
Section D – Expenditures and Revenues
Funding Sources - Itemized 19
Section E – Project Descriptions
Detailed Project Descriptfons 26
Section F – Appendix
Abbreviatfons and Acronyms
Resolutfon to Adopt Six-Year 2019-2024 TIP
2019 – 2024 Transportation Improvement Program
2
AGENDA ITEM # 10. a)
Section A
Introduction
2019 – 2024 Transportation Improvement Program
3
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Purpose of the Transportation Improvement Program
The purpose of this document is to update the City of Renton’s future plans for transportatfon improvement
programs and projects. This document is Renton’s comprehensive transportatfon program for the ensuing
six calendar years and is mandated by the Revised Code of Washington and Washington Administratfve Code.
The Transportatfon Improvement Program (TIP) is a multf-year planning tool for the development of
transportatfon facilitfes within the City that:
support the Mission and Vision of the City of Renton
help achieve the goals of the Renton Business Plan
reflect the involvement of City Citfzens and Elected Officials.
The Transportatfon Improvement Program is a vital part of planning under the Growth Management Act and
city projects must be included in the TIP to be eligible for state and federal grant programs. The
Transportatfon Systems Division uses the TIP to coordinate projects and programs with other jurisdictfons
and agencies.
4
AGENDA ITEM # 10. a)
Provide a safe,
healthy, vibrant
community
Promote safety, health,
and security through
effective communication
and service delivery
Facilitate successful
neighborhoods through
community involvement
Encourage and partner
in the development of
quality housing choices
for people of all ages and
income levels
Promote a walkable,
pedestrian and bicycle-
friendly city with complete
streets, trails, and
connections between
neighborhoods and
community focal points
Provide opportunities
for communities to be
better prepared for
emergencies
Promote economic
vitality and strategically
position Renton for
the future
Promote Renton as the
progressive, opportunity-
rich city in the Puget
Sound region
Capitalize on
opportunities through
bold and creative
economic development
strategies
Recruit and retain
businesses to ensure
a dynamic, diversified
employment base
Nurture
entrepreneurship
and foster successful
partnerships with
businesses and
community leaders
Leverage public/
private resources to
focus development
on economic centers
Support planned
growth and influence
decisions that impact
the city
Foster development
of vibrant, sustainable,
attractive, mixed-use
neighborhoods in urban
centers
Uphold a high standard
of design and property
maintenance
Advocate Renton’s
interests through state and
federal lobbying efforts,
regional partnerships and
other organizations
Pursue transportation
and other regional
improvements and services
that improve quality of life
Balance development
with environmental
protection
Building an inclusive
informed city with
opportunities for all
Improve access to city
services, programs and
employment, and make
residents and businesses
aware of opportunities
to be involved with their
community
Build connections with
ALL communities that
reflect the breadth and
richness of the diversity
in our city
Promote understanding
and appreciation of
our diversity through
celebrations and festivals
Provide critical and
relevant information on a
timely basis and facilitate
two-way dialogue between
city government and the
community
Meet service demands
and provide high
quality customer
service
Plan, develop, and
maintain quality services,
infrastructure, and
amenities
Prioritize services at
levels that can be sustained
by revenue
Retain a skilled
workforce by making
Renton the municipal
employer of choice
Develop and maintain
collaborative partnerships
and investment strategies
that improve services
Respond to growing
service demands through
partnerships, innovation,
and outcome management
Renton Business Plan
2019–2024 GOALS
The City of Renton, in partnership and communication
with residents, businesses, and schools, is dedicated to:MISSION
Providing a safe, healthy, welcoming atmosphere where people choose to live
Promoting economic vitality and strategically positioning Renton for the future
Supporting planned growth and influencing decisions that impact the city
Building an inclusive informed city with opportunities for all
Meeting service demands through high quality customer service, innovation,
a positive work environment, and a commitment to excellence
Renton: The center
of opportunity in
the Puget Sound
Region where
families and
businesses thrive
VISION
RENTON. AHEAD OF THE CURVE.
5
AGENDA ITEM # 10. a)
Section B
Map and Location
2019 – 2024 Transportation Improvement Program
6
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Map and Location
This sectfon contains a list of all the projects listed in the 2019 - 2024 Transportatfon Improvement Program
(TIP), listed by TIP number. The TIP project numbering system starts with programmatfc actfvitfes that
typically have annual financial allocatfons. With this in mind, the TIP numbers for these programs will remain
the same for future TIPs.
The next grouping of projects in alphabetfcal order are projects with full or partfal funding secured, such as
with federal or state grants or developer contributfons, or where the City has a financial commitment to
implementfng within the six-year period.
The last group of projects, where the projects start over in alphabetfcal order, are unfunded local projects or
outside agency-led projects, that have been identffied in other long-range plans for the City.
INTERACTIVE ONLINE MAP
In additfon to having a map index to the map of 2019-2024 TIP projects, there is an interactfve online map
where a user can click on a specific project and a dialog box opens with informatfon about that project with a
link to the individual TIP sheet. The web address is: http://www.rentonwa.gov/TIPMap
7
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
2.1
38
18
35
32
2.2
21 24
26
25
15
17
37
20
41
31
29
19
45
16
36
34
47
23
27
30
28
22
42
33
46
43
39
Maintenance and Preservatfon
Corridor Projects
Traffic Operatfons and Safety
Non-Motorized Projects
TIP Number #
City-wide projects are not identified
on this map.
TRANSPORTATION IMPROVEMENT PROGRAM MAP
44
8
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
TIP No. Project Title
1 Street Overlay
2 Arterial Rehabilitatfon Program
2.1 Renton Avenue S Resurfacing, S 130th St to Taylor Ave NW
2.2 SW 43rd St Resurfacing, SR 167 to west City Limits
3 Walkway Program
4 Roadway Safety and Guardrail Program
5 Intersectfon Safety & Mobility Program
6 Traffic Safety Program
7 Traffic Operatfon Devices Program
8 Intelligent Transportatfon Systems (ITS) Program
9 Sidewalk Rehabilitatfon and Replacement Program
10 Bridge Inspectfon & Repair Program
11 Barrier-Free Transitfon Plan Implementatfon
12 Project Development & Pre-Design Program
13 Arterial Circulatfon Program
14 1% for the Arts Program
15 Bronson Way N Bridge Repair, across Cedar River
16 Duvall Ave NE Roadway Improvements, NE 7th St to Sunset Blvd NE
17 Houser Way N Bridge Repair- Seismic Retrofit and Paintfng
18 Lake Washington Loop Trail, perimeter of the Renton Airport
19 NE Sunset Boulevard (SR 900) Corridor Improvements, I-405 to east City Limits
20 Park Ave North Extension, Logan Ave N to Southport
21 Rainier Ave S/N Corridor Improvements Phase 4, S 3rd St to NW 3rd Pl
22 Renton Connector, S 2nd St to S 5th St
23 116th Ave SE Improvements, Puget Drive SE to the south City Limits
24 South 2nd Street Conversion Project, Rainier Ave S to Main Ave S
25 Williams Ave N Bridge - Seismic Retrofit and Paintfng
26 Williams Ave S and Wells Ave S Conversion Project, S Grady Way to N 1st St
27 Carr Road improvements, Lind Ave SW to 116th Ave SE
28 Houser Way S/N Non-Motorized Improvements, Mill Ave S to Bronson Way S
29 Houser Way North Widening and Realignment, N 8th St to Lake Washington Blvd
30 Lake to Sound (L2S) Trail, East-West Trail connecting Lake Washington to Puget Sound
31 Lake Washington Blvd N/ Southport Access Improvements, Park Ave N to Gene Coulon Park
32 Lind Ave SW Roadway Widening, SW 16th St to SW 43rd St
33 Logan Ave North Improvements, S 2nd St to Park Ave N
34 Maple Valley Highway Barriers, vicinity of western edge of Riverview Park
35 Monster Road SW/68th Ave S Roadway Improvements, Monster Rd Bridge to City Limits
36 NE 3rd Street / NE 4th Street Corridor Improvements, Sunset Blvd N to the east City Limits
37 Nile Ave NE Bridge Repair, across May Creek
38 Rainier Ave N Corridor Improvements Phase 5, NW 3rd Pl to City Limits
39 Renton Bus Rapid Transit (BRT) Improvements, S Renton Village Pl extension to S Grady Way
40 Transit Master Plan
41 South 3rd Street Conversion Project, Rainier Ave S to Main Ave S
42 South/Southwest 7th Street Corridor Improvements
43 South Grady Way Multf-Modal Improvements, Talbot Rd South to Rainier Ave South
44 South Lake Washington Transit Stop, vicinity of Southport Dr N and Garden Ave N
45 Sunset Area Green Connectfons, vicinity of Sunset Area Revitalization Area
46 SW 27th Street/Strander Boulevard Connectfon
47 Talbot Road S / S 177th St Signalizatfon and Roadway Improvements, adjacent to Valley Medical Center
MAP INDEX
9
AGENDA ITEM # 10. a)
Section C
Development and Prioritization
2019 – 2024 Transportation Improvement Program
10
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
TIP Development Activities
TIP project and financial development actfvitfes are intricately intertwined and involve interactfons with
many groups and agencies at the local, regional, state and federal levels. Within the Transportatfon Systems
Division of the City of Renton, project development involves year-round coordinatfon between the
Transportatfon Operatfons and Transportatfon Maintenance Sectfon, the Transportatfon Planning and
Programming Sectfon and the Transportatfon Design Sectfon.
The Transportatfon Operatfons and Maintenance Sectfon compiles accident and traffic count data, performs
level-of-service calculatfons needed to identffy operatfonal/congestfon problems and tracks all transportatfon
-related complaints, suggestfons and requests that come into the City.
The Transportatfon Design Sectfon, through the TIP’s Overlay Program and Bridge Inspection and Repair
Program, work closely with the Maintenance Services Division to establish structural ratfngs for the City’s
roads and bridges.
These and other data are being used by the Planning and Programming Sectfon to develop transportatfon
improvement projects, prepare grant applicatfons, interface with ongoing state and federal transportatfon
programs and develop a TIP that supports the goals of the City’s long-range Comprehensive Plan and current
business plan.
The Transportatfon Planning and Programming Sectfon works with Washington Department of Transporta-
tfon, King County Metro Transit, Puget Sound Regional Council, Sound Transit and other groups and agencies
to assure consistency between Renton’s transportatfon policies and programs and those of the region. Such
consistency is required by the Growth Management Act and related legislatfon and by federal and state grant
programs.
With on-going changes to I-405 and SR 167 as well as the expansion of the Sound Transit network, especially
the I-405 Bellevue to Renton Bus Rapid Transit, the City of Renton must look to creatfng and maintaining an
infrastructure system to support these changes to the transportatfon system to promote economic vitality as
well as providing a safe and healthy community.
Ongoing transportatfon planning actfvitfes, such as updatfng the Transportatfon Element in the
Comprehensive Plan and the development of sub-area plans, play an important part in identffying and
prioritfzing transportatfon improvement projects. In recent years, long-range planning efforts have played a
key role in the development of transportatfon projects for the City: Downtown Civic Core Vision & Action
Plan, City Center Community Plan, Sunset Area Transformation Plan, and the Renton Trails and Bicycle Master
Plan.
All City of Renton departments and City Council are solicited each year to provide input, discuss and
comment on the Six-Year TIP. Additfonal input is also gathered through interactfons with other public and
private organizatfons and through public meetfngs held in the community concerning specific transportatfon
projects and programs.
11
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
At all levels of government - City, State and Federal - there are new laws and regulatfons that create the need
for new or different kinds of transportatfon projects and programs that have tremendous impacts on the de-
velopment and costs of transportatfon projects. Examples include the Moving Ahead for Progress in the 21 st
Century Act (MAP-21), the Growth Management Act, the Clean Air Act, the Commute Trip Reductfon law, the
Endangered Species Act and the Surface Water Management Ordinance.
Within the City of Renton, there are actfons and interactfons involving other departments and divisions, the
private sector, the City Council and Administratfon, which strongly influence the directfon of the
transportatfon program. For example, the transportatfon system is significantly impacted by land use
decisions, private development proposals and by public water and sewer extensions which increase
transportatfon demand by making possible higher density and/or intensity of land uses. Such proposals need
to be monitored and analyzed in regard to how they individually and collectfvely create the need for
transportatfon improvements.
In summary, with its heavy dependence on many different and unpredictable sources of external funding and
with the significant impacts created by ongoing local and regional land use decisions, transportatfon project
development is a contfnuous actfvity comprised of a multftude of diverse elements.
12
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
General Programming Criteria
The yearly update of the Six-Year Transportatfon Improvement Program (TIP) is part of an ongoing process
intrinsically linked with the development of the City’s Capital Improvement Program. The Six-Year TIP is also
linked with various state and federal funding programs, regional/inter-jurisdictfonal planning and coordina-
tfon processes and the City’s Growth Management Act Comprehensive Land Use Plan.
Projects are developed and prioritfzed based on community needs, specific goals to be achieved and on gen-
eral programming consideratfons. The general programming consideratfons include the following:
PRIORITY – As shown on pages 15-17 the projects and programs are prioritfzed by type prepared by City
staff with final approval by the City Council during the annual update of the TIP. The prioritfzatfon as-
sists staff in assigning the limited resources to projects and programs and reducing resources during
funding shortialls. In general, staff expends more resources on higher priority projects in the first
three years of the TIP, and when applying for grants staff will consider these projects first unless oth-
er lower priority projects better meet the partfcular criteria of a grant program.
PLANNING – How, at a local and regional level, a project fits with or addresses identffied future trans-
portatfon goals, demands and planning processes must be evaluated. This is strongly influenced by
ongoing land use decisions and by regional highway and transit system plans.
FINANCING – Many projects are dependent upon external grants, formatfon of LID’s or the receipt of im-
pact fees. Prioritfzatfon has to take into account the peculiaritfes of each of the various fund sources
and the probabilitfes of when and how much money will be available.
SCHEDULING – If a project is interconnected with, or interdependent on, other projects taking place,
this is reflected in their relatfve prioritfes.
PAST COMMITMENT – The level of previous commitment made by the City in terms of resources, legis-
latfve actfons or inter-local agreements must be taken into consideratfon in prioritfzing TIP projects.
In additfon to the general consideratfons discussed above, there are five specific project categories through
which the TIP is evaluated and analyzed. The categories include the following:
Maintenance and Preservatfon of Existfng Infrastructure
Corridor Projects
Operatfons and Safety
Non-Motorized Projects
Other Programs
These categories provide a useful analysis tool and represent goals developed through an evaluatfon of the
City’s transportatfon program in response to input from citfzens and local officials and to state and federal
legislatfon.
13
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Taken as a whole, the five categories provide a framework for evaluatfng projects both individually and as
part of a strategy that seeks to meet and balance the transportatfon needs of Renton during a tfme of in-
creasing transportatfon demand, decreasing revenues, and growing environmental concerns.
Although each project can be identffied with an important concern that allows it to be classified into one of
the five categories, most projects are intended to address and are developed to be compatfble with multfple
goals.
Maintenance and Preservation of the Existing Infrastructure is a basic need that must be met by the
program. The Mayor and City Council have emphasized the importance of sustaining strong programs in this
project category and maintaining our current infrastructure. Therefore, more than half of the Transporta-
tfon’s City Funds have historically been allocated under this category. The State Growth Management Act
also requires jurisdictfons to assess and address the funding required to maintain their existfng transporta-
tfon systems. The City of Renton owns and maintains 250 centerline miles of streets.
Corridor Projects are oriented toward moving people through a balanced transportatfon system that in-
volves multfple modes of transportatfon. Included are facilitfes that facilitate the movement of transit and
carpools. The Moving Ahead for Progress in the 21st Century Act (MAP-21), the State and Federal Clean Air
legislatfon and the State Commute Trip Reductfon Act (CTR) have added momentum to regional efforts and
placed requirements on local jurisdictfons such as Renton to promote these transportatfon elements.
Operations and Safety projects and programs are developed through ongoing analyses of the transporta-
tfon system and are directed mainly toward traffic engineering concerns such as safety and congestfon. Pro-
jects are identffied not only by analysis of traffic counts, accident records and geometric data, but also
through review and investfgatfon of citfzen complaints and requests.
Non-Motorized Projects have been developed with major emphasis on addressing community quality of
life issues by improving and/or protectfng residentfal livability while providing necessary transportatfon sys-
tem improvements. Bicycle and pedestrian projects are included in this category.
Other Programs involve planning of transportatfon improvements necessitated by new development and
new transportatfon capital improvements.
14
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Summary of Projects and Prioritization
The prioritfzatfon of the TIP is influenced by the interconnectfon and/or interdependence among TIP projects
and with projects by other City departments and by other jurisdictfons as well as the tfming of those
transportatfon projects. Equally important to the prioritfzatfon below is the likelihood, the tfme frame, and
the amount of outside funding that will be obtainable to finance transportatfon projects.
The prioritfzatfon lists below are sorted by the category type of the projects.
