Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
LUA92-119
--ord-o:f. �'<i':tt,'tj ,?�h MCst��:,Y% �hgo i=cwFo '= q +._,," ' ywil= 'i" e,e- xT,r CERTIFICATE OF - -'"' WETLAND EXEMPTION ►�•��� � limam''' 4,2,111414 , /' 4 r f City of Renton File Number: LUA 02-119, ECF - Detention Pond & Stormwater System tl Improvements. 3. r ' Location: Detention Pond at 4520 NE 10th Street 3 ` Proponent: City of Renton—Surface Water Utility. Legal Description/King County Assessor's Property Identification Number: Please see attached legal/#102305 9434 14 F Background: Section 4-3-110G of the Renton Municipal Code lists the activities that are exempt from compliance with the City of Renton's wetland regulations. This section also statesII F that exempt activities "require that a certificate of exemption be obtained from the Department IP Administrator". - 1. Description of proposal and wetlands: The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th 0 Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and j upgrades to the existing system. [I:x ' There will be buffer enhancements to an off-site Category 2 wetland located within 100 feet of the subject site. No construction will occur in the buffer. The enhancement of the buffer by PA removing the intrusive plant species and plantings of native species is a permitted activity. A 3,070 square foot Category 3 wetland, hydrologically isolated, is located within the proposed it detention pond site. As the wetland is less than 5,000 square feet in area, the proposed activity (stormwater pond construction) is exempt from the Critical Areas regulations. i rik i Date of Exemption: June 17, 2003 K Conditions of Approval: None. g P Approved by the City of Renton Date t Planning/Building/Public Works Administrator ii / r U:wetlandcert.doc A iNI w '�. .'ix,-'Mp I^�.=tH. ,a,r«,�, �a-.�.Ys;3"L. .y._w 0 g.�tz�'$�. _ -. ��Y_. . .�gA �"��.-�.'4 e�'.6 x" Y.F1...�.•^ -�.`r'f S.� ,y, • • wit sp CERTIFICATE OF WETLAND EXEMPTION City of Renton File Number: LUA 02-119, ECF - Detention Pond & Stormwater System Improvements. Location: Detention Pond at 4520 NE 10th Street Proponent: City of Renton —Surface Water Utility. Legal Description/King County Assessor's Property Identification Number: Please see attached legal/#102305 9434 Background: Section 4-3-110G of the Renton Municipal Code lists the activities that are exempt from compliance with the City of Renton's wetland regulations. This section also states that exempt activities "require that a certificate of exemption be obtained from the Department Administrator". Description of proposal and wetlands: The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th j Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. There will be buffer enhancements to an off-site Category 2 wetland located within 100 feet of the subject site. No construction will occur in the buffer. The enhancement of the buffer by removing the intrusive plant species and plantings of native species is a permitted activity. A 3,070 square foot Category 3 wetland, hydrologically isolated, is located within the proposed detention pond site. As the wetland is less than 5,000 square feet in area, the proposed activity (stormwater pond construction) is exempt from the Critical Areas regulations. Date of Exemption: June 17, 2003 t1 Conditions of Approval: None. Approved$411 y of enton Dat Planning/Builg Public Works Administrator U:wetlandcert.doc LEGAL DESCRIPTION OF PROPERTY NE 10th ST/Anacortes Ave. NE Detention Pond Property SITUATED IN THE NW 1/4 QUARTER OF SECTION 10 , TOWNSHIP 23N RANGE 5E , IN KING COUNTY, WASHINGTON. THE WEST 164 FEET OF THE SOUTHWEST QUARTER OF THE NORTHEAST QUARTER OF THE NORTHWEST QUARTER OF SECTION 10, TOWNSHIP 23 NORTH, RANGE 5 EAST, W.M. IN KING COUNTY, WASHINGTON; EXCEPT ROADS, (OR 49,036 SQUARE FEET OR 1.125 ACRES MORE OR LESS). KING COUNTY PARCEL NO. 102305-9434 H:FILE SYS/SWP-27-2266\01\1300\01\020709B-Legal Descrp Property v10.doc\DWC\tb 1 n En, • f t Iii, , O l-./ 1111 1 • ,:i , il ° 1 • NE 12TH ST !o '®`"�" 1;► li [Li -r�ti ! E , a ri fl • tH • oloI) T]Di tJ (i ff! i f 1 Hi {LJ k 1 jiiCITY OF REWITON •• I D1 f i .� CITY OF RENTON KING COUNTY cp • • • • • NE 11TH• Ja! j �� I s o L C ND 1 =[-Ljj1==j1 ! 4 I . . _� , i m_ I I r , NFAKBIB7f 1 f 0 1 • 1 F RPLCMT STORM SYSTEM • i Z , LL ''1 , 5fOR,""'� ` i i�� I , € U !. •- ., , ALTERNATIVE RO TE • �m �.��/ \�`Fl�ljl i a !!�r j i >/ 3 �'z ;EX STORM SYSTENI • • L I o 1 : • , , (4 .. ..., _--... firm= tm7G.bJMN I‘INN; .1.1 ii mi. SI LI,.%Li, 1 c61: \ .44 11.11.1701_M; • ii :• ,I LAIi --i pi !_i _E•-_-_ i >, I NO . el 1 mill IN j pi • 1• _ • 1 1../ ' Ill . -' �_I/.1 .1 ,-_. PRE . 0 KL..i. .Th, 0 . tr)1 t orif, i 1-ta. !Film 011074,plaw )/ ! ig i A -- .: . ._, ..,,. . \ i , i .'..iiii 1 (7014 'II I Z .,.:1 i lil • i: . .......g.r— ' 'fir/ l : ! ~• i • SE T16TH ST ' 01111,1 .11 i i u• r— T , I 1 1 I�.. L. RP Ali Dt i i ❑ 1 • i i I i r 11 � w I 1 i U 11 1 1 E-_ i I I i 1 l �/= , ii., li��i •-• i--� i 1 - 3 • I 1 i � t ii i(`� ! i� ! I it I 1 { ! 1 I ! 1 rCr i'1 1 'A d i Ind-! 14.,J r__/C"'� �J� I. s i I 1 i 1 - rM ^ 'a=4141" Atm Y CITY OF NE 10DETENTIONRTES�DAVE.NE to/te/oz M. RENTON POND Drama STORM SYSTEM IMPROVEMENT PROJECT .' atw NO. ,��„ R. o ,, ._ `�"' "'°` 040. SEPA SITE PLAN CITY OF RENTON PLANNING/BUILDING/PUBLIC WORKS MEMORANDUM DATE: February 11, 2003 TO: City Clerk's Office FROM: Holly SUBJECT: Land Use File Close-Out Please complete the following information to facilitate project close-out and indexing by the City Clerk's Office. fP:O/oYl!