Priority TIP No. Project Title Community Planning Area
Maintenance and Preservation of the Existing Infrastructure
1 1 Street Overlay Citywide
2 2 Arterial Rehabilitation Program Citywide
3 2.1 Renton Avenue S Resurfacing,
S 130th St to Taylor Ave NW City Center
4 2.2 SW 43rd St Resurfacing,
SR 167 to west City Limits Valley
5 15 Bronson Way N Bridge Repair,
across Cedar River City Center
6 17 Houser Way N Bridge Repair,
across Cedar River City Center
7 25 Williams Ave N Bridge Repair,
across Cedar River City Center
8 9 Sidewalk Rehabilitation and Replacement Program Citywide
9 37 Nile Ave NE Bridge Repair,
across May Creek East Plateau
10 10 Bridge Inspection & Repair Program Citywide
11 4 Roadway Safety and Guardrail Program Citywide
15
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Priority TIP No. Project Title Community Planning Area
Corridor
Projects
1 26 Williams Ave S and Wells Ave S Conversion Project,
S Grady Way to N 1st St City Center
2 20 Park Ave North Extension,
Logan Ave N to Southport City Center
3 21 Rainier Ave S/N Corridor Improvements Phase 4,
S 3rd St to NW 3rd Pl City Center
4 16 Duvall Ave NE Roadway Improvements,
NE 7th St to Sunset Blvd NE Highlands & E. Plateau
5 24 South 2nd Street Conversion Project,
Rainier Ave S to Main St City Center
6 19 NE Sunset Boulevard (SR 900) Corridor Improvements
I-405 to east City Limits Highlands
7 23 116th Ave SE Improvements,
Puget Drive SE to the south City Limits Benson
8 41 South 3rd Street Conversion Project,
Rainier Ave S to Main St City Center
9 22 Renton Connector,
S 2nd St to S 5th St City Center
10 44 South Lake Washington Transit Stop,
vicinity of Southport Dr N and Garden Ave N City Center
11 27 Carr Road improvements,
Lind Ave SW to 116th Ave SE Talbot & Benson
12 39 Renton Bus Rapid Transit (BRT) Improvements,
S Renton Village Pl extension to S Grady Way City Center
13 42 South 7th Street Corridor Improvements,
Rainier Ave South to Talbot Road South City Center
14 31 Lake Washington Blvd N/ Southport Access Improvements,
Park Ave N to Gene Coulon Park City Center
15 43 South Grady Way Multi-Modal Improvements,
Talbot Rd South to Rainier Ave South City Center
16 38 Rainier Ave N Corridor Improvements Phase 5,
NW 3rd Pl to City Limits City Center
17 29 Houser Way North Widening and Realignment,
N 8th St to Lake Washington Blvd City Center
18 33 Logan Ave North Improvements,
S 2nd St to Park Ave N City Center
19 36 NE 3rd Street / NE 4th Street Corridor Improvements,
Sunset Blvd N to the east City Limits Highlands & E. Plateau
20 32 Lind Ave SW Roadway Widening,
SW 16th St to SW 43rd St Valley
21 35 Monster Road SW/68th Ave S Roadway Improvements,
Monster Rd Bridge and City Limits Valley
22 46 SW 27th Street/Strander Boulevard Connection Valley
16
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
Priority TIP No. Project Title Community Planning Area
Operations and Safety
1 5 Intersection Safety & Mobility Program Citywide
2 6 Traffic Safety Program Citywide
3 8 Intelligent Transportation Systems (ITS) Program Citywide
4 7 Traffic Operation Devices Program Citywide
5 34 Maple Valley Highway Barriers,
west edge of Riverview Park Cedar River
6 47 Talbot Road S / S 177th St Signalization and Roadway Improvements,
adjacent to Valley Medical Center Talbot
Non-Motorized Projects
1 18 Lake Washington Loop Trail,
south perimeter of the Renton Airport City Center
2 30 Lake to Sound (L2S) Trail,
East-West Trail connecting Lake Washington to Puget Sound Valley & City Center
3 28 Houser Way S/N Non-Motorized Improvements,
Mill Ave S to Bronson Way S City Center
4 11 Barrier-Free Transition Plan Implementation Citywide
5 3 Walkway Program Citywide
6 45 Sunset Area Green Connections,
vicnity of Sunset Area Revitilzation Area Highlands
Other Programs
1 13 Arterial Circulation Program Citywide
2 12 Project Development & Pre-Design Program Citywide
3 40 Transit Master Plan Citywide
4 14 1% for the Arts Program N/A
17
AGENDA ITEM # 10. a)
Section D
Expenditures and Revenues
2019 – 2024 Transportation Improvement Program
18
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year Period
Total
1 Street Overlay $1,090,000 $1,170,000 $2,070,000 $2,170,000 $2,260,000 $2,360,000 $11,120,000
2 Arterial Rehabilitation Program $1,540,000 $1,610,000 $1,680,000 $4,830,000
2.1 Renton Avenue S Resurfacing $550,000 $550,000
2.2 SW 43rd St Resurfacing $220,000 $1,820,000 $2,040,000
3 Walkway Program $200,000 $250,000 $250,000 $250,000 $250,000 $250,000 $1,450,000
4 Roadway Safety and Guardrail Program $25,000 $25,000 $30,000 $30,000 $35,000 $35,000 $180,000
5 Intersection Safety & Mobility Program $250,000 $200,000 $350,000 $350,000 $350,000 $350,000 $1,850,000
6 Traffic Safety Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000
7 Traffic Operation Devices Program $120,000 $120,000 $120,000 $120,000 $120,000 $120,000 $720,000
8 Intelligent Transportation Systems (ITS) Program $60,000 $60,000 $60,000 $60,000 $60,000 $60,000 $360,000
9 Sidewalk Rehabilitation and Replacement Program $100,000 $110,000 $110,000 $110,000 $110,000 $110,000 $650,000
10 Bridge Inspection & Repair Program $90,000 $50,000 $100,000 $100,000 $100,000 $100,000 $540,000
11 Barrier‐Free Transition Plan Implementation $60,000 $80,000 $80,000 $80,000 $80,000 $80,000 $460,000
12 Project Development & Pre‐Design Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000
13 Arterial Circulation Program $145,000 $150,000 $150,000 $150,000 $150,000 $150,000 $895,000
14 1% for the Arts Program $15,000 $15,000 $15,000 $15,000 $15,000 $15,000 $90,000
15 Bronson Way N Bridge Repair $420,000 $2,510,000 $2,930,000
16 Duvall Ave NE Roadway Improvements $1,512,139 $1,512,139
17 Houser Way N Bridge Repair $470,000 $2,531,900 $222,550 $3,224,450
18 Lake Washington Loop Trail $340,000 $1,425,000 $1,200,000 $950,000 $3,250,000 $7,165,000
19 NE Sunset Blvd (SR 900) Corridor Improvements $459,000 $2,750,000 $7,550,000 $6,850,000 $6,450,000 $6,250,000 $30,309,000
20 Park Ave North Extension $5,825,000 $625,000 $6,450,000
21 Rainier Ave S/N Corridor Improvements Phase 4 $1,500,000 $1,951,323 $8,800,000 $5,850,000 $150,000 $18,251,323
22 Renton Connector $278,700 $621,300 $3,963,000 $8,850,000 $13,713,000
23 116th Ave SE Improvements $1,600,000 $3,700,000 $2,600,000 $2,200,000 $10,100,000
24 South 2nd Street Conversion Project $100,000 $1,350,000 $7,800,000 $7,800,000 $17,050,000
25 Williams Ave N Bridge Repair $470,000 $2,740,450 $3,210,450
26 Williams Ave S and Wells Ave S Conversion Project $1,933,800 $6,348,269 $8,282,069
27 Carr Road improvements $50,000 $50,000
28 Houser Way Non‐Motorized Improvements $385,000 $836,000 $966,000 $2,187,000
29 Houser Way North Widening and Realignment $1,065,000 $1,560,000 $2,340,000 $4,965,000
30 Lake to Sound (L2S) Trail $2,800,000 $2,800,000
31 Lake Wash. Blvd N/Southport Access Improvements $2,000,000 $2,000,000
32 Lind Ave SW Roadway Widening $400,000 $1,650,000 $2,350,000 $4,400,000
33 Logan Ave North Improvements $1,240,000 $10,000,000 $11,240,000
34 Maple Valley Highway Barriers $299,035 $2,838,865 $3,137,900
35 Monster Road SW/68th Ave S Improvements $50,000 $8,000,000 $8,050,000
36 NE 3rd Street / NE 4th Street Corridor Improvements $20,000 $20,000 $750,000 $4,190,000 $5,180,000 $3,200,000 $13,360,000
37 Nile Ave NE Bridge Repair $50,000 $200,000 $250,000
38 Rainier Ave N Corridor Improvements Phase 5 $100,000 $2,000,000 $2,100,000
39 Renton Bus Rapid Transit (BRT) Improvements $3,195,000 $9,052,500 $9,052,500 $21,300,000
40 Renton Master Transit Plan $300,000 $200,000 $500,000
41 South 3rd Street Conversion Project $4,000,000 $6,500,000 $10,700,000 $21,200,000
42 S/SW 7th Street Corridor Improvements $200,000 $1,600,000 $10,364,000 $3,608,928 $15,772,928
43 South Grady Way Multi‐Modal Improvements $550,000 $1,760,000 $1,690,000 $4,000,000
44 South Lake Washington Transit Stop $4,350,000 $4,350,000
45 Sunset Area Green Connections $3,600,000 $10,700,000 $7,900,000 $22,200,000
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL EXPENDITURES $20,804,939 $23,801,942 $35,905,285 $57,030,165 $80,475,500 $75,577,428 $293,595,259
SUMMARY OF PROJECT EXPENDITURES
19
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year Period
Total
1 Street Overlay $700,000 $710,000 $720,000 $730,000 $740,000 $750,000 $4,350,000
2 Arterial Rehabilitation Program
2.1 Renton Avenue S Resurfacing
2.2 SW 43rd St Resurfacing
3 Walkway Program
4 Roadway Safety and Guardrail Program
5 Intersection Safety & Mobility Program
6 Traffic Safety Program
7 Traffic Operation Devices Program
8 Intelligent Transportation Systems (ITS) Program
9 Sidewalk Rehabilitation and Replacement Program
10 Bridge Inspection & Repair Program
11 Barrier‐Free Transition Plan Implementation
12 Project Development & Pre‐Design Program
13 Arterial Circulation Program
14 1% for the Arts Program
15 Bronson Way N Bridge Repair
16 Duvall Ave NE Roadway Improvements
17 Houser Way N Bridge Repair
18 Lake Washington Loop Trail
19 NE Sunset Boulevard (SR 900) Corridor Improvements
20 Park Ave North Extension
21 Rainier Ave S/N Corridor Improvements Phase 4
22 Renton Connector
23 116th Ave SE Improvements
24 South 2nd Street Conversion Project
25 Williams Ave N Bridge Repair
26 Williams Ave S and Wells Ave S Conversion Project
27 Carr Road improvements
28 Houser Way Non‐Motorized Improvements
29 Houser Way North Widening and Realignment
30 Lake to Sound (L2S) Trail
31 Lake Washington Blvd N/ Southport Access Improvements
32 Lind Ave SW Roadway Widening
33 Logan Ave North Improvements
34 Maple Valley Highway Attenuator
35 Monster Road SW/68th Ave S Roadway Improvements
36 NE 3rd Street / NE 4th Street Corridor Improvements
37 Nile Ave NE Bridge Repair
38 Rainier Ave N Corridor Improvements Phase 5
39 Renton Bus Rapid Transit (BRT) Improvements
40 Renton Master Transit Plan
41 South 3rd Street Conversion Project
42 S/SW 7th Street Corridor Improvements
43 South Grady Way Multi‐Modal Improvements
44 South Lake Washington Transit Stop
45 Sunset Area Green Connections
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL VEHICLE FUEL TAX $700,000 $710,000 $720,000 $730,000 $740,000 $750,000 $4,350,000
RESOURCE: VEHICLE FUEL TAX
20
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year Period
Total
1 Street Overlay $390,000 $460,000 $490,000 $530,000 $560,000 $600,000 $3,030,000
2 Arterial Rehabilitation Program $510,000 $530,000 $550,000 $1,590,000
2.1 Renton Avenue S Resurfacing $275,000 $275,000
2.2 SW 43rd St Resurfacing $220,000 $820,000 $1,040,000
3 Walkway Program $200,000 $250,000 $100,000 $100,000 $100,000 $100,000 $850,000
4 Roadway Safety and Guardrail Program $25,000 $25,000 $30,000 $30,000 $35,000 $35,000 $180,000
5 Intersection Safety & Mobility Program
6 Traffic Safety Program $130,000 $70,000 $200,000
7 Traffic Operation Devices Program $120,000 $120,000 $120,000 $120,000 $120,000 $120,000 $720,000
8 Intelligent Transportation Systems (ITS) Program
9 Sidewalk Rehabilitation and Replacement Program $100,000 $110,000 $110,000 $110,000 $110,000 $110,000 $650,000
10 Bridge Inspection & Repair Program $90,000 $50,000 $50,000 $50,000 $50,000 $50,000 $340,000
11 Barrier‐Free Transition Plan Implementation $60,000 $80,000 $140,000
12 Project Development & Pre‐Design Program $150,000 $150,000 $150,000 $150,000 $150,000 $150,000 $900,000
13 Arterial Circulation Program $145,000 $150,000 $150,000 $150,000 $150,000 $150,000 $895,000
14 1% for the Arts Program $15,000 $15,000 $15,000 $15,000 $15,000 $15,000 $90,000
15 Bronson Way N Bridge Repair
16 Duvall Ave NE Roadway Improvements $30,000 $30,000
17 Houser Way N Bridge Repair,
18 Lake Washington Loop Trail $75,000 $75,000
19 NE Sunset Boulevard (SR 900) Corridor Improvements $32,975 $32,975
20 Park Ave North Extension
21 Rainier Ave S/N Corridor Improvements Phase 4 $100,000 $450,000 $550,000
22 Renton Connector
23 116th Ave SE Improvements
24 South 2nd Street Conversion Project $100,000 $100,000
25 Williams Ave N Bridge Repair $122,550 $122,550
26 Williams Ave S and Wells Ave S Conversion Project
27 Carr Road improvements
28 Houser Way Non‐Motorized Improvements
29 Houser Way North Widening and Realignment
30 Lake to Sound (L2S) Trail
31 Lake Washington Blvd N/ Southport Access Improvements
32 Lind Ave SW Roadway Widening
33 Logan Ave North Improvements
34 Maple Valley Highway Barriers
35 Monster Road SW/68th Ave S Roadway Improvements
36 NE 3rd Street / NE 4th Street Corridor Improvements $20,000 $20,000 $40,000
37 Nile Ave NE Bridge Repair
38 Rainier Ave N Corridor Improvements Phase 5
39 Renton Bus Rapid Transit (BRT) Improvements
40 Renton Master Transit Plan
41 South 3rd Street Conversion Project
42 S/SW 7th Street Corridor Improvements
43 South Grady Way Multi‐Modal Improvements
44 South Lake Washington Transit Stop
45 Sunset Area Green Connections
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL B & O Share $1,782,975 $2,017,550 $2,135,000 $2,215,000 $1,820,000 $1,880,000 $11,850,525
RESOURCE: BUSINESS LICENSE AND BUSINESS & OCCUPATION
21
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year
Period Total
1 Street Overlay
2 Arterial Rehabilitation Program
2.1 Renton Avenue S Resurfacing
2.2 SW 43rd St Resurfacing $1,000,000 $1,000,000
3 Walkway Program
4 Roadway Safety and Guardrail Program
5 Intersection Safety & Mobility Program
6 Traffic Safety Program
7 Traffic Operation Devices Program
8 Intelligent Transportation Systems (ITS) Program
9 Sidewalk Rehabilitation and Replacement Program
10 Bridge Inspection & Repair Program
11 Barrier‐Free Transition Plan Implementation
12 Project Development & Pre‐Design Program
13 Arterial Circulation Program
14 1% for the Arts Program
15 Bronson Way N Bridge Repair $420,000 $2,510,000 $2,930,000
16 Duvall Ave NE Roadway Improvements $1,049,039 $1,049,039
17 Houser Way N Bridge Repair $406,550 $2,531,900 $2,938,450
18 Lake Washington Loop Trail $340,000 $1,042,961 $1,382,961
19 NE Sunset Boulevard (SR 900) Corridor Improvements $426,025 $426,025
20 Park Ave North Extension
21 Rainier Ave S/N Corridor Improvements Phase 4 $1,192,475 $1,358,000 $5,800,000 $8,350,475
22 Renton Connector
23 116th Ave SE Improvements
24 South 2nd Street Conversion Project $1,200,000 $1,200,000
25 Williams Ave N Bridge Repair $406,550 $2,517,900 $2,924,450
26 Williams Ave S and Wells Ave S Conversion Project $1,453,800 $2,396,200 $3,850,000
27 Carr Road improvements
28 Houser Way Non‐Motorized Improvements
29 Houser Way North Widening and Realignment
30 Lake to Sound (L2S) Trail
31 Lake Washington Blvd N/ Southport Access Improvements
32 Lind Ave SW Roadway Widening
33 Logan Ave North Improvements
34 Maple Valley Highway Barriers
35 Monster Road SW/68th Ave S Roadway Improvements
36 NE 3rd Street / NE 4th Street Corridor Improvements
37 Nile Ave NE Bridge Repair
38 Rainier Ave N Corridor Improvements Phase 5
39 Renton Bus Rapid Transit (BRT) Improvements
40 Renton Master Transit Plan
41 South 3rd Street Conversion Project
42 S/SW 7th Street Corridor Improvements
43 South Grady Way Multi‐Modal Improvements
44 South Lake Washington Transit Stop
45 Sunset Area Green Connections
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL GRANTS AWARDED $5,694,439 $12,356,961 $8,000,000 $26,051,400
RESOURCE: GRANTS AWARDED
22
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year
Period Total
1 Street Overlay
2 Arterial Rehabilitation Program
2.1 Renton Avenue S Resurfacing
2.2 SW 43rd St Resurfacing
3 Walkway Program
4 Roadway Safety and Guardrail Program
5 Intersection Safety & Mobility Program $250,000 $200,000 $450,000
6 Traffic Safety Program $10,000 $80,000 $90,000
7 Traffic Operation Devices Program
8 Intelligent Transportation Systems (ITS) Program $60,000 $60,000 $120,000
9 Sidewalk Rehabilitation and Replacement Program
10 Bridge Inspection & Repair Program
11 Barrier‐Free Transition Plan Implementation
12 Project Development & Pre‐Design Program
13 Arterial Circulation Program
14 1% for the Arts Program
15 Bronson Way N Bridge Repair
16 Duvall Ave NE Roadway Improvements $322,475 $322,475
17 Houser Way N Bridge Repair
18 Lake Washington Loop Trail $307,039 $307,039
19 NE Sunset Boulevard (SR 900) Corridor Improvements
20 Park Ave North Extension
21 Rainier Ave S/N Corridor Improvements Phase 4 $307,525 $593,323 $700,000 $945,000 $150,000 $2,695,848
22 Renton Connector
23 116th Ave SE Improvements
24 South 2nd Street Conversion Project
25 Williams Ave N Bridge Repair
26 Williams Ave S and Wells Ave S Conversion Project
27 Carr Road improvements $50,000 $50,000
28 Houser Way Non‐Motorized Improvements
29 Houser Way North Widening and Realignment
30 Lake to Sound (L2S) Trail
31 Lake Washington Blvd N/ Southport Access Improvements
32 Lind Ave SW Roadway Widening
33 Logan Ave North Improvements
34 Maple Valley Highway Barriers
35 Monster Road SW/68th Ave S Roadway Improvements
36 NE 3rd Street / NE 4th Street Corridor Improvements
37 Nile Ave NE Bridge Repair
38 Rainier Ave N Corridor Improvements Phase 5
39 Renton Bus Rapid Transit (BRT) Improvements
40 Renton Master Transit Plan
41 South 3rd Street Conversion Project
42 S/SW 7th Street Corridor Improvements
43 South Grady Way Multi‐Modal Improvements
44 South Lake Washington Transit Stop
45 Sunset Area Green Connections
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL MITIGATION $1,000,000 $1,240,362 $700,000 $945,000 $150,000 $4,035,362
RESOURCE: MITIGATION (IMPACT FEES)
23
AGENDA ITEM # 10. a)
City of Renton | 2019‐2024 Transportation Improvement Program
TIP No. Project Title 2019 2020 2021 2022 2023 2024
Six‐Year
Period Total
1 Street Overlay
2 Arterial Rehabilitation Program
2.1 Renton Avenue S Resurfacing
2.2 SW 43rd St Resurfacing
3 Walkway Program
4 Roadway Safety and Guardrail Program
5 Intersection Safety & Mobility Program
6 Traffic Safety Program
7 Traffic Operation Devices Program
8 Intelligent Transportation Systems (ITS) Program
9 Sidewalk Rehabilitation and Replacement Program
10 Bridge Inspection & Repair Program
11 Barrier‐Free Transition Plan Implementation
12 Project Development & Pre‐Design Program
13 Arterial Circulation Program
14 1% for the Arts Program
15 Bronson Way N Bridge Repair
16 Duvall Ave NE Roadway Improvements
17 Houser Way N Bridge Repair
18 Lake Washington Loop Trail
19 NE Sunset Boulevard (SR 900) Corridor Improvements
20 Park Ave North Extension $5,825,000 $625,000 $6,450,000
21 Rainier Ave S/N Corridor Improvements Phase 4 $2,100,000 $4,455,000 $6,555,000
22 Renton Connector
23 116th Ave SE Improvements
24 South 2nd Street Conversion Project
25 Williams Ave N Bridge Repair
26 Williams Ave S and Wells Ave S Conversion Project
27 Carr Road improvements
28 Houser Way Non‐Motorized Improvements
29 Houser Way North Widening and Realignment
30 Lake to Sound (L2S) Trail $2,800,000 $2,800,000
31 Lake Washington Blvd N/ Southport Access Improvements $2,000,000 $2,000,000
32 Lind Ave SW Roadway Widening
33 Logan Ave North Improvements
34 Maple Valley Highway Barriers
35 Monster Road SW/68th Ave S Roadway Improvements
36 NE 3rd Street / NE 4th Street Corridor Improvements
37 Nile Ave NE Bridge Repair
38 Rainier Ave N Corridor Improvements Phase 5
39 Renton Bus Rapid Transit (BRT) Improvements
40 Renton Master Transit Plan
41 South 3rd Street Conversion Project
42 S/SW 7th Street Corridor Improvements
43 South Grady Way Multi‐Modal Improvements
44 South Lake Washington Transit Stop
45 Sunset Area Green Connections
46 SW 27th Street/Strander Boulevard Connection
47 Talbot Road S / S 177th St Improvements
TOTAL OTHER SOURCES $10,625,000 $625,000 $2,100,000 $4,455,000 $17,805,000
RESOURCE: OTHER (Developer Contributions, Other Agencies, etc)
24
AGENDA ITEM # 10. a)
Section E
Project Descriptions
2019 – 2024 Transportation Improvement Program
25
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 1
Project Title:Street Overlay
Community Planning Area:Citywide Fund:
Functional Classification:Local and Collector Project:
Project Length:various Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 28,000 - 4,000 24,000 4,000 4,000 4,000 4,000 4,000 4,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 14,161,226 1,671,226 1,730,000 10,760,000 1,030,000 1,110,000 2,010,000 2,110,000 2,200,000 2,300,000
Construction Services 455,947 63,947 56,000 336,000 56,000 56,000 56,000 56,000 56,000 56,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 14,645,173 1,735,173 1,790,000 11,120,000 1,090,000 1,170,000 2,070,000 2,170,000 2,260,000 2,360,000
Source of Fund:
Vehicle Fuel Tax 5,680,000 660,000 670,000 4,350,000 700,000 710,000 720,000 730,000 740,000 750,000
Business & Occupation Share 3,395,173 75,173 290,000 3,030,000 390,000 460,000 490,000 530,000 560,000 600,000
Fund Balance 30,000 - 30,000 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 800,000 - 800,000 - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Gen Fund Transfer)1,000,000 1,000,000 - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 3,740,000 - - 3,740,000 - - 860,000 910,000 960,000 1,010,000
Total Sources 14,645,173 1,735,173 1,790,000 11,120,000 1,090,000 1,170,000 2,070,000 2,170,000 2,260,000 2,360,000
122108
317
Street Overlay
Project Expenditures & Resources Programmed
Michelle Faltaous 425-430-7301
Annual program for repairing and resurfacing existing roadways. Installation of ADA compliant curb ramps has been incorporated into the Street Overlay Program in accordance
with federal requirements. This program funds overlays on neighborhood streets and collector streets while the Arterial Rehabilitation Program (TIP No. 2) funds principal and
minor arterials. This program allocates $100K/yr for the overlay of alleyways.
Asphalt concrete pavement (ACP) overlay and slurry seal of streets provide for improved driving surface and are highly cost-effective ways of avoiding expensive repairs and
reconstruction. The Pavement Management System and biennial survey of roadway conditions greatly improve the efficiency of the Overlay Program.
The 2016 "Pavement Management Program State of the Streets Report" rated the average Pavement Condition Index (PCI) as 68. According to the report, $78M will need to be
invested in pavement rehabilitation in the next 10 years to bring the PCI to 70 and maintain it at that level. The City will be conducting an updated street survey through the
summer of 2018.
Due to increasing ADA regulations starting in 2019, the annual design and contract award will be prepared by a Consultant. The ADA required curb ramps may be split out into its
own contract.
10,905,173 3,740,000
Programmed Pre-2019 Six-Year Program
26
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 2
Project Title:Arterial Rehabilitation Program
Community Planning Area:Citywide Fund:
Functional Classification:Principal and Minor Arterial Project:
Project Length:various Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 3,240,000 - - 3,240,000 - - - 1,030,000 1,080,000 1,130,000
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other (City Match)1,590,000 - - 1,590,000 - - - 510,000 530,000 550,000
Total Expenses 4,830,000 - - 4,830,000 - - - 1,540,000 1,610,000 1,680,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 1,590,000 - - 1,590,000 - - - 510,000 530,000 550,000
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 3,240,000 - - 3,240,000 - - - 1,030,000 1,080,000 1,130,000
Total Sources 4,830,000 - - 4,830,000 - - - 1,540,000 1,610,000 1,680,000
Arterial Rehabilitation Program
1,590,000 3,240,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
The 2016 "Pavement Management Program State of the Streets Report" rated the average Pavement Condition Index (PCI) as 68. According to the report, $78M will need to
ne invested in pavement rehabilitation in the next 10 years to bring the PCI to 70 and maintain it at that level. The City was awarded a $1,020,700 STP grant for the Renton
Ave Extension and $1,000,000 was awarded to SW 43rd St.
Expenditures and Funds for years 2019, 2020, & 2021 are reflected in individual TIP project sheets for Renton Ave Resurfacing (TIP #2.1) and SW 43rd Preservation (TIP
#2.2).
317
Michelle Faltaous 425-430-7301
This program provides for the rehabilitation of principal and minor arterial streets. Installation of ADA-compliant curb ramps has been incorporated into the annual Arterial
Rehabilitation and Overlay programs according to new federal requirements. This program will provide funding for the City match for larger federally funded projects.
The Overlay Program (TIP #1) concentrates to a great degree on maintaining residential streets, where relatively small traffic volumes and less truck and bus traffic make
standard asphalt overlays a long term means of maintenance. Arterial streets can often deteriorate rather quickly and often require more costly rehabilitation measures
and/or costly temporary repairs to avoid more extensive deterioration.
122186
27
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 2.1
Project Title:Arterial Rehabilitation - Renton Ave S Resurfacing
Community Planning Area:West Hill Fund:
Functional Classification:Minor Arterial Project:
Project Length:0.60 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 78,310 78,310 - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,875,390 - 1,325,390 550,000 550,000 - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,953,700 78,310 1,325,390 550,000 550,000 - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 505,655 78,310 152,345 275,000 275,000 - - - - -
Fund Balance 427,345 - 152,345 275,000 275,000 - - - - -
Grants Awarded (STP)1,020,700 - 1,020,700 - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 1,953,700 78,310 1,325,390 550,000 550,000 - - - - -
Arterial Rehabilitation - Renton Ave S Resurfacing
1,953,700 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
The construction of this project is being coordinated with development construction along Renton Ave S to minimize construction impacts and cost.
317
Hebe Bernardo 425-430-7232
This project will resurface 0.60 miles of Renton Ave S from S 130th St (west City Limits) to Hardie Ave SW and upgrade ADA ramps to current standards.
The roadway is classified as a T-2 truck route carrying 5.8 million tones of freight annually. The overall condition of the pavement will be improved and the project will extend the
pavement life (12-15 years). Renton Ave S is also an alternate route to SR-900, connecting Renton to the Skyway area and South Seattle.
The City was awarded a $1,020,700 STP grant for Pavement Preservation in 2016. Design is underway and will be completed in the Fall of 2018. Construction to be completed in
2019.
122185
28
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 2.2
Project Title:Arterial Rehabilitation - SW 43rd St Pavement Preservation
Community Planning Area:Valley Fund:
Functional Classification:Principal Arterial Project:
Project Length:1.17 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 220,000 - - 220,000 - 220,000 - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,820,000 - - 1,820,000 - - 1,820,000 - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 2,040,000 - - 2,040,000 - 220,000 1,820,000 - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 1,040,000 - - 1,040,000 - 220,000 820,000 - - -
Fund Balance - - - - - - - - - -
Grants Awarded (STP Preservation)1,000,000 - - 1,000,000 - - 1,000,000 - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - -
Total Sources 2,040,000 - - 2,040,000 - 220,000 1,820,000 - - -
2,040,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Arterial Rehabilitation - SW 43rd St Pavement Preservation
317
NEW
Michelle Faltaous 425-430-7301
This project will resurface the roadway from the western city limits to the SR 167 Ramps, except where there are existing concrete panels. This project will also upgrade all
intersection ramps to current ADA standards as well as install and replace all delineation to City of Renton standards. Also included in this project are the adjustment or evaluation
for replacement of existing features affected by resurfacing such as monuments, catch basins, or drainage grates.
This principal arterial and T-1 truck route is a major east-west corridor that serves and directly connects to the Sounder Station. SW 43rd St connects directly to SR 167 and is used
as a main access to Valley Medical Center, IKEA, and other major employment centers. Resurfacing this roadway will improve the overall condition of the pavement and the
project will extend the pavement life (12-15 years) of this key east-west South County corridor.
New project. The City was awarded a $1,000,000 STP grant for Pavement Preservation in 2018.
29
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 3
Project Title:Walkway Program
Community Planning Area:Citywide Fund:
Functional Classification:various Project:
Project Length:various Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 32,000 - 2,000 30,000 5,000 5,000 5,000 5,000 5,000 5,000
Preliminary Engineering 150,000 - - 150,000 25,000 25,000 25,000 25,000 25,000 25,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,231,088 73,088 8,000 1,150,000 150,000 200,000 200,000 200,000 200,000 200,000
Construction Services 120,000 - - 120,000 20,000 20,000 20,000 20,000 20,000 20,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,533,088 73,088 10,000 1,450,000 200,000 250,000 250,000 250,000 250,000 250,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 933,088 73,088 10,000 850,000 200,000 250,000 100,000 100,000 100,000 100,000
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 600,000 - - 600,000 - - 150,000 150,000 150,000 150,000
Total Sources 1,533,088 73,088 10,000 1,450,000 200,000 250,000 250,000 250,000 250,000 250,000
933,088 600,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Walkway Program
With the cost of design and construction of sidewalk projects exceeding the annual funding for this program, this program was used as match funding for grant applications in 2018.
317
120009
Hebe Bernardo 425-430-7232
This program provides for the design and construction of non-motorized transportation facilities for pedestrians as well as provide City match funding for larger federal and state
funded projects. Projects are identified and prioritized using criteria from the Comprehensive Citywide Walkway Study, Council direction, and through coordination with the City's
Neighborhood Program.
Providing safe and convenient non-motorized facilities is an integral part of a complete transportation network. Specific improvements will respond to the needs of school children,
the aged and persons with disabilities, and support increased use of transit.
The Comprehensive Citywide Walkway Study was completed in 2009 and is being used to select projects that move into the design and construction phases.
30
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 4
Project Title:Roadway Safety and Guardrail Program
Community Planning Area:Citywide Fund:
Functional Classification:various Project:
Project Length:various Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 21,000 - 3,000 18,000 3,000 3,000 3,000 3,000 3,000 3,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 175,000 714 24,286 150,000 20,000 20,000 25,000 25,000 30,000 30,000
Construction Services 14,000 - 2,000 12,000 2,000 2,000 2,000 2,000 2,000 2,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 210,000 714 29,286 180,000 25,000 25,000 30,000 30,000 35,000 35,000
210,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Roadway Safety and Guardrail Program
317
120110
Chris Barnes 425-430-7220
This program will provide guardrail improvements each year and improve the safety of the roadside environment.
This program will implement roadside safety improvements including barrier systems and hazardous object removal.
This program will develop a policy and standardized criteria for barriers and selection of projects.
31
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 5
Project Title:Intersection Safety & Mobility Program
Community Planning Area:Citywide Fund:
Functional Classification:various Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 314,000 - 44,000 270,000 45,000 45,000 45,000 45,000 45,000 45,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,380,000 99,652 30,348 1,250,000 150,000 100,000 250,000 250,000 250,000 250,000
Construction Services 356,000 - 26,000 330,000 55,000 55,000 55,000 55,000 55,000 55,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 2,050,000 99,652 100,348 1,850,000 250,000 200,000 350,000 350,000 350,000 350,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 200,000 99,652 100,348 - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 450,000 - - 450,000 250,000 200,000 - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 1,400,000 - - 1,400,000 - - 350,000 350,000 350,000 350,000
Total Sources 2,050,000 99,652 100,348 1,850,000 250,000 200,000 350,000 350,000 350,000 350,000
650,000 1,400,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Intersection Safety & Mobility Program
317
122601
Chris Barnes 425-430-7220
This program will install new traffic signals, software systems to improve traffic signal timing operations, central signal system upgrades or make improvements to existing signals
identified by the Transportation Systems' Traffic Signal Priority List. The Priority List is determined by citizen concerns, intersection safety, mobility needs, and intersections that
meet MUTCD traffic signal warrants.
Historically, one traffic signal is designed and constructed every two-three years to meet safety and mobility needs. This program budgets for projects needed to meet increasing
demand, and the need for signalized traffic control. Elements used to prioritize project intersections may include vehicular approach volumes, accident analysis, signal-warrant
analysis, and pedestrian volume.
Preliminary engineering and design will begin for SW 41st St. and Oakesdale Ave SW in 2018 and construction completed in 2020.
32
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 6
Project Title:Traffic Safety Program
Community Planning Area:Citywide Fund:
Functional Classification:various Project:
Project Length:various Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 34,905 34,905 - - - - - - - -
Preliminary Engineering 139,000 - 19,000 120,000 20,000 20,000 20,000 20,000 20,000 20,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 948,904 160,904 68,000 720,000 120,000 120,000 120,000 120,000 120,000 120,000
Construction Services 63,000 - 3,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000
Post Construction Services - - - - - - - - - -
Other (Trans to 503)11,000 11,000 - - - - - - - -
Total Expenses 1,196,809 206,809 90,000 900,000 150,000 150,000 150,000 150,000 150,000 150,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 345,000 55,000 90,000 200,000 130,000 70,000 - - - -
Fund Balance 113,259 103,259 - 10,000 10,000 - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 95,000 5,000 - 90,000 10,000 80,000 - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Landing Reimb)43,550 43,550 - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 600,000 - - 600,000 - - 150,000 150,000 150,000 150,000
Total Sources 1,196,809 206,809 90,000 900,000 150,000 150,000 150,000 150,000 150,000 150,000
596,809 600,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Traffic Safety Program
317
122115
Chris Barnes 425-430-7220
This ongoing yearly program provides funding for special small-scale traffic safety improvements that are identified and require materials, labor or equipment. This program
includes converting school zone signs to electronic operation, installation of pedestrian safety traffic signals including Rectangular Rapid Flashing Beacons (RRFB), and Hawk hybrid
beacon signals, bulbouts and radar speed signs for traffic calming.
Historically, this level of traffic safety improvements are required on an annual basis. This program budgets for safety projects to address these needs. Projects are typically
identified through citizen concerns, analysis of accident records or observation by City Traffic Operations personnel.
School speed zone flashing beacons and speed radar signs will be installed for traffic calming.
33
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 7
Project Title:Traffic Operation Devices Program
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 902,000 62,000 120,000 720,000 120,000 120,000 120,000 120,000 120,000 120,000
Fund Balance 97,000 73,763 23,237 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 999,000 135,763 143,237 720,000 120,000 120,000 120,000 120,000 120,000 120,000
999,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Traffic Operation Devices Program
317
122904
Eric Cutshall 425-430-7423
The City of Renton owns and operates 135 traffic signals, 4800+ street lights, 700+ lane miles and 12,000+ signs. This program replaces failed video detection cameras, signal heads,
signal cabinets, UPS batteries and LED indications as needed based on the findings from yearly maintenance programs. This program also provides for new/replacement of signs
that are obsolete, faded or that do not meet retro reflectivity requirements, replacement of damaged luminaire and signal poles. This program also replaces pavement markings
and failed C-curbing with a more maintenance friendly composite curbing.