/O/.A'/®/B/O/.41/O/®/.O/tl%O/9/.d/.O//1/.O/LY/.01,MW.074,/27a7/O/.O/®/.O/O/O/®/O/OY®/O/O/!J/dY0/O/.OYO.:OY.O/.C.'/®/®/.074SW/OY®/®/®/O/O/O/O/O/d/O/.OYO/®/27/.0%9/O/L7/O/61/O'/.R9/07417..67/p/7/a0/v940 Project Name: Detention Pond and Pipe Repairs 0 n LUA(File) Number: LUA02-119, ECF 0 c o $ Crass References: AKA's: N/A c 0, 4 A Project Manager: Susan Fiala Acceptance Date: 11/26/2003 ` o 9 cApplicant:. City of Renton, Surface Water Owner: City of Renton 0 0 Contact: Daniel Carey PID #: 102305 9129 0 o ERC Approval/Denial (circle one) & Date: 11/26/2002- Approved o ERC Appeal Date: 12/20/2002 0 o Public Hearing Date: N/A Appeal Period Ends: N/A °a o Date Appealed to HE & By Whom: N/A t $ HE Decision & Date: N/A 0 d' o Date Appealed to Council & By Whom: N/A a o, a Council Decision & Date: N/A Mylar Recording #: a Project Description: The applicant is proposing improvements to the stormwater system to o reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes o o Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, r 0 constructing a new stormwater pipe system for the pond and repairs and upgrades to the o e existing system. The detention pond will be located on City property located in King County, 0, I addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways il located in the City of Renton and King County. The applicant is proposing two alternatives for i° pipe system locations in the right-of-ways. A Category 3 wetland is located on the detention ,°'a $ pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both o 0 wetlands are regulated under the jurisdiction of King County. s o Location: SW 43rd ST by Springbrook Creek o o 0 Comments: o / S g o %/ e/®/ K27/a/a/a/®/47/d/�./.�/®/m/o/4,/po/49/a/.o/ 7/a/a/oo/ 0/a/0/®/47/4/o/o%.0/®/o/4/d/pa/a/a/®/®/,47/./d/.0/®/®/Er/®/m/a/0/ao%47/,0/®/o/d/a/n,.07®/®/47/.9/,7/®/o/n/„/®/d/®,o/p/.09 Setup , 4, .„ CITY ^F RENTON Planning/Bui1u n) /PublicWorks Department J e Tanner,Mayor Gregg Zimmerman P.E.,Administrator February 7, 2003 Daniel Carey, Project Manager City of Renton, Surface Water Utility 1055 South Grady Way Renton, WA 98055 SUBJECT: Detention Pond/Pipe Repairs. LUA-02-119,ECF Dear Mr. Carey: • This letter is to inform you that the appeal period has ended for the Environmental Review Committee's (ERC) Determination of Non-Significance -Mitigated for the above-referenced project. No appeals were filed on the ERC determination. This decision is final and application for the appropriately.required permits may proceed. The applicant must comply with all ERC Mitigation Measures and Advisory Notes. If you have any questions, please feel free.to contact me at (425)430-7382. For the Environmental Review Committee, Susan Fiala Senior Planner cc: E. Suciu, T. Nino, R. & R. Key, R.Hanning, H.Johansen/Parties of Record • T,NAL.noc R E N T O N 1055 South Grady Way-Renton,Washington 98055 •� AHEAD OF THE CURVE :: This paper contains 50%recyclsr material,30%post consumer f d CITY OF RENTON MEMORANDUM Date: February 7, 2003 To: Daniel Carey, Surface Water Utility Project Manager From: Susan Fiala Environmental Review Committee Subject: Detention Pond and Stormwater System Improvements LUA-02-119, ECF We just wanted to inform you that the comment and/or appeal periods have ended for the Detention Pond and Stormwater System Improvements Determination of Non-Significance - Mitigated. No appeals were filed. This decision is final and application for the appropriately required permits may proceed. If you have any questions, please feel free to contact me at 425-430-7382. \- AFFIDAVIT OF PUBLICATION - Barbara Alther,first duly sworn on oath states that he/she is the Legal Clerk of the - "`-P` - - .NOTICE OF ENVIRONMENTAL_ _ SOUTH COUNTY JOURNAL 9 ENVIRONMENTAL REVIEW 600 S.Washington Avenue,Kent,Washington 98032 t -COMMITTEE . ' :'; RENTON,WASHINGTON I- The Environmental Review a daily newspaper published seven(7)times a week. Said newspaper is a legal newspaper of Committee has_issued a Determination • general publication and is now and has been for more than six months prior to the date of I publication, referred to, printed and published in the English language continually as a daily newspaper in Kent, King County,Washington. The South County Journal has been approved as a �:;.' , legal newspaper by order of the Superior Court of the State of Washington for King County. • !of Non-Significance-mitigated for 'the The notice in the exact form attached,was published in the South County Journal(and following project under the authority of • the Renton Municipal Code. not in supplemental form)which was regularly distributed to the subscribers during the below DETENTION , POND AND • stated period. The annexed notice,a STORMWATER IMPROVEMENTS LUA-02-11'9,ECF Detention Pond&Stormwater Improvements . Proposed improvements to the stormwater system to reduce the frequency and severity of flooding. as published on: 12/6/02 Location:City ROW in NE 10th St. to NE 11th St.,Ariacortes Ave.NE, The full amount of the fee charged for said foregoing publication is the sum of$66.75,charged to King County ROW & pond site at Acct. No.8051067. 