Most of Renton's traffic signals and UPS systems require extensive maintenance and replacement programs to keep traffic signals operating as efficiently as possible. Signage
requires a maintenance program to maintain retro reflectivity requirements. Pavement deterioration has increased the number of failed loops throughout the City and as loops fail
they are replaced with video detection cameras and associated equipment.
Ongoing based on findings of yearly maintenance programs and engineering work orders.
34
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 8
Project Title:Intelligent Transportation Systems (ITS) Program
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 300,000 38,015 21,985 240,000 40,000 40,000 40,000 40,000 40,000 40,000
Construction Services 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 430,000 38,015 31,985 360,000 60,000 60,000 60,000 60,000 60,000 60,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 60,000 30,000 30,000 - - - - - - -
Fund Balance 10,000 8,015 1,985 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 120,000 - - 120,000 60,000 60,000 - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 240,000 - - 240,000 - - 60,000 60,000 60,000 60,000
Total Sources 430,000 38,015 31,985 360,000 60,000 60,000 60,000 60,000 60,000 60,000
190,000 240,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Intelligent Transportation Systems (ITS) Program
An additional $30,000/yr has been allocated to this program.
317
122162
Eric Cutshall 425-430-7423
Provides for improvements to the operational efficiency of the roadway system, including development and implementation of signal coordination programs, Adaptive Signal
Control, installation of fiber communication, PTZ cameras, Radar signs, LED signs, transit signal priority, Intelligent Traffic Systems (ITS) Master Plan and signal improvements such as
protective/permissive phasing.
Improving the capacity and efficiency of the existing roadway system is a cost effective element of the transportation program. Installing fiber communication creates higher
bandwidths so PTZ cameras can be installed. Fiber optic communication provides the Traffic Management Center with real time traffic conditions, adaptive signal control and ability
to view video detection systems. The goal is to have fiber installed to all 135 traffic signals.
This program is currently in the process of installing fiber communications and expanding adaptive signal control which affects 70% of the City's traffic signals.
35
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 9
Project Title:Sidewalk Rehabilitation and Replacement Program
Community Planning Area:Citywide Fund:
Functional Classification:various Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 204 204 - - - - - - - -
Preliminary Engineering 61,822 61,822 - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,498,537 361,679 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000
Construction Services 11,467 11,467 - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,572,030 435,172 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 850,000 100,000 100,000 650,000 100,000 110,000 110,000 110,000 110,000 110,000
Fund Balance 722,030 335,172 386,858 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 1,572,030 435,172 486,858 650,000 100,000 110,000 110,000 110,000 110,000 110,000
1,572,030 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Sidewalk Rehabilitation and Replacement Program
The 2019 program funding will be used to repair the sidewalk along Rainier Ave between S 2nd St and Tobin.
317
122801
Michelle Faltaous 425-430-2270
This program provides for the replacement of existing curb and gutter, sidewalks, and curb ramps where such facilities have deteriorated or have been damaged.
In order to address deficiencies and provide safe and convenient non-motorized facilities for pedestrians in neighborhoods, the City must have a program to analyze, repair or
replace damaged or deteriorated curb and gutter, sidewalks, and curb ramps. There are some places where curb ramps do not exist or are not to current ADA standards and they
will be upgraded through this program.
Staff continue to receive location requests from the public and other staff for review and prioritization.
36
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 10
Project Title:Bridge Inspection & Repair Program
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 385,056 88,056 87,000 210,000 30,000 20,000 40,000 40,000 40,000 40,000
R-O-W (includes Admin)- - - - - - - - - -
Construction 162,000 - 15,000 147,000 20,000 17,000 20,000 35,000 20,000 35,000
Construction Services - - - - - - - - - -
Post Construction Services 218,000 - 35,000 183,000 40,000 13,000 40,000 25,000 40,000 25,000
Other - - - - - - - - - -
Total Expenses 765,056 88,056 137,000 540,000 90,000 50,000 100,000 100,000 100,000 100,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 450,000 50,000 60,000 340,000 90,000 50,000 50,000 50,000 50,000 50,000
Fund Balance 115,056 38,056 77,000 - - - - - - -
Grants Awarded (FEMA)- - - - - - - - - -
Grants Awarded (State Share)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 200,000 - - 200,000 - - 50,000 50,000 50,000 50,000
Total Sources 765,056 88,056 137,000 540,000 90,000 50,000 100,000 100,000 100,000 100,000
565,056 200,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Bridge Inspection & Repair Program
317
120106
Derek Akesson 425-430-7337
The Transportation Division inspects 27 bridge structures owned by the City of Renton, every two years. The purpose of these inspections is to monitor the condition of bridge
elements in order to identify structural deficiencies in need of repair. The goals of the program are to keep the bridges open and safe for public use, preserve bridge infrastructure
by maximizing the useful lie through active maintenance, retrofitting and rehabilitation, and replace bridges with reliable new structures when repair or rehabilitation is not
feasible.
Per Federal Regulations, the City is required to perform a bridge condition inspection for all bridges, located in the public right-of-way and open for public use, that span 20-ft or
more. WSDOT recommends condition inspections be performed on all short span and pedestrian bridges, located with the public right-of-way and open for public use. In order to
qualify for Federal Highway Administration (FHWA) bridge funding, the City must stay in compliance with the Federal Regulations.
Funds shown under construction are for minor repairs to bridge structures.
37
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 11
Project Title:Barrier Free Transition Plan Implementation
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 65,000 - 5,000 60,000 10,000 10,000 10,000 10,000 10,000 10,000
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 416,000 5,171 46,829 364,000 44,000 64,000 64,000 64,000 64,000 64,000
Construction Services 39,000 - 3,000 36,000 6,000 6,000 6,000 6,000 6,000 6,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 520,000 5,171 54,829 460,000 60,000 80,000 80,000 80,000 80,000 80,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 175,171 5,171 30,000 140,000 60,000 80,000 - - - -
Fund Balance 24,829 - 24,829 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 320,000 - - 320,000 - - 80,000 80,000 80,000 80,000
Total Sources 520,000 5,171 54,829 460,000 60,000 80,000 80,000 80,000 80,000 80,000
200,000 320,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Barrier Free Transition Plan Implementation
An additional $30,000 for 2019 and $40,000/yr for years 2020-2024 have been allocated to this program.
317
122705
Dan Hasty 425-430-7217
This program provides funding for designing and building features on an "as needed" basis in response to individual requests to improve access for individuals with special needs. A
project list has been developed based upon sites identified in the Transition Plan section of the City of Renton Comprehensive Citywide Sidewalk Study.
This program implements projects that support the City's effort to transition pedestrian facilities within the right-of-way into conformity with provisions contained in the Americans
with Disabilities Act (ADA) Guidelines. The ADA Transition Plan has been adopted on May 18 2015. A programmatic approach is required to ensure compliance with federal law.
Maintenance of the GIS database to continue Self Evaluation of existing curb ramps, newly constructed curb ramps, annexations, capital improvement projects, and/or physical
condition changes is ongoing.
38
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 12
Project Title:Project Development & Pre-Design Program
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 766,795 77,233 89,562 600,000 100,000 100,000 100,000 100,000 100,000 100,000
Preliminary Engineering 343,204 13,204 30,000 300,000 50,000 50,000 50,000 50,000 50,000 50,000
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 1,110,000 90,438 119,562 900,000 150,000 150,000 150,000 150,000 150,000 150,000
1,110,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Project Development & Pre-Design Program
The Trails and Bicycle Master Plan Update is anticipated to be completed in the end of 2018. Once the Trails and Bicycle Master Plan is complete, staff will work on updating the
Comprehensive Citywide Walkway Study (last updated in 2009).
317
122150
Vangie Garcia 425-430-7319
Perform critical activities needed for the development of transportation projects that will best serve the needs of Renton and be eligible for grant applications. Also provides for
the monitoring of active grant projects for compliance with State and Federal laws, regulations and specifications.
Other critical activities to develop future capital improvement projects consist of but are not limited to project scoping, cost estimates, pre-design, interlocal agreements, analyses
of existing and projected transportation problems, local and regional mobility goals and deficiency analysis.
This program includes small studies funding. Transportation, in partnership with Parks Division is updating the Trail and Bicycle Master Plan.
39
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 13
Project Title:Arterial Circulation Program
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 1,093,454 53,454 145,000 895,000 145,000 150,000 150,000 150,000 150,000 150,000
Fund Balance 1,546 - 1,546 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 1,095,000 53,454 146,546 895,000 145,000 150,000 150,000 150,000 150,000 150,000
1,095,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Arterial Circulation Program
Transportation will develop a work plan to create a Transit Master Plan.
317
120029
Vangie Garcia 425-430-7319
This program provides for the short and long-range planning and traffic analyses required to evaluate and update proposed transportation improvements projects, to assess the
impacts of new development proposals, and to recommend local and regional transportation system improvements for all modes of travel. This program also covers programmatic
activities to maintain eligibility for grant funding, such as assuring that project specifications and management comply with current State and Federal standards and regulations,
Title VI reporting and ADA Transition Plan implementation. This program will also provide coordination with the I-405 project team, to assure it provides the maximum benefits and
minimum problems for Renton's transportation system.
State and Federal government regulations and legislation, the Growth Management Act (GMA), and the Puget Sound Regional Council Vision 2040 highlight the increasing
importance of making sure that local and regional transportation plans are coordinated to the benefit of Renton make ongoing multi-modal planning a high priority need. In order
to meet the City's Business Plan Goals, transportation will play a key role with public and private partnerships to promote economic vitality.
This project will fund the ongoing planning work which will lead to refinement and/or adjustment of the of improvement projects on the arterial network identified in the
Transportation Element of the City's 2015 Comprehensive Plan and other long-range planning documents.
40
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 14
Project Title:1% For The Arts Program
Community Planning Area:N/A Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Spent 2017 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 133,823 28,823 15,000 90,000 15,000 15,000 15,000 15,000 15,000 15,000
133,823 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
1% For The Arts Program
317
122112
Heather Gregersen 425-430-7393
Funding is tied to the calculated share of eligible types of transportation projects and transportation funding subject to the City's 1% for the Arts Program. All gateway project
proposals under this program are subject to approval of the Arts Commission.
This program transfers funds to Fund 125, which is being managed by the Department of Community and Economic Development.
Program is now based on actual design and construction costs.
$11,151 was transferred in 2013 for 2012 capital expenditures.
$10,454 was transferred in 2014 for 2013 capital expenditures.
$9,344 was transferred in 2015 for 2014 capital expenditures.
$16,767 was transferred in 2016 for 2015 expenditures.
$28,823 was transferred in 2017 for 2016 expenditures.
41
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 15
Project Title:Bronson Way Bridge - Seismic Retrofit and Painting
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,950,000 - - 1,950,000 - 1,950,000 - - - -
Construction Services 430,000 - - 430,000 - 430,000 - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (FHWA Bridge 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 3,000,000 - 70,000 2,930,000 420,000 2,510,000 - - - -
3,000,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Bronson Way Bridge - Seismic Retrofit and Painting
317
NEW
Derek Akesson 425-430-7337
The Bronson Way Bridge was built by WSDOT in 1939. Ownership was transferred to the City in January 2018 as part of the SR-900 turnback agreement. It is a three span bridge
that crosses over the Cedar River. The project will remove the existing paint from the steel girders, repair corrosion damage and apply a new protective paint system. The project
will also perform a seismic analysis and retrofit along with other improvements.
The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load carrying
capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquefication susceptibility during seismic events.
New project. In April 2018, the project was awarded $3,000,000 of Washington State funding (2018 Supplemental Transportation Budget) to perform a seismic retrofit and painting
of the bridge. No local match is required.
42
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 16
Project Title:Duvall Ave NE - NE 7th St to Sunset Blvd NE
Community Planning Area:Highlands & East Plateau Fund:
Functional Classification:Minor Arterial Project:
Project Length:0.67 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,044,136 353,250 335,435 355,451 355,451 - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 4,559,488 - 3,576,000 983,488 983,488 - - - - -
Construction Services 900,200 - 727,000 173,200 173,200 - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 6,503,824 353,250 4,638,435 1,512,139 1,512,139 - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 90,000 - 60,000 30,000 30,000 - - - - -
Fund Balance & Held Reserve 649,121 90,838 447,658 110,625 110,625 - - - - -
Grants Awarded (TIB 74.285%)3,468,289 262,412 3,205,877 - - - - - - -
Grants Awarded (DOE 75%)1,223,939 - 174,900 1,049,039 1,049,039 - - - - -
Mitigation 1,072,475 - 750,000 322,475 322,475 - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Water Dept)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 6,503,824 353,250 4,638,435 1,512,139 1,512,139 - - - - -
6,503,824 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Duvall Ave NE - NE 7th St to Sunset Blvd NE
The City was awarded a TIB grant in the amount of $3,468,289 (2015) for the roadway reconstruction between NE 10th St and NE 12th St, curb, gutter, sidewalk and streetlights on
the west side and channelization from NE 12th St to south of the intersection with NE Sunset Blvd. The City was also awarded a Department of Ecology (DOE) grant (2018) in the
amount of $1,223,939 for water quality improvements via the installation of water quality treatment facilities. A future phase will install non-motorized improvements along the
east side of Duvall Ave NE, from NE 7th St to NE 12th St.
This project is anticipated to be ready for construction in early 2019.
317
122702
Flora Lee 425-430-7303
Reconstruction/resurfacing of roadway, including new pavement, curb, gutter, sidewalk, street lights, storm drainage, channelization and bike lanes from NE 7th St to Sunset Blvd
NE.
Complete roadway improvements, bicycle lanes and sidewalks on Duvall Ave NE, from NE 7th St to Sunset Blvd NE. Condition of the existing roadway pavement requires road
reconstruction in segments of the roadway. Project will enhance safety for pedestrians, bicyclists and vehicular along this corridor.
43
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 17
Project Title:Houser Way Bridge - Seismic Retrofit and Painting
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - -
R-O-W (includes Admin)50,000 - - 50,000 50,000 - - - - -
Construction 2,189,450 - - 2,189,450 - 2,189,450 - - - -
Construction Services 435,000 - - 435,000 - 212,450 222,550 - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 3,294,450 - 70,000 3,224,450 470,000 2,531,900 222,550 - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance 72,900 - 9,450 63,450 63,450 - - - - -
Grants Awarded (FHWA Bridge 2,999,000 - 60,550 2,938,450 406,550 2,531,900 - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 222,550 - - 222,550 - - 222,550 - - -
Total Sources 3,294,450 - 70,000 3,224,450 470,000 2,531,900 222,550 - - -
3,071,900 222,550
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Houser Way Bridge - Seismic Retrofit and Painting
317
NEW
Derek Akesson 425-430-7337
The Houser Way Bridge was built by the City of Renton in 1960. It is a three span bridge that crosses over the Cedar River. The project will remove the existing paint from the steel
girders, repair corrosion damage and apply a new protective paint system. The project will also perform a seismic analysis and retrofit and replace/upgrade the bridge rails along
with other improvements.
The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load carrying
capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquification susceptibility during seismic events. The bridge rail has been
damaged.
New project. In late 2017, the project was awarded a Federal Highway Administration (FHWA) grant of $2,999,000 to perform a seismic retrofit and painting of the bridge. A 13.5%
local match is required for Preliminary Engineering and ROW. If construction is authorized by December 2020, the project is eligible for 100% FHWA funding for the eligible costs.
44
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 18
Project Title:Lake Washington Loop Trail
Community Planning Area:City Center Fund:
Functional Classification:varies Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 2,261,301 597,219 314,082 1,350,000 - - 1,200,000 150,000 -
R-O-W (includes Admin)670,000 - 670,000 - - - - - - -
Construction 4,880,000 - 530,000 4,350,000 300,000 1,350,000 - - 200,000 2,500,000
Construction Services 1,492,000 - 27,000 1,465,000 40,000 75,000 - - 600,000 750,000
Post Construction Services - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 9,303,301 597,219 1,541,082 7,165,000 340,000 1,425,000 - 1,200,000 950,000 3,250,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 124,984 49,984 - 75,000 - 75,000 - - - -
Fund Balance + Held Reserve - - - - - - - - - -
Grants Awarded (TAP)346,000 329,855 16,145 -
Grants Awarded (STP ROW)575,000 - 575,000 - - - - - - -
Grants Awarded (Ped/Bike
Program - PE Phase 3)426,000 217,380 208,620 - - - - - - -
Grants Awarded (Ped/Bike
Program - CN)430,000 - 370,659 59,341 59,341 - - - - -
Grants Awarded (STP - CN
Phase 3 1,694,278 370,658 1,323,620 280,659 1,042,961 - - - -
Mitigation 307,039 - - 307,039 - 307,039 - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 5,400,000 - - 5,400,000 - - 1,200,000 950,000 3,250,000
Total Sources 9,303,301 597,219 1,541,082 7,165,000 340,000 1,425,000 - 1,200,000 950,000 3,250,000
3,903,301 5,400,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Lake Washington Loop Trail
Phase 3 construction is expected to start in the fall or winter of 2019.
317
122802
Michelle Faltaous 425-430-7301
The project will construct approximately 1.3 miles of pedestrian and bicycle facilities to complete a gap in the Lake Washington trail system. Improvements include a 12-foot wide
combined pedestrian/bicycle path, a landscaped buffer separating the path from the travelled roadway, pedestrian level lighting. For the segment located along Airport Way, the
facilities will include a bike track and sidewalk, which will involve removing one westbound lane of traffic on Airport Way.
The project will separate pedestrians and bicyclists from the vehicular traffic, enhancing safety and encouraging residents to use active transportation modes.
The City was awarded the following grants: TAP = $346,000 (2013); STP Non-Motorized = $575,000 (2015); Ped & Bike = $426,000 (2015); STP = $1,694,278; Ped & Bike Safety = $
430,000 (under recommendation for 2017). Construction has been implemented in phases, with Phases 1 and 2 completed. Phase 3 (Logan Ave N/Cedar River to Rainier Ave N)
design is underway.Phase 4 is from Airport Way/Rainier Ave N intersection to north City limits (programmed in 2020-2022).
45
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 19
Project Title:NE Sunset Boulevard (SR 900) Corridor Improvements
Community Planning Area:Highlands Fund:
Functional Classification:Principal Project:
Project Length:3.0 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 200,000 200,000 - - - - - - - -
Preliminary Engineering 3,500,833 501,831 990,002 2,009,000 209,000 - 1,000,000 600,000 200,000 -
R-O-W (includes Admin)3,300,000 - - 3,300,000 250,000 2,750,000 300,000 - - -
Construction 20,000,000 - - 20,000,000 - - 5,000,000 5,000,000 5,000,000 5,000,000
Construction Services 5,000,000 - - 5,000,000 - - 1,250,000 1,250,000 1,250,000 1,250,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 32,000,833 701,831 990,002 30,309,000 459,000 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 312,866 2,364 277,527 32,975 32,975 - - - - -
Fund Balance + Held Reserve 324,032 74,032 250,000 - - - - - - -
Grants Awarded (STP/CMAQ)1,313,935 425,435 462,475 426,025 426,025 - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (REET)200,000 200,000 - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 29,850,000 - - 29,850,000 - 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000
Total Sources 32,000,833 701,831 990,002 30,309,000 459,000 2,750,000 7,550,000 6,850,000 6,450,000 6,250,000
2,150,833 29,850,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
NE Sunset Boulevard (SR 900) Corridor Improvements
30% Design of the corridor improvements is completed. WSDOT is currently reviewing the channelization plan. Project will be on hold until ROW funding can be identified.
317
122902
Keith Woolley 425-430-7318
This project will seek to address pedestrian, transit and bicycle needs. This corridor needs a series of key improvements to improve traffic operations such as channelization, traffic
signal modifications, signal treatments, possible queue jumps, access management through installation of medians. The corridor limits are from I-405 on the west and to the east
City limits.
This corridor has strong potential for non-motorized and transit usage. The Sunset area is experiencing residential and retail growth.
The Sunset Area Planned Action EIS prepared in 2011 delineated transportation needs along Sunset Blvd from N Park Dr to Monroe Ave NE (estimated at $33M).
The project has received a STP/CMAQ grant in the amount of $1,313,935 for design and is on the PSRC contingency list for ROW funding. Transportation will continue to look into
other funding sources, such as TIB, for the ROW and construction phases.
46
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 20
Project Title:Park Avenue North Extension
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:0.23 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,000,000 100,091 649,909 250,000 250,000 - - - - -
R-O-W (includes Admin)1,500,000 - 300,000 1,200,000 1,200,000 - - - - -
Construction 4,000,000 - - 4,000,000 3,500,000 500,000 - - - -
Construction Services 1,000,000 - - 1,000,000 875,000 125,000 - - - -
Post Construction Services - - - - - - - - - -
Other (BNSF/Gate)- - - - - - - - - -
Total Expenses 7,500,000 100,091 949,909 6,450,000 5,825,000 625,000 - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 100,091 100,091 - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (LRF)7,399,909 - 949,909 6,450,000 5,825,000 625,000 - - - -
Other (Developer)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 7,500,000 100,091 949,909 6,450,000 5,825,000 625,000 - - - -
Park Avenue North Extension
7,500,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
317
122190
Hebe Bernardo 425-430-7232
The project will extend Park Ave N to the north of Logan Ave N, to provide access to Southport, PSE property and The Boeing Company. Improvements include bicycle and
pedestrian facilities, illumination, landscaping.
With the additional development growth in the North Renton area, which includes The Landing and the Southport residential/hotel/office development, this project will construct
improvements to improve accessibility.
The design work will be completed in 2019 and the project is scheduled to go to bid in June of 2019.
47
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 21
Project Title:Rainier Ave S/N Phase 4 - S 3rd Street to NW 3rd Pl
Community Planning Area:City Center Fund:
Functional Classification:Principal Project:
Project Length:0.51 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 3,000,000 543,395 1,505,282 951,323 500,000 451,323 - - - -
R-O-W (includes Admin)3,500,000 - - 3,500,000 1,000,000 1,500,000 1,000,000 - - -
Construction 10,500,000 - - 10,500,000 - - 6,000,000 4,500,000 - -
Construction Services 3,300,000 - - 3,300,000 - - 1,800,000 1,350,000 150,000 -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 20,300,000 543,395 1,505,282 18,251,323 1,500,000 1,951,323 8,800,000 5,850,000 150,000 -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 709,600 56,387 103,213 550,000 - - 100,000 450,000 - -
Fund Balance 239,552 39,552 100,000 100,000 - - 100,000 - - -
Grants Awarded (STP PE)2,600,000 447,456 1,302,069 850,475 750,475 100,000 - - - -
Grants Awarded (STP ROW)3,000,000 - - 3,000,000 442,000 1,258,000 1,300,000 - - -
Grants Awarded (STP CN)4,500,000 - - 4,500,000 - - 4,500,000 - - -
Mitigation 2,695,848 - - 2,695,848 307,525 593,323 700,000 945,000 150,000 -
Bonds / LID's Formed - - - - - - - - - -
Other (TIB Grant)*6,555,000 - - 6,555,000 - - 2,100,000 4,455,000 - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 20,300,000 543,395 1,505,282 18,251,323 1,500,000 1,951,323 8,800,000 5,850,000 150,000 -
20,300,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Rainier Ave S/N Phase 4 - S 3rd Street to NW 3rd Pl
Phase 4 of the Rainier Ave S Corridor Improvements has been separated into two phases due to cost and feasibility. Currently, there is a Renton Airport Master Plan process that
may affect the alignment of Airport Way, which is at the northern end of Phase 4. This grant request is to fund the construction of Phase 4A from S 3rd St to S Tobin St. The City of
Renton will construct Phase 4B after the Airport Master Plan is final and approved. *Transportation plans to also apply for a TIB grant for the construction of Phase 4A. Previous
phases of Rainier were constructed with TIB funds but if this phase does not receive TIB funding, the City will use local funds to construct the project.
317
122195
Michelle Faltaous 425-430-7301
This is Phase 4 of the Rainier Ave Corridor Improvements, and will extend the improvements from S 3rd St to NW 3rd Pl. Project elements include sidewalk widening with
streetscaping, adding pedestrian-scale illumination, adding a pedestrian actuated traffic signal, upgrading existing traffic signals, transit facility improvements, planted buffer
strips and landscaped medians. Also includes a ped/bike path on the east side of Rainier Ave N, between Airport Way and NW 3rd Pl.
Rainier Ave is a critical corridor in central Renton with existing operational problems and in need of infrastructure enhancements to provide greater ease of non-motorized and
transit-based travel. It also provides improved access to the Renton Airport and Boeing's Renton Plant. Improvements will enhance traffic flow and reduce accidents.
A STP grant in the amount of $2,600,000 was awarded (2014) for design of Phase 4 and design is currently underway. Additional STP grants were awarded for Right-of-Way for
$3,000,000 and for construction of Phase 4A for $4,500,000.
48
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 22
Project Title:Renton Connector
Community Planning Area:City Center Fund:
Functional Classification:Urban Collector Project:
Project Length:0.5 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,500,000 - - 1,500,000 - - 278,700 621,300 600,000 -
R-O-W (includes Admin)- - - - - - - - - -
Construction 12,213,000 - - 12,213,000 - - - - 3,363,000 8,850,000
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 13,713,000 - - 13,713,000 - - 278,700 621,300 3,963,000 8,850,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 13,713,000 - - 13,713,000 - - 278700 621,300 3,963,000 8,850,000
Total Sources 13,713,000 - - 13,713,000 - - 278,700 621,300 3,963,000 8,850,000
- 13,713,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Renton Connector
317
NEW
Vangie Garcia 425-430-7319
The Renton Connector project will install a continuous non-motorized facility along Burnett Ave S. between S. 2nd St and S. 5th St via separated walkways, protected bicycle lanes
(cycle track), and a multi-use path. This project will also include reduced travel lanes, landscaped medians, and reconfigured public parking areas in order to provide opportunities
to incorporate art, play spaces, and resting areas along the connector. Intersection improvements will include traffic signalization improvements and curb ramp upgrades to ADA
standards.
As a key element of the Downtown Civic Core Vision and Action Plan, The Renton Connector is a new urban trail, or "greenway", that creates a signature Civic Core and Downtown
green spine and regional trail connection between the Cedar River Trail, Lake to Sound Trail, Lake Washington Loop Trail, and the Eastside Rail Corridor for pedestrians and cyclists
between the Cedar River, City Hall and the South Renton Transit Center to the South.
New Project. Project is pending funding availability. Transportation has applied for grants to begin design and will continue to look into other funding sources.
49
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 23
Project Title:116th Ave SE Improvements
Community Planning Area:Benson Fund:
Functional Classification:Minor Arterial Project:
Project Length:2.5 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,313,179 113,179 - 1,200,000 - - 600,000 600,000 - -
R-O-W (includes Admin)2,800,000 - - 2,800,000 - - 1,000,000 1,800,000 - -
Construction 5,315,028 615,028 - 4,700,000 - - - 1,000,000 2,000,000 1,700,000
Construction Services 1,547,102 147,102 - 1,400,000 - - - 300,000 600,000 500,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 10,975,309 875,309 - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 221,638 221,638 - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (CMAQ+SRTS)653,671 653,671 - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 10,100,000 - - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000
Total Sources 10,975,309 875,309 - 10,100,000 - - 1,600,000 3,700,000 2,600,000 2,200,000
875,309 10,100,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
116th Ave SE Improvements
Transportation applied for a FY 2020 WSDOT Pedestrian-Bicycle grant for the design of a walkway and a bike lane on the west side of 116th Ave SE, between SE 168th St and SE
160th St.
317
122117
Flora Lee 425-430-7303
Widen roadway to provide a 3-lane roadway with bike lanes along 116th Ave SE and Edmonds Way SE, including new pavement, curb, gutter, sidewalk, street lights, traffic signals,
storm drainage, channelization and landscaping from Puget Drive SE to the southern City limits. Benson Hill Community Plan recommended improvements for a first phase, based
on the neighborhood needs. The priority, cost and schedule for the phased improvements will be determined based on available funding.
116th Ave SE is classified as a minor arterial. Non-continuous segments of sidewalk exist along the roadway. Improvements will enhance vehicular, bicycle and pedestrian safety
along this important north-south transportation corridor.
The corridor improvements are estimated at $33M. Phase 1 Improvements (SE Petrovitsky Rd to SE 168th St) are shown as programmed for 2020-2024. Staff will be developing
scope, cost and schedule for future phases.
50
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 24
Project Title:South 2nd Street Conversion Project
Community Planning Area:City Center Fund:
Functional Classification:Principal Project:
Project Length:0.5 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,450,000 - - 1,450,000 100,000 1,350,000 - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 12,000,000 - - 12,000,000 - - - 6,000,000 6,000,000 -
Construction Services 3,600,000 - - 3,600,000 - - - 1,800,000 1,800,000 -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 17,050,000 - - 17,050,000 - 100,000 1,350,000 7,800,000 7,800,000 -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 100,000 - - 100,000 - 100,000 - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (STP)1,200,000 - - 1,200,000 - - 1,200,000 - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (WSDOT Turnback)364,931 - - 364,931 - - 150,000 214,931 - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 15,385,069 - - 15,385,069 - - 7,585,069 7,800,000 -
Total Sources 17,050,000 - - 17,050,000 - 100,000 1,350,000 7,800,000 7,800,000 -
South 2nd Street Conversion Project
1,664,931 15,385,069
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
The City was awarded $1.2M STP funds for preliminary engineering in the PSRC Countywide competition. There is $300,000 for this project that is third in line on the Regional
project contingency list.
317
Vangie Garcia 425-430-7319
The South 2nd Street Conversion Project will be improving multimodal mobility in around the downtown core by converting an existing 4–lane one-way roadway to a roadway
with one through-lane in each direction between Main Ave South and Rainier Ave South. This project also includes pedestrian and bicycle facilities, traffic operations
improvements, and transit upgrades that will provide better traffic operation and circulation for all modes of transportation. The improvements include a westbound bypass
transit lane from just west of Logan Ave S to just east of Lake Avenue. Transit facility upgrades include new RapidRide stops and a transit queue jump at the new traffic signal at
the Shattuck intersection.
This project is one of the strategies identified in the City Center Community Plan as well as the Downtown Civic Core Action Plan. The project enhances downtown Renton as a
destination area, while improving circulation and enhancing pedestrian safety and environment. The intersection of S 2nd St and Burnett is key connection to The Renton
Connector Project (TIP No. 22)
Since grant funding for design is for FY 2021, we hope to request advance construction funds to get started on design in order to apply for more grant opportunities.
51
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 25
Project Title:Williams Ave Bridge - Seismic Retrofit and Painting
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 620,000 - 70,000 550,000 420,000 130,000 - - - -
R-O-W (includes Admin)50,000 - - 50,000 50,000 - - - - -
Construction 2,175,450 - - 2,175,450 - 2,175,450 - - - -
Construction Services 435,000 - - 435,000 - 435,000 - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 3,280,450 - 70,000 3,210,450 470,000 2,740,450 - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 132,000 - 9,450 122,550 - 122,550 - - - -
Fund Balance 163,450 - - 163,450 63,450 100,000 - - - -
Grants Awarded (FHWA Bridge 2,985,000 - 60,550 2,924,450 406,550 2,517,900 - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 3,280,450 - 70,000 3,210,450 470,000 2,740,450 - - - -
3,280,450 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Williams Ave Bridge - Seismic Retrofit and Painting
317
NEW
Derek Akesson 425-430-7337
The Williams Ave Bridge was built by the City of Renton in 1954. It is a three span bridge that crosses over the Cedar River. The project will remove the existing paint from the steel
girders, repair corrosion damage and apply a new protective paint system. The project will also perform a seismic analysis and retrofit along with other improvements.
The main span is carried by steel girders. The girders are coated with paint to protect the steel from corrosion. Corrosion causes section loss which results in a reduced load
carrying capacity of the girders. The existing paint is failing. The bridge is located in a zone of moderate to high liquefication susceptibility during seismic events.
New project. In late 2017, the project was awarded a Federal Highway Administration (FHWA) grant of $2,985,000 to perform a seismic retrofit and painting of the bridge. A 13.5%
local match is required for Preliminary Engineering and ROW. If construction is authorized by December 2020, the project is eligible for 100% FHWA funding for eligible costs.
52
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 26
Project Title:Williams Ave S and Wells Ave S Conversion Project
Community Planning Area:City Center Fund:
Functional Classification:Principal Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 1,147,300 128,030 1,019,270 - - - - - - -
R-O-W (includes Admin)130,000 - 130,000 - - - - - - -
Construction 7,547,000 - 2,364,931 5,182,069 1,233,800 3,948,269 - - - -
Construction Services 2,100,000 - - 2,100,000 500,000 1,600,000 - - - -
Post Construction Services - - - - - - - - - -
Other (BNSF CM Agreement)1,000,000 - - 1,000,000 200,000 800,000 - - - -
Total Expenses 11,924,300 128,030 3,514,201 8,282,069 1,933,800 6,348,269 - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 220,000 - 10,000 210,000 30,000 180,000 - - - -
Fund Balance 540,000 128,030 411,970 - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (STP)3,850,000 - - 3,850,000 1,453,800 2,396,200 - - - -
Mitigation 1,157,965 - 407,965 750,000 450,000 300,000 - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (WSDOT Mitigation)319,335 - 319,335 - - - - - - -
Other (WSDOT Turnback)2,364,931 - 2,364,931 - - - - - - -
Other (Utilties Reimb)- - - - - - - - - -
- - - - - - - - - -
Undetermined 3,472,069 - - 3,472,069 - 3,472,069 - - - -
Total Sources 11,924,300 128,030 3,514,201 8,282,069 1,933,800 6,348,269 - - - -
8,452,231 3,472,069
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Williams Ave S and Wells Ave S Conversion Project
The City was awarded a STP grant in the amount of $3,850,000 in 2016. Design starting in 2017 and construction is anticipated to start in 2019.
317
122908
Keith Woolley 425-430-7318
The project provides pedestrian and bicyclists facilities and enhancements, traffic operation and circulation improvements in Downtown. The improvements include adding
signalized raised intersections with bulb outs, lighting, street furniture, streetscape, bike racks, signage and converting Williams Ave S and Wells Ave S to two-way traffic
operations.
This project is one of the strategies identified in the City Center Community Plan. The project enhances downtown Renton as a destination area, while improving circulation,
reducing traffic speeds and enhancing pedestrian safety. A feasibility study, including a Downtown Circulation Traffic Analysis for the conversion to two-way operations was
completed.
53
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 27
Project Title:Carr Road Improvements
Community Planning Area:Talbot & Benson Fund:
Functional Classification:Major Arterial Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 50,000 - - 50,000 50,000 - - - - -
Preliminary Engineering 784,421 666,866 117,555 - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 834,421 666,866 117,555 50,000 50,000 - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance 78,424 78,424 - - - - - - - -
Grants Awarded (Fed Safety)660,000 542,445 117,555 - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 95,997 45,997 - 50,000 50,000 - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 834,421 666,866 117,555 50,000 50,000 - - - - -
834,421 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Carr Road Improvements
317
122920
Vangie Garcia 425-430-7319
A corridor study prepared by King County in 2003 identified the need for roadway improvements from Lind Ave SW and SW 43rd St intersection and extend east crossing SR 167
and ending at 116th Ave SE. Potential improvements vary from roadway realignment/widening at several locations to address geometric deficiencies, widening to 5-lane roadway
(2 lanes westbound, 3 lanes eastbound), including bicycle lanes on new alignment. The total project cost is estimated as $80M.
Carr Road is classified as a principal arterial. It has four lanes of traffic with left-turn lanes at intersections. Improvements are necessary to enhance vehicle traffic capacity and
safety for vehicles, bicycles, and pedestrians on this major east-west transportation corridor.