13610 SE 116th St. Appeals of _the environmental determination must be.filed in writing The cost above includes a$6.00 fee for the printing of the affidavits. • on or before 5:00 PM December 20, 2002. Appeals must be filed in writing Legal Number 845039 :together with the required $75.00- application fee with:Hearing Examiner, L ��J�/ City of Renton,1055 South Grady Way, (% G4G��Cll.� :—___ Renton, WA 98055. Appeals to the , Legal Clerk, outh County Journal Examiner are governed by City of Renton Municipal Code Section 4-8- 110. Additional information regarding ; the appeal process may be obtained Subscribed and sworn before me on this day of ( ,2002 from the Renton City Clerk's Office, • A-1Ir-LIP-15-7—)11.A (425)-430 6510. 0�®oO..r.4.".Part � J 25)-_4 0-e_mtier 6e 20 2 8450 9 my w�°`,��.� sIsii• ��!a�oB Notary g �-. e �: �R,s F,j-A � o Public of the State of Wash ton `��:�n��` �9� d residing in Renton aw: ta0 Tr iiy tcoS m King County,Washington e%o' . o: ?o m d 15m' � m ti zZ 2 Z G) N.01ICE ENVIRONMENTAL DETERMINATION-REVISED POSTED TO NOTIFY INTERESTED PERSONS OF AN ENVIRONMENTAL ACTION PROJECT NAME: DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS PROJECT NUMBER: LUA-02.119,ECF DESCRIPTION AND LOCATION: The Water Utility Division of the City of Renton is proposing Improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE.Improvements Involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system.The detention pond will be located on City property located in King County,addressed as 13610 SE 116th Street.The pipe system Improvements will occur in right-of- ways located In the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Class 3 wetland(King County Classification)is located on the detention pond site and a Class 2 wetland Is located within 100 feet of the proposed site.Both wetlands are regulated under the jurisdiction of King County. Location:City ROW in NE 10 St.to NE 11'St.,Anacortes Ave.NE,King County ROW&pond site at 13610 SE 116m St. THE CITY OF RENTON ENVIRONMENTAL REVIEW COMMITTEE(ERC)HAS DETERMINED THAT THE PROPOSED ACTION DOES NOT HAVE A SIGNIFICANT ADVERSE IMPACT ON THE ENVIRONMENT. APPEALS OF THE ENVIRONMENTAL DETERMINATION MUST BE FILED IN WRITING ON OR BEFORE 5:00 PM DECEMBER 20,2002. APPEALS MUST BE FILED IN WRITING TOGETHER WITH THE REQUIRED$75.00 APPLICATION FEE WITH:HEARING EXAMINER,CITY OF RENTON,1055 SOUTH GRADY WAY, RENTON,WA 98055. APPEALS TO THE EXAMINER ARE GOVERNED BY CITY OF RENTON MUNICIPAL CODE SECTION 4-8-110. INFORTION REGARDING PROCESS MAY BE OBTAINED FROM THE RENTON ITYNAL CLERK'S OFFICE,(425)-430-6510. APPEAL • NORTH • ■ 1 IIIP,,,'�' ---- I 61111:=I�1FA I MI loconlaw 1EE M= IO NE 10th 5I SE 116th St NMI 111111M IN___ tisaww NEIGHBORHOOD DETAIL MAP 1 0 300' NE10W5T/ANACORTES AVE NE N Smle 1•-300'• DETENTION POND,STORM SYSTEM FOR FURTHER INFORMATION,PLEASE S V SOOTAT THE 4 0-7 CITY OF0 RENTON,DEVELOPMENT SERVICES DO NOT REMOVE THIS NOTICE WITHOUT PROPER AUTHORIZATION Please Include the project NUMBER when calling for proper file identification. • CERTIFICATION , hereby certify that 3 copies of the above document were posted by me in 3 conspicuous places on or nearby the described property on c e L to, Zo a z Signed: ti (2,�+ tom,C U ATTEST:Su d sc ib o befo a me,a Notary Public,in and for S e of d Washi `tgcresi;ug�i �' ,on the day of `� • ��' NOTARY UBL IC MARILYN KAMOHEFF STATE OF WASHINGTON 6Viy APPOINTMENT EXPIRES:6-29-03 EXPIRES JUKE 29,2003 CITY OF RENTON CURRENT PLANNING DIVISION AFFIDAVIT OF SERVICE BY MAILING On the 3 day of 'Dec e.n lotr , 2002, I deposited in the mails of the United States, a sealed envelope containing �{ Eh VS/OAM. aL n4- Te.Aef I.h?-YpprahS b GLEA/ refed Y§7 e ied documents. This information was sent to: Name Representing d1a encAe 5 S 2-e_ G • (Signature of Sender) )1)\.&kt jyto.V3 STATE OF WASHINGTON ) ) SS COUNTY OF KING ) I certify that I know or have satisfactory evidence that '�F o 16\ Crr i -ex signed this instrument and acknowledged it to be his/her/their free and voluntaryct for the uses and purposes mentioned in the instrument. Dated: l Zi (2/o • /� 7�� �r,. , .. ..< a — — — • Notary Public! and for the State of Wa ngton MARILYN KAMCHEFF ► NOTARY PUBLIC ► Notary(Print) MARILYN KAMCHEFF STATE OF WASHINGTON ► My appointmentWIFINTMENT EXPIRES:6-29-03 COMMISSION EXPIRES .I(!NF 29.2003 ► Proje a T Gke-n fla n rand and 5-form io 0-4 ah,p ro ye'heeds Project Number: L ia.A 0 2 ~-O Q q , EC F NOTARY.DOC • AGENCY(DOE) LETTER MAILING (ERC DETERMINATIONS) Dept. of Ecology Washington Dept. of Fish &Wildlife Muckleshoot Indian Tribe Fisheries Dept. Environmental Review Section Habitat Program Attn. SEPA Reviewer PO Box 47703 16018 Mill Creek Boulevard 39015— 172nd Avenue SE Olympia,WA 98504-7703 Mill Creek,WA 98012 Auburn,WA 98092 WSDOT Northwest Region Duwamish Tribal Office Mr. David Dietzman Attn: Ramin Pazooki 14235 Ambaum Blvd. SW—Front A Dept. of Natural Resources King Area Dev. Serv., MS-240 Burien,WA 98166 PO Box 47015 PO Box 330310 Olympia,WA 98504-7015 Seattle,WA 98133-9710 US Army Corp. of Engineers Ms. Shirley Marroquin Eric Swennson Seattle District Office Environmental Planning Supervisor Real Estate Services PO Box Ci3755 KC Wastewater Treatment Division Seattle Public Utilities Seattle,WA 98124 201 South Jackson St, MS KSC-NR-050 Suite 4900, Key Tower Attn: SEPA Reviewer Seattle,WA 98104-3855 700 Fifth Avenue Seattle,WA 98104 KC Dev. & Environmental Serv. City of Newcastle City of Kent Attn: SEPA Section Attn: Mr. Micheal E. Nicholson Attn: Mr. Fred Satterstrom, AICP 900 Oakesdale