Future roadway improvement options include spot safety improvements, bicycle and pedestrian improvements, roadway widening and roadway on new alignment. Staff will be
developing scope, cost and schedule for the intersection of Talbot Rd near Valley Medical Center.
54
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 28
Project Title:Houser Way S/N Non-Motorized Improvements
Community Planning Area:City Center Fund:
Functional Classification:Principal Arterial Project:
Project Length:0.36 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 220,000 - - 220,000 - - - 220,000 - -
R-O-W (includes Admin)165,000 - - 165,000 - - - 165,000 - -
Construction 750,000 - - 750,000 - - - - 400,000 350,000
Construction Services 900,000 - - 900,000 - - - - 360,000 540,000
Post Construction Services 152,000 - - 152,000 - - - - 76,000 76,000
Other - - - - - - - - - -
Total Expenses 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000
Total Sources 2,187,000 - - 2,187,000 - - - 385,000 836,000 966,000
- 2,187,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Houser Way S/N Non-Motorized Improvements
317
NEW
Vangie Garcia 425-430-7319
This project would install a separated bike facility on the north side of Houser Way S/N, between Mill Ave S. and Bronson Way N. Intersection crossings would be improved at
Cedar River Park Drive and Mill Ave S. The project will include planing and pavement overlay, channelization, and intersection crossing improvements. For feasibility and
constructibility issues, the roadway and pedestrian bridge sections would not be part of this project.
The feedback during the public engagement process for the Trails and Bicycle Master Plan update identified Houser Way as the route for the Eastside Rail Corridor alignment. With
the development of the Civic Core Plan, development of this section of the bicycle network creates an important connection point for bicycle traffic between the north and south
portions of the City's urban growth center. Creating a bike facility down to Mill Ave S creates a connection to the Cedar River Trail. The crossing at Cedar River Park Drive is a
connection point for people connecting from Liberty Park to the Renton Community Center.
New Project.
55
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 29
Project Title:Houser Way North - North 8th Street to Lake Washington Blvd
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 900,000 - - 900,000 - - - 900,000 - -
R-O-W (includes Admin)165,000 - - 165,000 - - - 165,000 - -
Construction 3,000,000 - - 3,000,000 - - - - 1,200,000 1,800,000
Construction Services 900,000 - - 900,000 - - - - 360,000 540,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000
Total Sources 4,965,000 - - 4,965,000 - - - 1,065,000 1,560,000 2,340,000
317
Houser Way North - North 8th Street to Lake Washington Blvd
Bob Mahn 425-430-7322
This project will widen and realign the existing one lane roadway to a two-lane roadway and includes intersection improvements to convert Houser Way N to a two-way operation.
Includes new roadway, curbs, pedestrian-bicycle path, drainage, signals, lighting, signing and channelization.
The City of Renton travel demand model predicts traffic volumes increasing significantly in the North Renton Area in the near future. One of the recommendations to improve
northbound access to Lake Washington Blvd is to convert Houser Way N to a two-way operations, between N 8th St and Lake Washington Blvd.
A conceptual layout of the two-way approach to the intersection of Houser Way and Lake WA Blvd has been completed. This project will coordinate with the Southport
Development improvements to the Southport entrance at the Lake WA Blvd/Coulon Park intersection.
- 4,965,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
56
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 30
Project Title:Lake to Sound (L2S) Trail
Community Planning Area:Valley & City Center Fund:
Functional Classification:Minor and Principal Arterial, and Other Project:
Project Length:1.6 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 800,000 800,000 - - - - - - - -
R-O-W (includes Admin)110,000 110,000 - - - - - - - -
Construction 2,240,000 - - 2,240,000 2,240,000 - - - - -
Construction Services 560,000 - - 560,000 560,000 - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 3,710,000 910,000 - 2,800,000 2,800,000 - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (KC+CMAQ Grant)3,710,000 910,000 - 2,800,000 2,800,000 - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 3,710,000 910,000 - 2,800,000 2,800,000 - - - - -
3,710,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Lake to Sound (L2S) Trail
If L2S uses BNSF ROW for central section, the alignment would likely be on the south side, lower bank. Downtown Civic Core team prefers alignment with city-owned Houser Way
section along the south side of ROW. Alignment within BNSF would require King County to purchase ROW and new bridges to cross roadways. An alignment on 7th Street can be
developed as a reasonable alternative or parallel route as a trail within railroad ROW is developed (TIP #42).
317
122903
Vangie Garcia 425-430-7319
The Lake to Sound (L2S) Trail is a joint partnership between the cities of Renton, SeaTac, Tukwila, Burien and Des Moines, in coordination with King County. The 17-mile L2S Trail
will provide an east-west connection between the shoreline of Lake Washington (Renton) and the shoreline of Puget Sound (Des Moines). Phase A goes from Naches Ave SW
(Renton) to Fort Dent Park (Tukwila). The length between Naches Ave SW and Mill Ave S are future phases.
Phase A will connect Fort Dent (Tukwila) to the larger system of regional trails in South King County, including the Green River Trail, the Interurban Trail and the Cedar River Trail.
Phase A will provide a 12-foot wide asphalt paved multi-use trail, with 2-foot gravel shoulders. In the Downtown Civic Core Plan, the L2S Trail connects to the Eastside Rail Corridor
(ERC) and the Renton Connector (TIP #22).
This project received a $950,000 CMAQ grant for construction of Phase A (Naches Ave SW to Fort Dent Park inTukwila), in 2014. No City match is required. King County is leading the
design for construction of Phase A, Fort Dent Park Connection. Construction of Phase A is anticipated to be completed in 2019. City staff will be developing scope, cost and schedule
for future phases.
57
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 31
Project Title:Lake Washington Blvd N - Park Ave N to Gene Coulon Memorial Park
Community Planning Area:City Center Fund:
Functional Classification:Collector Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 14,899 14,899 - - - - - - - -
Preliminary Engineering 28,460 28,460 - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,973,821 373,821 - 1,600,000 1,600,000 - - - - -
Construction Services 410,363 10,363 - 400,000 400,000 - - - - -
Post Construction Services 15,934 15,934 - - - - - - - -
Other - - - - - - - - - -
Total Expenses 2,443,477 443,477 - 2,000,000 2,000,000 - - - - -
Resources:
Vehicle Fuel Tax 2,807 2,807 - - - - - - - -
Business & Occupation Share 2,734 2,734 - - - - - - - -
Fund Balance 8,828 8,828 - - - - - - - -
Grants Awarded (1)149,501 149,501 - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 258,353 258,353 - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Dev. Expend)2,000,000 - - 2,000,000 2,000,000 - - - - -
Other (Dev. Reimb)21,253 21,253 - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 2,443,476 443,476 - 2,000,000 2,000,000 - - - - -
2,443,476 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Lake Washington Blvd N - Park Ave N to Gene Coulon Memorial
Park
Last Phase underway. Design for Lake Washington Blvd is complete. Construction to start in the summer of 2018 and be completed by the end of 2019.
317
122121
Bob Hanson 425-430-7319
This project includes road widening, traffic signals, railroad crossings, drainage, curb, gutter, sidewalks and bicycle lanes. Developer to design and construct improvements, and get
credit toward mitigation contribution. The developer is completing the project in 3 phases.
This project will serve the development and access needs to Coulon Park and the Southport Development. Agreement with developer to credit traffic mitigation towards the costs
of certain improvements.
The hotel tower was complete in 2018. The office towers are under construction. This project will be funded by the development of Southport. The costs shown below are for the
estimated mitigation credit, per agreement with the developer.
58
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 32
Project Title:Lind Ave SW - SW 16th St to SW 43rd St
Community Planning Area:Valley Fund:
Functional Classification:Minor Arterial Project:
Project Length:1.69 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 650,000 - - 650,000 - - - 400,000 250,000 -
R-O-W (includes Admin)- - - - - - - - - -
Construction 3,200,000 - - 3,200,000 - - - - 1,200,000 2,000,000
Construction Services 550,000 - - 550,000 - - - - 200,000 350,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000
Total Sources 4,400,000 - - 4,400,000 - - - 400,000 1,650,000 2,350,000
- 4,400,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Lind Ave SW - SW 16th St to SW 43rd St
317
120024
Bob Mahn 425-430-7322
Widen existing roadway to five lanes where required. Includes new roadway, curbs, sidewalks, drainage, signals, lighting, signing and channelization.
Increasing traffic demands in the Valley due in part to development will create the need to increase the capacity of this major north/south arterial. A potential project is a signal
installation at the intersection at Lind Ave SW and SW 34th St (currently unsignalized). Additionally, improvements may result from future WSDOT I-405 plans which include an
interchange at Lind Ave SW (currently unfunded).
The needs, priorities and schedules for improvements on Lind Ave SW will be determined through Arterial Circulation studies.
59
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 33
Project Title:Logan Ave North Improvements
Community Planning Area:City Center Fund:
Functional Classification:Principal Arterial Project:
Project Length:0.76 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 39,760 39,760 - - - - - - - -
Preliminary Engineering 3,245,616 1,005,616 - 2,240,000 - - - - 1,240,000 1,000,000
R-O-W (includes Admin)9,033,266 33,266 - 9,000,000 - - - - - 9,000,000
Construction 5,108,330 4,908,330 200,000 - - - - - - -
Construction Services 1,167,070 1,081,070 86,000 - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 18,594,042 7,068,042 286,000 11,240,000 - - - - 1,240,000 10,000,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 27,065 27,065 - - - - - - - -
Fund Balance 59,090 20,111 38,979 - - - - - - -
Grants Awarded (STP)3,074,943 2,988,943 86,000 - - - - - - -
Grants Awarded (TIB)3,912,242 3,751,221 161,021 - - - - - - -
Mitigation 200,000 200,000 - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Integra Phone)53,702 53,702 - - - - - - - -
Other (Boeing Lot)27,000 27,000 - - - - - - - -
- - - - - - - - - -
Undetermined 11,240,000 - - 11,240,000 - - - - 1,240,000 10,000,000
Total Sources 18,594,042 7,068,042 286,000 11,240,000 - - - - 1,240,000 10,000,000
Logan Ave North Improvements
7,354,042 11,240,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Project has been closed out for Phase 1.
317
122303
Vangie Garcia 425-430-7319
Phase 1 (Cedar River Bridge to N 6th St) is complete. Phase 2 (N 6th St to Park Ave N) will add a NB lane, new curb, gutter, sidewalks (on the east side), landscaped buffer, and a
pedestrian/bicycle trail (west side), streetlights, pedestrian scale illumination, crosswalks, channelization.
The increase in traffic and the new RapidRide transit have warranted widening to add a northbound lane. Included with the improvements are urban roadway amenities to
implement "Complete Streets" practice per City code.
Project is on hold until the Boeing Company is in a position to dedicate property to the project.
60
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 34
Project Title:Maple Valley Highway Barriers
Community Planning Area:Cedar River Fund:
Functional Classification:Principal Arterial Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 522,970 - - 522,970 - - 274,035 248,935 - -
R-O-W (includes Admin)156,300 - - 156,300 - - 25,000 131,300 - -
Construction 1,804,160 - - 1,804,160 - - - 1,804,160 - -
Construction Services 654,470 - - 654,470 - - - 654,470 - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - -
Total Sources 3,137,900 - - 3,137,900 - - 299,035 2,838,865 - -
- 3,137,900
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Maple Valley Highway Barriers
317
Chris Barnes 425-430-7220
This project includes two barriers: One is to install a concrete median barrier between east and westbound travel lanes of the SR 169 S-Curve between the Riviera Apartments and
S. 5th Street including associated roadway widening to add the barrier. The second barrier improvement will remove the existing concrete barrier end treatment located eastbound
(east of the Riviera Apartments) and replace with 2 new concrete barriers extending west.
Maple Valley Highway (SR 169) is a principal arterial carrying 44,000 vehicles per day. This project will improve safety for traffic on Maple Valley Highway (SR 169) at this location,
which has been the site to numerous collision impacts.
The design report for the Cedar River half bridge is complete and was funded by the Roadway Safety and Guardrail Program (TIP # 4). Final design and construction pending funding
availability.
61
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 35
Project Title:Monster Road SW/68th Ave S Roadway Improvements
Community Planning Area:Valley Fund:
Functional Classification:N/A Project:
Project Length:0.92 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 50,000 - - 50,000 - - - - 50,000 -
Preliminary Engineering 5,000,000 - - 5,000,000 - - - - - 5,000,000
R-O-W (includes Admin)3,000,000 - - 3,000,000 - - - - - 3,000,000
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000
Total Sources 8,050,000 - - 8,050,000 - - - - 50,000 8,000,000
- 8,050,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Monster Road SW/68th Ave S Roadway Improvements
317
Vangie Garcia 425-430-7319
Widen existing roadway to four lanes plus two-way-left-turn-lane where needed and bike lanes. Realign Beacon Coal Mine Road approach to intersection with the Monster Road
SW roadway. Includes new roadway, curbs, sidewalk, drainage, street lighting, traffic signals, channelization, retaining walls and widening the existing bridge.
Will serve growing north-south traffic demand. A preliminary design study was completed in 1999. The project cost is estimated at $32M, with the City's share estimated at $13M
and King Co. at $19M.
Phase 1 of improvements will address drainage problems between the Monster Rd Bridge and the City limits. Scope, cost and implementation schedule to be determined. Project is
pending future grant funding availability. Cost beyond 2024 not shown.
62
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 36
Project Title:NE 3rd Street/NE 4th Street Corridor Improvements
Community Planning Area:Highlands & East Plateau Fund:
Functional Classification:Principal Project:
Project Length:2.2 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 258,420 218,420 - 40,000 20,000 20,000 - - - -
Preliminary Engineering 2,276,917 776,917 - 1,500,000 - - 750,000 750,000 - -
R-O-W (includes Admin)684,024 84,024 - 600,000 - - - 600,000 - -
Construction 10,816,803 2,316,803 - 8,500,000 - - - 2,500,000 4,500,000 1,500,000
Construction Services 3,042,921 322,921 - 2,720,000 - - - 340,000 680,000 1,700,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 17,079,085 3,719,085 - 13,360,000 20,000 20,000 750,000 4,190,000 5,180,000 3,200,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 462,831 422,831 - 40,000 20,000 20,000 - - - -
Fund Balance 1,024,433 1,024,433 - - - - - - - -
Grants Awarded (TIB)1,495,542 1,495,542 - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation 373,700 373,700 - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (KC WD#90)352,541 352,541 - - - - - - - -
Other (Franchise Reimb)50,038 50,038 - - - - - - - -
- - - - - - - - - -
Undetermined 13,320,000 - - 13,320,000 - 750,000 4,190,000 5,180,000 3,200,000
Total Sources 17,079,085 3,719,085 - 13,360,000 20,000 20,000 750,000 4,190,000 5,180,000 3,200,000
3,759,085 13,320,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
NE 3rd Street/NE 4th Street Corridor Improvements
The estimated cost for all corridor improvements (Sunset Blvd N to the east City limits) is $46M. Programmed expenses (2021-2024) are placeholders for future phases. Programmed
expenses in 2019-2020 are for developing scope, cost and schedule for next phases. Future phases are pending future grant funding availability.
Increased estimated costs from previous TIP for inflation.
317
122176
Keith Woolley 425-430-7318
This project involves a series of improvements in this corridor to improve traffic operations such as rechannelization and traffic signal modifications, possible transit priority signal
treatments and queue jumps. This project will seek to meet pedestrian, transit and bicycle needs. Phase 1 constructed a new signal and other improvements at NE 4th St and
Whitman Ave NE.
This corridor has a strong potential for transit usage and is experiencing rapid residential and retail growth. The NE 3rd/4th Corridor Study was adopted in May 2005. The study
refined the corridor transportation needs and costs, including pedestrian, transit, bicycle improvements, as well as streetscape enhancement.
63
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 37
Project Title:Nile Ave NE Bridge Replacement
Community Planning Area:East Plateau Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 250,000 - - 250,000 - 50,000 200,000 - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 250,000 - - 250,000 - 50,000 200,000 - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 50,000 - - 50,000 - 50,000 - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 200,000 - - 200,000 - - 200,000 - - -
Total Sources 250,000 - - 250,000 - 50,000 200,000 - - -
50,000 200,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Nile Ave NE Bridge Replacement
317
NEW
Derek Akesson 425-430-7337
The Nile Ave NE Bridge was built by King County in 1951. Ownership was transferred to the City in 2009 as part of the MacKay Annexation (Ord #5456). It is a single span bridge that
crosses over May Creek. The initial phase of this project will evaluate replacement options with a type, size and location (TS&L) study.
The bridge is 17 years beyond its original design life of 50 years. It will very likely need to be replaced or significantly retrofitted within the next 10 years. The main span is
comprised of precast concrete girders. The girders are supported on treated timber piles with a timber caps. Some of the timber piles are showing signs of deterioration.
New project. To date the project has not received grant funding for replacement. However, with a TS&L study, the City will be in a very good position to apply for Federal Highway
Administration (FHWA) funding when the bridge condition qualifies for replacement funding.
64
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 38
Project Title:Rainier Ave N Corridor Improvements (Phase 5)
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:0.76 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 100,000 - - 100,000 - - - - 100,000 -
Preliminary Engineering 2,000,000 - - 2,000,000 - - - - - 2,000,000
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000
Total Sources 2,100,000 - - 2,100,000 - - - - 100,000 2,000,000
- 2,100,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Rainier Ave N Corridor Improvements (Phase 5)
317
Vangie Garcia 425-430-7319
This is Phase 5 of the Rainier Ave Corridor Improvements, and will extend the improvements from NW 3rd Pl to north City limits. Project elements include widening of sidewalks
with streetscaping, adding pedestrian-scale illumination and planted buffer strips. The street may be narrowed from 5 to 3 lanes where feasible. On the east side of Rainier Ave the
new multi-use trail will be installed (Lake Washington Loop Trail), (as shown on TIP #18).
Rainier Ave is a critical corridor in Renton with existing operational problems and in need of infrastructure enhancements to provide greater ease for non-motorized and transit-
based travel.
Funds shown in 2023 are for planning to determine the roadway cross section. Project cost estimated at $31.5M and is unfunded. Costs beyond 2024 not shown.