Ave. SW Director of Community Development Acting Community Dev. Director Renton,WA 98055-1219 13020 SE 72nd Place 220 Fourth Avenue South Newcastle,WA 98059 Kent,WA 98032-5895 Gary Kriedt Joe Jainga Steve Lancaster, Responsible Official Senior Environmental Planner Municipal Liason Manager City of Tukwila Metro Transit PO Box 90868 6300 Southcenter Blvd. 201 South'Jackson Street MS: XRD-01W Tukwila,WA 98188 KSC-TR-0431 Bellevue,WA 98009-0868 Seattle,WA 98104-3856 Note: If the Notice of Application states that it is an "Optional DNS",the following agencies and 'cities will need to be sent a copy of the checklist, PMT's, and the notice of application. Also note, do not mail David Dietzman any of the notices he gets his from the web. Only send him the ERC Determination paperwork. Last printed 10/22/02 3:57 PM _ _ ___ . ___ , . Name• ENVIRONMENTAL DETERMINATION POSTED TO NOTIFY INTERESTED PERSONS OF AN ENVIRONMENTAL ACTION PROJECT NAME: DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS PROJECT NUMBER: LUA-02-119,ECF DESCRIPTION AND LOCATION: The Water Utility Division of the City of Renton Is proposing Improvements to the stormwater system to reduce the frequency and severity of flooding In the vicinity of NE 10th Street and Anacortes Avenue NE.Improvements involve constructing a detention pond to , store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system.The detention pond will be located on City property located in King County,addressed as 13610 SE 116th Street.The pipe system Improvements will occur In right-of- , ways located In the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Class 3 wetland(King County Classification)Is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site.Both wetlands are regulated under the Jurisdiction of King County. Location:City ROW In NE 10°'St.to NE 11'St.,Anacortes Ave.NE,King County ROW 8 pond site at 13610 SE 116^St. THE CITY OF RENTON ENVIRONMENTAL REVIEW COMMITTEE(ERC)HAS DETERMINED THAT THE PROPOSED ACTION DOES NOT HAVE A SIGNIFICANT ADVERSE IMPACT ON THE ENVIRONMENT. APPEALS OF THE ENVIRONMENTAL DETERMINATION MUST BE FILED IN WRITING ON OR BEFORE 5:00 PM DECEMBER 16,2002. APPEALS MUST BE FILED IN WRITING TOGETHER WITH THE REQUIRED$75.00 APPLICATION FEE WITH:HEARING EXAMINER,CITY OF RENTON,1055 SOUTH GRADY WAY,RENTON,WA 96055. APPEALS TO THE EXAMINER ARE GOVERNED BY CITY OF RENTON MUNICIPAL CODE SECTION 4-5.110. ADDITIONAL INFORMATION REGARDING THE APPEAL PROCESS MAY BE OBTAINED FROM THE RENTON CITY CLERKS OFFICE,(425)-430-6510. ' I Sunsettin =1_ , • NORTH■ • • MO Cw y 1 ■MIIIIPMIt E�►►.gy ES m i • I1i11®B-air o i loczonalin • • NE 161h Si SE116N St N = NM it sm. NEIGHBORHOOD DETAIL MAP I 0 UT NE10NST/ANACORTES AVE NE IT DETENTION POND,STORM SYSTEM N SWet-00' FOR FURTHER INFORMATION,PLEASE CONTACT THE CITY OF RENTON,DEVELOPMENT SERVICES DIVISION AT(425)430-7200. DO NOT REMOVE THIS NOTICE WITHOUT PROPER AUTHORIZATION IPlease Include the project NUMBER when calling for proper file Identification. CERTIFICATION I, JPL) , hereby certify that -3 copies of the above document were posted b me i conspicuous places on or nearby the described property on �' '7)0 0 // Signed ),' a ,. (, ' ,,y-,drit, ATTEST: Subscribed and sworn before me,a Notary Public,in and for the S to of Wa _i}:t�agtgairg/,s�idi g�,in � vL �. ,on the ? S`ki, day of y�;Co . C, - MA fF.,!N tl1�Ad+i�':�7fp F F . B"d` ;' e t1 2 � 4 l+�,U ,— SVIt�91'I9LY eV Y r = •""'°''r �,AM1,,HEFF f 1 b f�T OF !r,'�a i i i 9 Alit APPOINTMENT EXPIRES:6-29- COMMISSION EXPIRES I' JUNE 2.9, 200 3 r CITY OF RENTON • CURRENT PLANNING DIVISION AFFIDAVIT OF SERVICE BY MAILING On the 2f day of \NI)v . , 2002, I deposited in the mails of the United States, a sealed envelope containing • 4=_IaL -e-1-t_ documents. This information was sent to: Name Representing_ UV (Signature of Sender) C � _-.� STATE OF WASHINGTON ) ) SS COUNTY OF KING ) I certify that I know or have satisfactory evidence that 1"'1ti-cl-r-e-e_ 1 .J-e-'J —tic signed this instrument and acknowledged it to be his/her/their.free and voluntary act for the uses and purposes mentioned in the instrument.; Dated: 1 ZI 119 to -z_- • �_��C2¢ „ ,` Notary Public ly and for the State of Washton MARILYN KAMCHEFF NOTARY PUBLIC Notary(Print) MARILYN KAMCHEFF STATE OF WASHINGTON 1 My appointment expKVAPPOINTMENT EXPIRES:6-29-03 COMMISSION EXPIRES .IIJNF ?.R. 200 f \t\ v‘ . Ski) r �4i`� t45r+� '-`u✓�'V V` ...�Q Project Number: O 2- I I 'c'► 1- C (— NOTARY.DOC (DOE)AGENCY LETTER MAILING (ERC DETERMINATIONS) Dept. of Ecology Washington Dept. of Fish &Wildlife Muckleshoot Indian Tribe Fisheries Dept. Environmental Review Section Habitat Program Attn. SEPA Reviewer PO Box 47703 I 16018 Mill Creek Boulevard 39015— 172nd Avenue SE • Olympia,WA 98504-7703 Mill Creek,WA 98012 Auburn, WA 98092 WSDOT Northwest Region Duwamish Tribal Office Mr. David Dietzman Attn: Ramin Pazooki 14235 Ambaum Blvd. SW—Front A Dept. of Natural Resources King Area Dev. Serv., MS-240 Burien,WA 98166 PO Box 47015 PO Box 330310 Olympia,WA 98504-7015 Seattle,WA 98133-9710 US Army Corp. of jEngineers Ms. Shirley Marroquin Eric Swennson Seattle District Office Environmental Planning Supervisor Real Estate Services PO Box C-3755 KC Wastewater Treatment Division Seattle Public Utilities Seattle,WA 98124 201 South Jackson St, MS KSC-NR-050 Suite 4900, Key Tower Attn: SEPA Reviewer Seattle,WA 98104-3855 700 Fifth Avenue Seattle,WA 98104 KC Dev. & Environmental Serv. City of Newcastle City of Kent Attn: SEPA Section Attn: Mr. Micheal E. Nicholson Attn: Mr. Fred Satterstrom, AICP 900 Oakesdale Ave. SW Director of Community Development Acting Community Dev. Director Renton,WA 98055-1219 13020 SE 72nd Place 220 Fourth Avenue South Newcastle,WA 98059 Kent, WA 98032-5895 Gary Kriedt Joe Jainga Steve Lancaster, Responsible Official Senior Environmental Planner Municipal Liason Manager City of Tukwila Metro Transit PO Box 90868 6300 Southcenter Blvd. 201 South Jackson Street MS: XRD-01W Tukwila,WA 98188 KSC-TR-0431 I Bellevue,WA 98009-0868 Seattle,WA 981041-3856 Note: If the Notice of Application states that it is an "Optional DNS", the following agencies and cities will need to be sent a copy of the checklist, PMT's, and the notice of application. Also note, do not mail David Dietzman any of the notices he gets his from the web. Only send him the ERC Determination paperwork. Last printed 10/22/02 3:57 PM [ -.',, . ' r ,- -- r 7, 1 ) , , ,, ENVIRONMENTAL DETERMINATION- REVISED POSTED TOINOTIFY INTERESTED PERSONS OF AN ENVIRONMENTAL ACTION PROJECT NAME: DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS . PROJECT NUMBER: LUA-02-119,ECF DESCRIPTION I AND LOCATION: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of- ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Class 3 wetland (King County Classification)is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Location: City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW&pond site at 13610 SE 116m St. THE CITY OF RENTON ENVIRONMENTAL REVIEW COMMITTEE (ERC) HAS DETERMINED THAT THE PROPOSED ACTION DOES NOT HAVE A SIGNIFICANT ADVERSE IMPACT ON THE ENVIRONMENT. II APPEALS OF THE ENVIRONMENTAL DETERMINATION MUST BE FILED IN WRITING ON OR BEFORE 5:00 PM DECEMBER 20, 2002. APPEALS MUST BE FILED IN WRITING TOGETHER WITH THE REQUIRED $75.00 APPLICATION FEE WITH: HEARING EXAMINER, CITY OF RENTON, 1055 SOUTH GRADY WAY, RENTON, WA 98055. APPEALS TO THE EXAMINER ARE GOVERNED BY CITY OF RENTON MUNICIPALiCODE SECTION 4-8-110. ADDITIONAL INFORMATION REGARDING THE APPEAL PROCESS MAY BE OBTAINED FROM THE RENTON CITY CLERK'S OFFICE,(425)-430-6510. . NE Sunset Blvd — a `L z 1 U— storm System Improvements I NORTH •• City of RENTGN KING County JNE11t1, wSt ow to — — � A :Hy r z , Ili c�7 ' I; > 1 — L _ I S Detention Pond NE 10 P /Prerty — — Ns owA simativ f .7 — St rm Sys em . Im roe sm nts NE 10th St I opSE 116th St I I I II._1—__L_.LL.-- NEIGHBORHOOD DETAIL MAP t 0 300' NE 10 th ST/ANACORTES AVE NE N Scale 1"=300' DETENTION POND.STORM SYSTEM FOR FURTHER INFORMATION,PLEASE CONTACT THE CITY OF RENTON,DEVELOPMENT SERVICES DIVISION AT(425)430-7200. AUTHORIZATION I DO NOT ude he.;'project NUMBER';wli'en"o Ilin ;,for r' I REMOVE THIS NOTICE WITHOUT PROPER p j ca ,,.g "p oper.file'identificatiorr. i r — / 4,, e,, ` CITY RENTON r„ ,.LL i` Planning/Building/PublicWorks Department Jesse Tanner,Mayor Gregg Zimmerman P.E.,Administrator 11 December 3, 2002 I I I SUBJECT: Detention Pond and Stormwater System Improvements LUA-02-119, ECF Dear Interested Parties: This letterlis written on behalf of the Environmental Review Committee (ERC) and is to advise you that the appeal period for the subject project has been extended due to an error with the publisher. The new appeal period is as follows: Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 20, 2002. Appeals must be filed in writing together with the required $75.00 application fee • with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from.the Renton City Clerk's Office, (425)-430-6510. If you have any questions or desire clarification of the above, please call me at(425)430-7382. • I For the Environmental Review Committee, ,),‘Ze.7..., Susan Fiala Senior Planner 1 • cc: Parties of Record. Enclosure I 1 1 I i I 1 I \3\oa 1T----- revised lellel.dua 1 1055 South Grady Way-Renton,Washington 98055 R E N T O N �� AHEAD OF THE CURVE :: This paper contains 50%recycled material,30%post consumer �► CITY L_1i RENTON c. I aall Plannin uildin ublicWorks Department Jesse Tanner,Mayor Gregg Zimmerman P.E.,Administrator December 3,2002 Washington State Department of Ecology Environmental Review Section PO Box 47703 Olympia,WA 98504-7703 Subject: Revised Appeal Period for Environmental Determinations The project reviewed by the Environmental Review Committee (ERC)on November 26, 2002 has been assigned a!new appeal period due to an error with the publisher: DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS LUA-02-119, ECF The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system.The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Class 3 wetland (King County Classification)is located on the detention.pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Location: City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE•116th St. Appeals lof the environmental determination must be filed in writing on or before 5:00 PM December 20, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner] are governed, by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. If you have questions, please call me at(425)430-7382. For the Environmental Review Committee, V ' Q;� Susan Fiala Senior Planner cc: King County Wastewater Treatment Division Larry Fisher, Department of Fisheries David F. Dietzman, Department of Natural Resources WSDOT, Northwest Region �'\13\°1. Duwamish Tribal Office Rod