65
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 39
Project Title:Renton Bus Rapid Transit (BRT) Improvements
Community Planning Area:City Center Fund:
Functional Classification:TBD Project:
Project Length:TBD Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500
Total Expenses 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded(2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500
Total Sources 21,300,000 - - 21,300,000 - - - 3,195,000 9,052,500 9,052,500
Renton Bus Rapid Transit (BRT) Improvements
- 21,300,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
317
NEW
Vangie Garcia 425-430-7319
New transit access road improvements from I-405 exit 3 (Talbot Rd) to South Renton Transit Center. Includes reconfiguration of Grady Way, Lake Ave S and S Renton Village Place to
accommodate transit.
With current traffic conditions and configurations, improvements will be needed to ensure speed and reliability of the BRT system into and out of the South Renton Transit Center.
This transit hub is currently and will remain a key connection point for transit users for both Metro and Sound Transit. Proximity to the Sounder Station and future increase of
parking availability also plays a key role in improvement accessibility needs.
New Project. Estimated cost in Regional Transportation Plan is $21,300,000. Design and Construction should be implemented and coordinated with South Renton Transit Center,
development of Renton Village, and implementation of I-405 Bus Rapid Transit.
66
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 40
Project Title:Transit Master Plan
Community Planning Area:Citywide Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 500,000 - - 500,000 - - 300,000 200,000 - -
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction - - - - - - - - - -
Construction Services - - - - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 500,000 - - 500,000 - - 300,000 200,000 - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 500,000 - - 500,000 - - 300,000 200,000 - -
Total Sources 500,000 - - 500,000 - - 300,000 200,000 - -
- 500,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Transit Master Plan
317
NEW
Vangie Garcia 425-430-7319
The Transit Master Plan provides the city with a means to influence decisions made by regional transit authorities. It also provides a basis on which to begin advancing proposed
capital projects for further study, design and prioritization, and position them to be strong competitors for grant funding. The plan establishes scalable short- and long-term
strategies, and identifies projects that will foster a high-quality transit system to meet Renton’s needs.
Although the City does not operate its own transit service, the role of transit in Renton is evolving and becoming more of a priority in the region. The current regional vision allows
cities and other urban service providers prioritized maximizing the use of existing infrastructure, making more efficient and less costly investments in new infrastructure, and
minimizing the environmental impact of urban growth. This prioritization made transportation a key role in the region by creating improved accessibility and mobility for walking,
biking, and transit. Regional growth centers are envisioned as major focal points of higher density population and employment, served with efficient multimodal transportation
infrastructure and services. Linking these centers with a highly efficient transportation system allows the region to take actions to reduce the rate of growth in vehicle miles
traveled, especially by providing and expanding transportation choices.
New project.
67
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 41
Project Title:South 3rd Street Conversion Project
Community Planning Area:City Center Fund:
Functional Classification:Principal Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 4,000,000 - - 4,000,000 - - 4,000,000 - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 13,200,000 - - 13,200,000 - - - 5,000,000 8,200,000 -
Construction Services 4,000,000 - - 4,000,000 - - - 1,500,000 2,500,000 -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded(2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 -
Total Sources 21,200,000 - - 21,200,000 - - 4,000,000 6,500,000 10,700,000 -
South 3rd Street Conversion Project
- 21,200,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
317
Vangie Garcia 425-430-7319
The project provides pedestrian and bicyclists facilities and enhancements, traffic operation and circulation improvements in Downtown. The improvements include adding raised
intersections with bulb outs, parklets, pedestrian plaza, lighting, street furniture, streetscape, bicycle blvd, bike racks, signage, wayfinding and converting S 3rd St to two-way
operations.
This project is one of the strategies identified in the City Center Community Plan. The project enhances downtown Renton as a destination area, while improving circulation,
reducing traffic speeds and enhancing pedestrian safety. A feasibility study, including a Downtown Circulation Traffic Analysis for the conversion to two-way operations was
completed.
This is the last project of the Downtown Conversion to a two-way operations. It will continue the downtown improvements, further enhancing the pedestrian and bicyclists
environment. Project is pending future grant funding availability.
68
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 42
Project Title:S/SW 7th Street Corridor Improvements - Naches Ave S to Talbot Road S
Community Planning Area:City Center Fund:
Functional Classification:Minor Arterial Project:
Project Length:1.16 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning 32,270 32,270 - - - - - - - -
Preliminary Engineering 2,311,842 311,842 - 2,000,000 - - 200,000 800,000 1,000,000 -
R-O-W (includes Admin)1,725,124 25,124 - 1,700,000 - - - 800,000 900,000
Construction 11,362,668 975,141 14,599 10,372,928 - - - - 7,264,000 3,108,928
Construction Services 1,999,882 299,882 - 1,700,000 - - - - 1,200,000 500,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 17,431,786 1,644,259 14,599 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share 52,115 52,115 - - - - - - - -
Fund Balance + Reserve 72,164 60,401 11,763 - - - - - - -
Grants Awarded (STP)497,241 494,405 2,836 - - - - - - -
Grants Awarded (TIB)613,338 613,338 - - - - - - - -
Mitigation 424,000 424,000 - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 15,772,928 - - 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928
Total Sources 17,431,786 1,644,259 14,599 15,772,928 - - 200,000 1,600,000 10,364,000 3,608,928
1,658,858 15,772,928
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
S/SW 7th Street Corridor Improvements - Naches Ave S to
Talbot Road S
Added costs for the SW 7th St Sidepath. It is assumed that no ROW would be required.
317
122151
Vangie Garcia 425-430-7319
Widening the existing S 7th St from Talbot Road S to Rainier Ave S roadway to 3 lanes (2 lanes EB and 1 lane WB) and a separated multi-use trail. Includes new curb, gutter, wider
sidewalks, street lighting, landscaping, channelization and upgrades to traffic signals. The S 7th St Project - Traffic Analysis Report provided alternatives for corridor improvement
options. This project also includes a sidepath on SW 7th St between Rainier Ave S and Naches Ave S.
The segment of the S 7th St corridor connects Talbot Rd S (SR 515) with Rainier Ave S (SR 167). The segment of S 7th St is part of a designated east-west ped/bike route through
the City's commercial core and an important link between regional trails. The South Renton Neighborhood Study has identified South 7th St as needing streetscape
improvements. The Trails and Bicycle Master Plan Update identified SW 7th St/S 7th St as a good alternate/parallel route as the L2S Trail (TIP #30) is developed. With the
expansion of the South Renton Transit Center and Bus Rapid Transit (BRT) implementation, S 7th St is important non-motorized link to downtown core.
Costs incurred are for Phase 1, which added a traffic signal and an eastbound right-turn lane at the intersection of S 7th St and Shattuck Ave S. Project is pending future grant
funding availability.
69
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 43
Project Title:South Grady Way - Talbot Rd South to Rainier Ave South
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 750,000 - - 750,000 - - 550,000 200,000 - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 2,500,000 - - 2,500,000 - - - 1,200,000 1,300,000 -
Construction Services 750,000 - - 750,000 - - - 360,000 390,000 -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 -
Total Sources 4,000,000 - - 4,000,000 - - 550,000 1,760,000 1,690,000 -
- 4,000,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
South Grady Way - Talbot Rd South to Rainier Ave South
317
Vangie Garcia 425-430-7319
This project will perform a comprehensive analysis of multi-modal transportation improvements, including review of potential transit improvements along Grady Way, such as
Business Access and Transit (BAT) lanes and Traffic Signal Priority (TSP).
The project will remove the islands at the intersections of S Grady Way with Lake Ave S and Shattuck Ave S, to allow for a continuous eastbound lane from Rainier Ave S to Talbot
Rd S. Included are modifications to the traffic signal, new pedestrian crossings and channelization. The improvements will add much needed capacity to the S Grady Way corridor.
Project is pending future grant funding availability.
70
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 44
Project Title:South Lake Washington Transit Stop
Community Planning Area:City Center Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 600,000 - - 600,000 - - 600,000 - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 3,000,000 - - 3,000,000 - - 3,000,000 - - -
Construction Services 750,000 - - 750,000 - - 750,000 - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 4,350,000 - - 4,350,000 - - 4,350,000 - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (1)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 4,350,000 - - 4,350,000 - - 4,350,000 - - -
Total Sources 4,350,000 - - 4,350,000 - - 4,350,000 - - -
- 4,350,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
South Lake Washington Transit Stop
317
Vangie Garcia 425-430-7319
This project will implement a Bus Transit Station at Park Ave. N and Garden Ave N. The project includes a new transit stop, with passenger amenities such as shelters, lighting,
benches, litter receptacles, bicycle racks and lockers.
The project is proposed to meet recent travel demand growth in the area and as a part of the connectivity of the regional transit system. This transit hub will provide service to a
17.5 acre mixed use site consisting of 730,000 sq.ft. of office space, 43,000 sq.ft. of meeting space, 30,000 sq.ft. of retail, 383 apartment units and a 347 unit hotel. Other new
development in the area includes two hotels. In addition, a large manufacturing company's employees will benefit from the transit hub's location as well as visitors to The Landing
and the 57 acre Gene Coulon Park.
The preliminary planning for this transit project will be incorporated into the N Park Ave Extension Project (TIP #20).
71
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 45
Project Title:Sunset Area Green Connections
Community Planning Area:Highlands Fund:
Functional Classification:N/A Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 2,600,000 - - 2,600,000 - - - 2,600,000 - -
R-O-W (includes Admin)1,000,000 - - 1,000,000 - - - 1,000,000 - -
Construction 16,000,000 - - 16,000,000 - - - - 9,200,000 6,800,000
Construction Services 2,600,000 - - 2,600,000 - - - - 1,500,000 1,100,000
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (CED)- - - - - - - - - -
Other (2)- - - - - - - - - -
- - - - - - - - - -
Undetermined 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000
Total Sources 22,200,000 - - 22,200,000 - - - 3,600,000 10,700,000 7,900,000
- 22,200,000
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
Sunset Area Green Connections
317
Vangie Garcia 425-430-7319
This project will construct multi-modal improvements identified in the Sunset Area Community Planned Action Study. Roadways will be widened/extended/realigned to provide for
future traffic flows. Several residential streets will be developed as "green connections" improving pedestrian mobility and enhance the neighborhood. Roadways included are NE
10th St, NE Sunset Lane, Harrington Ave NE, NE 12th St, Edmonds Ave NE, Jefferson Ave NE, Kirkland Ave NE and Glennwood Ave NE.
Improvements to these streets are key to support the redevelopment of the Sunset Area Community in the Highlands area, bounded by NE 21st St on the north, Edmonds Ave NE
on the west, NE 7th St on the south, and Monroe Ave NE on the east. The City in partnership with the Renton Housing Authority aspires to redevelop the Sunset Terrace public
housing community and encourage private delopment in the Planned Action Study area over a 20-year period.
The total cost of the project is estimated at $22.2M. Schedule, cost and selection of streets to be improved to be determined. Significant cost participation will be required from
development. Surface Water is leading this project and has completed two projects along Harrington Ave NE.
72
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 46
Project Title:SW 27th Street/Strander Boulevard Connection
Community Planning Area:Valley Fund:
Functional Classification:Minor Arterial Project:
Project Length:1.27 mi Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering 5,030,912 5,030,912 - - - - - - - -
R-O-W (includes Admin)3,842,563 3,842,563 - - - - - - - -
Construction 16,798,111 16,748,111 50,000 - - - - - - -
Construction Services 2,435,829 2,435,829 - - - - - - - -
Post Construction Services 3,009,442 3,009,442 - - - - - - - -
Other - - - - - - - - - -
Total Expenses 31,116,857 31,066,857 50,000 - - - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Interfund Loan 700,000 700,000 - - - - - - - -
Gen & Prop Fund Balances 2,638,698 2,588,698 50,000 - - - - - - -
Grants Awarded (State & Fed 2,408,422 2,408,422 - - - - - - - -
Grants Awarded (FMSIB)7,697,425 7,697,425 - - - - - - - -
Mitigation 1,413,835 1,413,835 - - - - - - - -
Bonds / LID's Formed 2,799,500 2,799,500 - - - - - - - -
Other (Sound Transit & FRB)4,687,421 4,687,421 - - - - - - - -
Other (STP & TIB)7,346,536 7,346,536 - - - - - - - -
City of Tukwila Reimburse 1,000,000 1,000,000 - - - - - - - -
- - - - - - - - - -
PW Utilities (Water/Surf Wat)425,020 425,020 - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 31,116,857 31,066,857 50,000 - - - - - - -
SW 27th Street/Strander Boulevard Connection
29,691,837 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
The City of Tukwila has taken the lead for future phases.
317
122239, 122240
Keith Woolley 425-430-7318
The project will provide a grade-separated crossing at the Union Pacific Railroad (UPRR) and Burlington Northern Santa Fe (BNSF) railroad tracks. Bicycle and pedestrian
connections will be provided to the Tukwila Station and the Interurban Trail. Phase 1 - Seg 2a - 2 lane roadway from Naches Ave SW to the Sounder Station, including a BNSF
bridge is completed.
This project provides a critical four/five-lane arterial that will serve as a connector to West Valley Highway (SR 181) and East Valley Road, as well as an arterial connector to SR 167
from the south. A new east-west arterial roadway will connect the cities of Renton and Tukwila and provide significant congestion relief to existing arterials. The new road will
provide access to the Tukwila Train/Sound Transit Station. The new grade separated arterial (UPRR and BNSF railroads) will provide significant benefits to both freight mobility
and general motorists.
73
AGENDA ITEM # 10. a)
TRANSPORTATION IMPROVEMENT PROGRAM
2019 - 2024
TIP No. 47
Project Title:Talbot Road S / S 177th Street Signalization & Roadway Improvements
Community Planning Area:Talbot Fund:
Functional Classification:Major Collector Project:
Project Length:N/A Contact:
Project Description:
Justification:
Status:
Changes:
Funded:Unfunded:
Pre-2018 2018 Total 2019 2020 2021 2022 2023 2024
Expenditures:
Planning - - - - - - - - - -
Preliminary Engineering - - - - - - - - - -
R-O-W (includes Admin)- - - - - - - - - -
Construction 1,000,000 - 1,000,000 - - - - - - -
Construction Services 25,000 - 25,000 - - - - - - -
Post Construction Services - - - - - - - - - -
Other - - - - - - - - - -
Total Expenses 1,025,000 - 1,025,000 - - - - - - -
Resources:
Vehicle Fuel Tax - - - - - - - - - -
Business & Occupation Share - - - - - - - - - -
Fund Balance - - - - - - - - - -
Grants Awarded (1)- - - - - - - - - -
Grants Awarded (2)- - - - - - - - - -
Mitigation - - - - - - - - - -
Bonds / LID's Formed - - - - - - - - - -
Other (Dev. Expenditure)1,025,000 - 1,025,000 - - - - - - -
Other (Dev. Reimb)- - - - - - - - - -
- - - - - - - - - -
Undetermined - - - - - - - - - -
Total Sources 1,025,000 - 1,025,000 - - - - - - -
Talbot Road S / S 177th Street Signalization & Roadway
Improvements
1,025,000 -
Project Expenditures & Resources Programmed Programmed Pre-2019 Six-Year Program
317
Vangie Garcia 425-430-7319
This project involves installing a traffic signal and various roadway improvements including meeting pedestrian transit and bicycle needs.
This project is proposed to meet recent traffic demand through this intersection and surrounding area as a result of the expansion of Valley Medical Center.
The project is currently in design and will be starting construction in 2018 once they receive an approved permit.
74
AGENDA ITEM # 10. a)
Section F
Appendix
2019 – 2024 Transportation Improvement Program
75
AGENDA ITEM # 10. a)
City of Renton | 2019 - 2024 TRANSPORTATION IMPROVEMENT PROGRAM
25
Abbreviations and Acronyms
The following list defines the abbreviated words and/or acronyms used in the City of Renton’s Six -Year
Transportatfon Improvement Program.
ACP Asphalt Concrete Pavement
ADA American Disability Act
BAT Business Access Transit
BNSF Burlington Northern Santa Fe
BRAC Bridge Replacement Advisory Committee
CBD Central Business District
CIP Capital Improvement Program
CMAQ Congestfon Mitfgatfon and Air Quality
CTR Commute Trip Reductfon (State Act)
DOE Department of Ecology
EB Eastbound
ECL East City Limits
EIS Environmental Impact Study
ER Emergency Relief
FHWA Federal Highway Administratfon
FMSIB Freight Mobility Strategic Investment Board
GIS Geographic Informatfon System
GMA Growth Management Act
HOV High Occupancy Vehicles
ITS Intelligent Transportatfon System
LF Linear Feet
LID Local Improvement District
LOS Level of Service
MAP-21 Moving Ahead for Progress in the 21st Century Act
METRO Municipality of Metropolitan Seattle
MOU Memorandum of Understanding
MUTCD Manual on Uniform Traffic Control Devices
NCL North City Limits
NB Northbound
PMS Pavement Management System
Precon Preconstructfon Engineering/Administratfon (design phase of project)
PS&E Plans, Specificatfons, and Estfmates
ROW Right-of-way
RTA Regional Transit Authority
SB Southbound
SCATBd South County Area Transportatfon Board
SCL South City Limits
SOV Single Occupant Vehicle
ST Sound Transit
STP Surface Transportatfon Program
TDM Transportatfon Demand Management Program
TIB Transportatfon Improvement Board
TIP Transportatfon Improvement Plan
UPRR Union Pacific Railroad
UPS Uninterruptfble Power Supple
WB Westbound
WCL West City Limits
WSBIS Washington State Bridge Inventory System
WSDOT Washington State Department of Transportatfon
76
AGENDA ITEM # 10. a)
1
CITY OF RENTON, WASHINGTON
RESOLUTION NO. ______
A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING
THE TEMPORARY TOTAL CLOSURE OF THE INTERSECTION OF EAST
VALLEY ROAD AND SW 19TH STREET, BETWEEN 1701 EAST VALLEY ROAD
AND 2501 EAST VALLEY ROAD TO THE NORTH AND SOUTH, AND 200 SW
19TH STREET AND 204 SW 19TH STREET TO THE EAST AND WEST.