Malcom, Fisheries, Muckleshoot Indian Tribe(Ordinance) US Army Corp. of Engineers revised agency teuer.dot\ R E N T O N 1055 South Grady Way-Renton,Washington 98055 �. AHEAD OF THE CURVE L? This paper contains 50%recycled material,30%post consumer CITY OF RENTON MEMORANDUM Date: December 3, 2002 To: Daniel Carey,Surface Water Utility Project Manager From: Susan Fiala Environmental eview Committee Subject: Detention Pond and Stormwater System Improvements LUA-02-119, ECF On behalf of the Environmental Review Committee(ERC), I would like to inform you that appeal period for the subject project has been extended due to an error with the publisher. The new appeal period is as follows: Appeals of the environmental determination must be filed in writing on or before 5:00 PM December'20, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. If you have any questions or desire clarification of the above, please call me at 430-7382. dnsmm NOTICE OF ENVIRONMENTAL DETERMINATION ENVIRONMENTAL REVIEW COMMITTEE RENTON, WASHINGTON The Environmental Review Committee has issued a Determination of Non-Significance-mitigated for the following project under the authority of the Renton Municipal Code. DETENTION POND AND STORMWATER IMPROVEMENTS LOA-02-119, ECF Proposed improvements to the stormwater system to reduce the frequency and severity of;flooding..Location: City ROW in NE 10th St. to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE 116th St. Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 20, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner; City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed jby City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. Publication Date: December 6,2002 Account!No. 51067 dnspub K:),NOOE *.. • . . . . ,. ENVIRONMENTAL DETERMINATION • POSTED TO;NOTIFY INTERESTED PERSONS OF AN ENVIRONMENTAL ACTION • PROJECT NAME: DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS • PROJECT NUMBER: LUA-02-119,ECF DESCRIPTION AND LOCATION: The Water Utility Division of the City of Renton is proposing . improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity • of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King • County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of- ways located in the City of Renton and King County. The applicant is proposing two alternatives for • pipe system locations in the right-of-ways.A Class 3 wetland (King County Classification)is located on the detention pond site and a Class 2'wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Location: City ROW in NE 10thSt.to NE 111h St.,Anacortes Ave. NE, King County ROW&pond site at 13610 SE 116th St. ' I • THE CITY OF RENTON ENVIRONMENTAL REVIEW COMMITTEE (ERC) HAS DETERMINED THAT THE • PROPOSED ACTION DOES NOT HAVE A SIGNIFICANT ADVERSE IMPACT ON THE ENVIRONMENT. APPEALS OF THE ENVIRONMENTAL DETERMINATION MUST BE FILED IN WRITING ON OR BEFORE 5:00 PM DECEMBER 16, 2002. APPEALS MUST BE FILED IN WRITING TOGETHER WITH THE REQUIRED $75.00 APPLICATION FEE WITH: HEARING EXAMINER, CITY OF RENTON, 1055 SOUTH • GRADY WAY, RENTON, WA 98055. APPEALS TO THE EXAMINER ARE GOVERNED BY CITY OF RENTON MUNICIPAL CODE SECTION 4-8-110. ADDITIONAL INFORMATION REGARDING THE APPEAL PROCESS MAY BE OBTAINED FROM THE RENTON CITY CLERK'S OFFICE,(425)-430-6510. NE Sunset Blvd _ _ o IL ' ,�. I _ z t3 • — Storm System I ry Improvements • • - NORTH 1 City of RENTON KING County Jl INEI11tII Stl I ow tag tam ■r a LAj A ive 2t, ern t W i " { • _ Detention and • NE 10 p . I Property :1--- • . . rites r � Alternativ 1- Storm Sys em IITI3M0m nts • NE 10th St SE 116th St I 1 NEIGHBORHOOD DETAIL MAP i o 3o0'I NE 101h ST/ANACORTES AVE NE N Scale 1"=300' DETENTION POND,STORM SYSTEM I FOR FURTHER INFORMATION, PLEASE CONTACT THE CITY OF RENTON, DEVELOPMENT SERVICES I DIVISION AT(425)430-7200. DO NOT REMOVE THIS NOTICE WITHOUT PROPER AUTHORIZATION -Pleaselinclude-the; t*at`NIJMBER`,w,hen;:call g for p !p;roper,'file identification. .. . NOTICE OF ENVIRONMENTAL DETERMINATION ENVIRONMENTAL REVIEW COMMITTEE RENTON,WASHINGTON The Environmental Review Committee has issued a Determination of Non-Significance-mitigated for the following project under the authority of the Renton Municipal Code. DETENTION POND AND STORMWATER IMPROVEMENTS LOA-02-119, ECF Proposed improvements to the stormwater system to reduce the frequency and severity of flooding. Location: City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE 116th St. Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed lby City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. Publication Date: December 2,2002 Account No. 51067 dnspub ;....- CITY C. RENTON ‘ ) Planning/Building/PublicWorks Department Gregg Zimmerman P.E.,Administrator Jesse Tanner,Mayor ' November 27,2002 • • • SUBJECT:! Detention Pond and Stormwater System Improvements I LUA-02-119, ECF Dear Interested Parties: This letter his written on behalf of the.Environmental Review Committee (ERC) and is to advise you that they have completed their review of the subject project. The ERC issued a threshold Determination of Non-Significance-Mitigated with Mitigation Measures. Please refer to the enclosed Mitigation Measures document.) Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regardingithe appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. The preceding information will assist you in planning for implementation of your project and enable you to exercise your appeal rights more fully, if you choose to do so. If you have any questions or desire clarification of the above, please call me at(425)430-7382. For the Environmental Review Committee, . Susan Fiala Senior Planner ' cc: Parties of Record Enclosure I - 1 dt ismdeltet.POR.doc RENTON 1055 South Grady Way-Renton,Washington 98055 AHEAD OF THE CURVE C. This paper contains 50%recycled material,30%post consumer CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- • MITIGATED MITIGATION MEASURES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater'pipe system-for.•the pond and repairs and upgrades to the existing system. The detention,`pond Will be; located on,City.property located in King County, addressed as 13610 SE 116th Street.'The pipe,.system-improvements;:will occur in right-of-ways located in the City of Renton and King County; The applicant is proposing;;two alternatives for pipe system locations in the right-of-ways. A•Class :3wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located witlin;;:100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County,:: LOCATION OF PROPOSAL:.. CityyROWfin:NE:10th St. to NE 1.1th St;,Anacortes Ave. NE, King County ROW 84 pond site at 1361.0 SE 116th St. Mitigation Measures 1. The applicant shall be required to adhere to the requirements of the City of Renton Aquifer Protection regulations including but not limited to°regulation of hazardous materials; a fill source statement; and surface water management standards. ' Mitigation measures.doc CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED ADVISORY NOTES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE..•,Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system'for:,the pond and repairs and upgrades to the existing system. The detention-pond will belocated on: City, property located in King County, addressed as 13610 SE 116th Street."The pipe system,improvements will occur in right-of-ways located in the Cityof Renton and Kin :'Coun The applicant is ro osin two alternatives for pipe system King;!Count PP P P 9;: , P�P Y locations in the right-of-ways. A-Class•3 wetland (King County Classification) is located on the detention pond site'and a Class 2 wetland"is located within,100:feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County: e '+ LOCATION OF PROPOSAL: City;ROW:in NE 10th,St.to NE 1.1'h St,Anacortes Ave. NE, King County ROW&pond site at 13610 SE 116 St. Advisory Notes to.Applicant: The following notes are supplemental information provided..in,conjunction with the environmental determination. Because these notes are provided as information Only, they are not subject to the appeal process for environmental determinations. • Planning:', 1. The wetlands found on site and off site must comply with all applicable King County regulations. 2. The applicant is to obtain applicable King County permits. Plan Review-General: 1. This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. 2. System Development Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were calculated. If connection is made then code required fees would apply. Plan Review-Water: 1. The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level is approximately 68 psi. Plan Review-Sewer: 1. An 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer service outside the City limits of Renton. Plan Review-Storm: 1. There are existing constructed storm water facilities along the frontage of SE 116th street. advisory notes.doc CITY OF RENTON MEMORANDUM Date: November 27, 2002 To: Daniel Carey, Surface Water Utility Project Manager From: Susan Fiala Environmental Review Committee Subject: Detention Pond and Stormwater System Improvements LUA-02-119, ECF On behalf of the Environmental Review Committee (ERC), I would like to inform you that they have complete4 their review of your project. The Committee, on November 26, 2002, decided that the project will be issued a Determination of Non-Significance-Mitigated (DNS-M). The City of Renton ERC has determined that it does not have a probable significant adverse impact on the environment. An Environmental Impact Statement(EIS) is not required under RCW 43.21C.030(2)(c). This decision was made by the ERC under the authority of Section 4-6-6, Renton Municipal Code, after review of a completed environmental checklist and other information, on file with the lead agency. This information is available to the public on request. Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. If you have any questions or desire clarification of the above, please call me at 430-7382. dnsmm CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- • MITIGATED MITIGATION MEASURES • APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements•to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE,,,Improments invplve constructing a detention pond to store stormwater runoff, constructing a new,stor'"mwater'pipe system for=;the pond and repairs and upgrades to the. existing system. The detention and \mill berllocated o Cittybproperty located in King County, addressed as 13610 SE 116th Street.