WHEREAS, the Washington State Department of Transportation (“WSDOT”) plans
to install a culvert that conveys Rolling Hills Creek under East Valley Road, at the
approximate address of 1801 East Valley Road; and
WHEREAS, this construction activity will require temporary street closure along
East Valley Road, between 1701 East Valley Road to 2501 East Valley Road, as well as SW
19th Street between 200 SW 19th Street and 204 SW 19th Street; and
WHEREAS, pursuant to City Code section 9‐9‐3 the City Council is to authorize such
closures by means of a resolution;
WHEREAS, the City wishes to provide full and adequate notice to the public of the
extent and nature of such closure;
NOW, THEREFORE, THE CITY OF RENTON, WASHINGTON, DO RESOLVE AS
FOLLOWS:
SECTION I. The City Council does hereby authorize the temporary total closure
of the intersection of East Valley Road and SW 19th Street, between 1701 East Valley Road
and 2501 East Valley Road to the north and south, and 200 SW 19th Street and 204 SW 19th
AGENDA ITEM # 10. b)
RESOLUTION NO. ________
2
Street to the east and west, for up to four calendar days, anytime during the period of
August 24, 2018 to August 27, 2018, to allow WSDOT to install the culvert.
PASSED BY THE CITY COUNCIL this _______ day of _________________, 2018.
__________________________________
Jason A. Seth, City Clerk
APPROVED BY THE MAYOR this _______ day of _________________, 2018.
__________________________________
Denis Law, Mayor
Approved as to form:
__________________________________
Shane Moloney, City Attorney
Date of Publication: ____________
RES:1780:7/26/18:scr
AGENDA ITEM # 10. b)
1
CITY OF RENTON, WASHINGTON
RESOLUTION NO. ______
A RESOLUTION OF THE CITY OF RENTON, WASHINGTON, AUTHORIZING
THE TEMPORARY TOTAL CLOSURE OF SW 19TH STREET BETWEEN 100 SW
19TH STREET AND 204 SW 19TH STREET.
WHEREAS, the Washington State Department of Transportation (“WSDOT”) plans
to install a new 120” saddle manhole that connects Rolling Hills Creek to the existing
conveyance system; and
WHEREAS, this construction activity will require temporary total street closure
along SW 19th Street, between 100 SW 19th Street and 204 SW 19th Street; and
WHEREAS, pursuant to City Code section 9‐9‐3 the City Council is to authorize such
closures by means of a resolution;
WHEREAS, the City wishes to provide full and adequate notice to the public of the
extent and nature of such closure;
NOW, THEREFORE, THE CITY OF RENTON, WASHINGTON, DO RESOLVE AS
FOLLOWS:
SECTION I. The City Council does hereby authorize the temporary total closure
of SW 19th Street, between 100 SW 19th Street and 204 SW 19th Street, for up to 10
AGENDA ITEM # 10. c)
RESOLUTION NO. ________
2
calendar days, anytime during the periods of September 4, 2018 to September 30, 2018, to
allow WSDOT to install a new 120” saddle manhole.
PASSED BY THE CITY COUNCIL this _______ day of _________________, 2018.
__________________________________
Jason A. Seth, City Clerk
APPROVED BY THE MAYOR this _______ day of _________________, 2018.
__________________________________
Denis Law, Mayor
Approved as to form:
__________________________________
Shane Moloney, City Attorney
Date of Publication: ____________
RES:1781:8/3/18:scr
AGENDA ITEM # 10. c)
1
CITY OF RENTON, WASHINGTON
ORDINANCE NO. ________
AN ORDINANCE OF THE CITY OF RENTON, WASHINGTON, REPEALING AND
REPLACING CHAPTER 6‐3 OF THE RENTON MUNICIPAL CODE, AMENDING ALARM
SYSTEM REGULATIONS, AND PROVIDING FOR SEVERABILITY AND ESTABLISHING
AN EFFECTIVE DATE.
WHEREAS, excessive false alarms unduly burden the City of Renton Police Department’s
limited law enforcement resources; and
WHEREAS, the purpose of this ordinance is to establish reasonable expectations of alarm
users, and alarm companies, and to ensure that alarm users are held responsible for their use of
alarm systems; and
WHEREAS, the Council deems it necessary to replace the current RMC Chapter 6‐3
(Burglar Alarms) relating to false alarm regulations; and
WHEREAS, the Council has determined that it would be beneficial to delegate the
enforcement responsibilities for excessive false alarms;
NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF RENTON, WASHINGTON, DO
ORDAIN AS FOLLOWS:
SECTION I. Chapter 6‐3 of the Renton Municipal Code is repealed in its entirety and
replaced with the following language:
CHAPTER 3
ALARM SYSTEM REGULATIONS
SECTION:
6‐3‐1: Purpose
6‐3‐2: Definitions
6‐3‐3: Authority; Funds
6‐3‐4: Alarm Permit Required
6‐3‐5: Duties Of An Alarm User
6‐3‐6: Duties Of An Alarm Company
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
2
6‐3‐7: Violations
6‐3‐8: Suspension Of Response
6‐3‐9: Reinstatement Of Response
6‐3‐10: Appeals Process
6‐3‐1 PURPOSE:
It is the intent of this chapter to reduce the number of false alarms occurring
within the City and to minimize the resulting waste of City resources by providing
for corrective administrative action to hold alarm users and alarm companies
responsible for proper use of alarm systems.
6‐3‐2 DEFINITIONS:
The following words, terms and phrases, when used in this chapter, shall have the
meanings ascribed to them, except where the context clearly indicates a different
meaning:
A. Alarm Administrator: Person or persons designated by the City to
administer the provisions of this chapter.
B. Alarm Company: Person or company, firm, and/or a company engaged in
the selling, leasing, installing, servicing or monitoring alarm systems.
C. Alarm Dispatch Request: A notification to a law enforcement agency that
an alarm, either manual or automatic, has been activated at a particular alarm
site, which results in a request for law enforcement action.
D. Alarm Permit: A permit issued to an alarm user allowing the operation of
an alarm system within the City.
E. Alarm Signal: A detectable signal, audible or visual, generated by an alarm
system, which is intended to elicit a response from the City.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
3
F. Alarm System: Any single device or assembly of equipment designed to
signal the occurrence of an illegal or unauthorized entry, or other illegal activity
requiring immediate attention, and to which law enforcement is requested to
respond by an alarm company, but does not include motor vehicle or boat alarms,
fire alarms, or alarms designated to elicit a medical response.
G. Alarm User: Any person, corporation, partnership, proprietorship,
government, or educational entity or any other entity owning, leasing, or
operating an alarm system, or on whose premises an alarm system is maintained
for the protection of such premises.
H. Alarm User Awareness Class: A class conducted for the purpose of
educating alarm users about the responsible use, operation, and maintenance of
alarm systems and the problems created by false alarms.
I. Automatic Dial Protection Device: An automatic dialing device or an
automatic telephone dialing alarm system that includes any system which, upon
being activated, automatically initiates to the Renton Police Department a
recorded message or code signal indicating a need for law enforcement response.
J. Cancellation: The process by which an alarm dispatch request response is
terminated when the alarm company (designated by the alarm user) notifies the
Renton Police Department that there is not an existing situation at the alarm site
requiring police response. If cancellation occurs prior to police arriving at the
scene, no fine will be assessed.
K. City: The City of Renton, Washington, or its designee.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
4
L. False Alarm:
1. A false alarm includes the following:
a. The activation of an alarm system through mechanical or electronic
failure; malfunction; improper installation; negligence of alarm user, his/her
employees or agents that either directly or through a third party/object summons
law enforcement personnel; and
b. Upon inspection by the Renton Police Department, evidence
indicates that no unauthorized entry, burglary, or other such crime was
committed or attempted in or on the premises which would have activated a
properly functioning alarm system.
2. A false alarm shall not include:
a. An alarm which can reasonably be determined to have been caused
by conditions of nature;
b. Other extraordinary circumstances not reasonably subject to
control by the alarm user;
c. An alarm in which an alarm dispatch request response from the City
is cancelled by the user’s alarm company before the City arrives at the alarm
location; or
d. Intentional activation of the alarm system because of the
reasonable, but mistaken, belief that a crime is being or about to be committed.
M. Permit Year: A twelve (12)‐month period beginning on January 1st of each
year which the alarm permit is issued.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
5
N. Runaway Alarm: An alarm system that produces repeated alarm signals
that do not appear to be caused by separate human action or that produces three
(3) separate false alarm signals within a twenty‐four (24) hour period.
O. Verify: An attempt by the monitoring company, through telephone
verification, or its representative, to determine whether an alarm signal is valid
before requesting law enforcement dispatch, in an attempt to avoid an
unnecessary alarm dispatch request. Telephone verification means, at a
minimum, that a second call be made to a different number if the first attempt
fails to reach an alarm user who can properly identity themselves to determine
whether an alarm signal is valid before requesting law enforcement dispatch.
P. Violator: Any alarm user that violates any provisions under this chapter
including but not limited to any alarm user upon whose property a false alarm
occurs.
6‐3‐3 AUTHORITY; FUNDS:
A. Responsibility for administration of this chapter is vested with the Chief of
Police.
B. The Chief of Police shall designate an alarm administrator to carry out the
administrative duties and functions described in this chapter.
C. The Chief of Police has the authority to review and recommend to the City
Council false alarm fees set forth in the City of Renton Fee Schedule.
D. The Chief of Police has the authority to delegate the City’s rights and
responsibilities delineated by this chapter to a third party.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
6
6‐3‐4 ALARM PERMIT REQUIRED:
No person shall own, lease or operate an alarm system without first obtaining a
permit for such alarm system from the City. A separate alarm permit is required
for each alarm site. A fee is required for the initial alarm registration. No fee will
be charged for annual renewals. Each alarm permit shall be assigned a unique
permit number, and the alarm user or alarm company may be required to provide
the permit number to facilitate law enforcement dispatch and enforcement of this
chapter. Each alarm permit shall expire on December 31 of the year issued and
must be renewed annually by submitting an updated application to the City. A
late fee will be assessed if the renewal is more than thirty (30) days late. An alarm
permit cannot be transferred to another person or alarm site.
A. Application: Each alarm user has a duty to obtain an application from the
City and apply for each permit on a form provided by the City.
B. Transfer of Possession: When the occupancy or possession of the
premises at which an alarm system is maintained is transferred, the alarm user
obtaining possession of the property shall file an application for an alarm permit
within thirty (30) days of obtaining possession of the property. Alarm permits are
not transferable.
C. Reporting Updated Information: Whenever any information provided on
the alarm permit application changes, the alarm user shall provide correct
information to the City within thirty (30) days of the change.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
7
D. Multiple Alarm Systems: If an alarm user has one (1) or more alarm
systems protecting two (2) or more separate structures having different addresses
and/or tenants, a separate permit shall be required for each structure and/or
tenant.
E. Failure to Register, Renew, or Update Information: Failure to initially
obtain or renew a permit under this chapter or report any updated information
within thirty (30) days of change shall result in a fine as set forth in the City of
Renton Fee Schedule.
F. Unpermitted Alarm Signal: If an alarm signal is originated from the
property of an alarm user who does not possess a current permit and such signal
results in an alarm dispatch request, the alarm user shall pay a fine for failure to
register as described in RMC 6‐3‐4.E, in addition to any other applicable fines and
fees.
6‐3‐5 DUTIES OF AN ALARM USER:
A. Comply with all applicable provisions of this chapter;
B. Maintain the premises and the alarm system in a manner that will reduce
or eliminate false alarms;
C. Provide the permit number to the alarm company to facilitate dispatch;
D. Refrain from manually activating an alarm for any reason other than the
occurrence of an event that the alarm system was intended to report. An alarm
user must not manually initiate a False Alarm;
E. Obtain an alarm permit for each alarm system;
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
8
F. Renew permit(s) annually;
G. Update the City with any changes to information contained on an alarm
permit application within thirty (30) days of the change.
H. Failure of alarm user to comply with the duties of this chapter may result
in a fine as set forth in the City of Renton Fee Schedule.
6‐3‐6 DUTIES OF AN ALARM COMPANY:
A. Any person engaged in the alarm business in the City shall comply with the
following:
1. Obtain and maintain the required state, county and/or city license(s).
2. Provide the City most current name, address, and telephone number
and other available information of the alarm user or a designee, who can be called
in an emergency, twenty‐four (24) hours a day, and contact a key holder or other
emergency contact who will be requested to respond immediately if necessary.
B. Ninety (90) days after enactment of this chapter, each alarm company
shall, on all new and upgraded installations, use only alarm control panels which
meet current industry standards.
C. Prior to activation of the alarm system, the alarm company must provide
to each alarm user:
1. Instructions explaining the proper operation of the alarm system; and
2. Written information of how to obtain service from the alarm company
for the alarm system.
D. Any alarm company doing business within the City of Renton shall:
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
9
1. Attempt to verify, by calling the alarm site and/or alarm user by
telephone, to determine whether an alarm signal is valid before requesting
dispatch. Telephone verification shall require, at a minimum, that a second call be
made to a different number, if the first attempt fails to reach an alarm user who
can properly identify themselves to attempt to determine whether an alarm signal
is valid, except in the case of a panic, silent, duress or burglary and/or robbery‐in‐
progress alarm, or in cases where a crime‐in‐progress has been verified by video
and/or audible means.
2. Provide each address and alarm permit number to the communications
center to facilitate dispatch and/or cancellations.
3. Communicate any available information about the location of the
alarm.
4. Communicate a cancellation to the law enforcement communications
center as soon as possible following a determination that a response is
unnecessary.
E. Failure of an alarm company to comply with the duties under this chapter
may result in a fine as set forth in the City of Renton Fee Schedule.
6‐3‐7 VIOLATIONS:
A. It shall be a violation of this chapter:
1. For a false alarm to occur on an alarm user’s property;
2. To install, maintain, or use an audible alarm system which sounds
continually for more than fifteen (15) minutes;
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
10
3. To install, maintain, or use an automatic dial protection device that
reports, or causes to be reported, any recorded message to the Renton Police
Department;
4. To fail to obtain a permit for an alarm system;
5. To fail to provide updated information to the City as described in this
chapter; or
6. To fail to comply with any other requirement of this chapter.
B. The alarm user will be responsible for violations under this chapter
whether or not the alarm user individually caused the violation to occur.
C. It shall be a violation of this chapter for an alarm company to violate any
requirements of this chapter.
D. Any violation of this chapter shall result in a fine, as determined by the City
of Renton Fee Schedule.
6‐3‐8 SUSPENSION OF RESPONSE:
A. The City may discontinue response of City emergency services if the City
determines that:
1. There is a false statement or omission of material fact made to the City
or contained in a permit application.
2. An alarm system meets the definition of a runaway alarm.
3. An alarm system has generated in excess of eight (8) false alarms
during any calendar year.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
11
4. The alarm user has failed to make payment of any fine or fee assessed
under this chapter within ninety (90) days of the assessment.
5. An alarm user commits any other violation of this chapter.
6‐3‐9 REINSTATEMENT OF RESPONSE:
A. The City may resume City emergency services response upon the alarm
user submitting satisfactory proof of compliance of one (1) or more of the
following:
1. Proof that the alarm system has been inspected and the measures
taken to ensure the alarm system is in good working order. Measures taken may
require the alarm user to repair, upgrade or modify the alarm system to be
compliant with this chapter.
2. Proof the alarm user has been retrained on the use of the alarm system
and procedures for contacting the alarm company in the case of false activation.
3. The alarm user successfully completes an online alarm user awareness
class and test.
4. All fees and fines are paid in full including a reinstatement fee as set
forth in the City of Renton Fee Schedule.
6‐3‐10 APPEALS PROCESS:
A. If the City assesses a fine, suspends, denies the issuance, renewal or
reinstatement of the alarm permit, the City or its designee shall send written
notice of the action and a statement of the right to an appeal to the aggrieved
party.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
12
B. Any party fined in accordance with this chapter may appeal an assessment
of a fine, a suspension of an alarm permit, or other enforcement action to the City
by mailing the appeal to the address as shown on the notice within fifteen (15)
days after receipt of the notice. The appeal must set forth in writing the reasons
for the appeal and any evidence that should be considered. The failure to give
notice of appeal within fifteen (15) days shall constitute a waiver of the right to
contest the violation(s) or enforcement action(s).
C. If a hearing is requested, written notice of the time, place, and manner of
the hearing shall be mailed to the address of the alarm user as contained in the
alarm permit, at least fifteen (15) days prior to the date of the hearing, which shall
be held no more than thirty (30) days after the request for hearing is filed.
D. The appeal shall be administered by the Chief of Police or his/her designee
(Hearing Officer). The alarm user and a representative of the Police Department
shall have the right to present written and/or oral evidence. If the Hearing Officer
determines, after the presentation of evidence, that any violations have occurred,
the Hearing Officer shall issue written findings and record the findings in the alarm
user’s record within thirty (30) days, and the fines shall be paid, including an
additional appeal fee. If the Hearing Officer determines that no violation has been
committed, the appeal fee and associated fine, if already paid, shall be refunded
within thirty (30) days, and no finding of violation may be entered on the alarm
user’s record.
AGENDA ITEM # 10. a)
ORDINANCE NO. ________
13
E. The appeal decision made by the Hearing Officer may be appealed to the
King County Superior Court within thirty (30) calendar days from the date the
decision is issued.
SECTION II. If any section, subsection, sentence, clause, phrase or work of this
ordinance should be held to be invalid or unconstitutional by a court or competent jurisdiction,
such invalidity or unconstitutionality thereof shall not affect the constitutionality of any other
section, subsection, sentence, clause, phrase or word of this ordinance.
SECTION III. This ordinance shall be in full force and effect thirty (30) days after
publication of a summary of this ordinance in the City’s official newspaper. The summary shall
consist of this ordinance’s title.
PASSED BY THE CITY COUNCIL this _______ day of ___________________, 2018.
Jason A. Seth, City Clerk
APPROVED BY THE MAYOR this _______ day of _____________________, 2018.
Denis Law, Mayor
Approved as to form:
Shane Moloney, City Attorney
Date of Publication:
ORD:2006:6/20/18:scr
AGENDA ITEM # 10. a)