•'-The pi system impro 'ements will occur in right-of-ways located in the City of Renton and King County The applicant is proposing `two alternatives for pipe system locations in the right-of-ways. A'Class:3 Wetland (King County Classification) is located on the detention pond site and a Class 2 wetland-As-located with n;;100,feet ofthe'P P�ro posed site. Both wetlands are regulated under the jurisdiction of King..County. ::'_ • LOCATION OF PROPOSAL:: Cifyft OW:v 0v NE.1Q':St. to N 11th St,Anacortes Ave. NE, King • County ROW&;'pond site at 136'10 SE 116th St. Mitigation'Measures : l 1. The applicant shall be required to Where to the requirements of the'.City of Renton Aquifer Protection regulations including but not limited to:regulation of hazardous''materials, a fill source statement;and surface'water management standards: ;pX • • • Mitigation measures.doc CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED ADVISORY NOTES APPLIC/1TION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE,,,;Impr"ovements involve constructing a detention pond to store stormwater runoff, constructing a new,stormwater pipe system forrfthe pond and repairs and upgrades to the existing system. The detention:-pond Will bel:;located on City £property located in King County, addressed as 13610 SE 116th Street:The pipesystem,improvementsnwill occur in right-of-ways located in the City of Renton and King:-`County: The applicant is proposing;,two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Ciessificatiien) is located on the detention pond site and a Class 2 wetland pis 'located withlins:,1 00:feet of the'proposed site. Both wetlands are regulated under the jurisdiction of King;County: LOCATION OF PROPOSAL: City F OW in NEs10th 1; St. to NE t 'St,Anacortes Ave. NE, King County ROW &"p` ond site at i 3610 SE 116th St. Advisory Notes to Applicant:: • The following notes are supplemezptal information provided.u -conjunction with the environmental determination. Because these notes are provided as information:only, they are not subject to the appeal process for environmental determinations. Planning: 1. The wetlands found on site and off site must comply with all applicable King County regulations. 2. The applicant is to obtain applicable King County permits. Plan Review-General: 1. This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. 2. System Development.Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were calculated. If connection is made then code required fees would apply. Plan Review-Water: 1. The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level ie approximately 68 psi. Plan Review-Sewer: • 1. An 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer(service outside the City limits of Renton. Plan Review-Storm: 1. There are existing constructed storm water facilities along the frontage of SE 116th street. advisory notes.doc q: CITY -F.RENTON "LL , ' Planning/Building/PublicWorks Department Jesse Tanner,Mayor Gregg Zimmerman P.E.,Administrator • November 27, 2002 • Washington State Department of Ecology Environmental Review Section PO Box47703 Olympia;WA 98504-7703 • Subject: Environmental Determinations Transmitted herewith is a copy of the Environmental Determination for the following project reviewed by the Environmental Review Committee (ERC) November 26, 2002: DETERMINATION OF NON-SIGNIFICANCE-MITIGATED DETENTION POND AND STORMWATER SYSTEM IMPROVEMENTS LUA02-119, ECF The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for • pipe system locations in the right-of-ways.A Class 3 wetland (King County Classification)is located on the detention pond site and a Class 2.wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Location: City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE 116th St. Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner, are governed by City of Renton Municipal.Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. If you have questions, please call me at(425)430-7382. For the Environmental Review Committee, Susan Fiala Senior Planner cc: King County Wastewater Treatment Division Larry Fisher, Department of Fisheries David F. Dietzman, Department of Natural Resources WSDOT, Northwest Region D;uwamish Tribal Office Rod Malcom, Fisheries, Muckleshoot Indian Tribe(Ordinance) • US Army Corp. of Engineers • Agency leuer.duc\ 1055 South Grady Way-Renton,Washington 98055 E N T O N AHEAD OF THE CURVE :: This paper contains5D%recycled material,30%post consumer • CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED MITIGATION MEASURES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE,..Impr'ovements'involve constructing a detention pond to store stormwater runoff, constructing a new stormwater`,pipe system'for;the pond and repairs and upgrades to the existing system. The detention `pond will be'°;.located on, city,property located in King County, addressed as 13610 SE 116th Street: The pipe system improvements.will occur in right-of-ways located in the City of Renton and King'County: The applicant is "proposing.,two alternatives for pipe system locations in the right-of-ways. AA Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetlandis'located,within100;feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County., LOCATION OF PROPOSAL: City:ROW iin:NE,10'r'St. to NE,11th St,Anacortes Ave. NE, King County ROW-&,pond site at 13610 SE 116th St. Mitigation Measures 1. The applicant shall be required to adhere to the requirements ofthe City of Renton Aquifer Protection regulations including but not limited to:regulation of hazardous materials; a fill source statement; and surface water management standards." • Mitigation measures.doc CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED ADVISORY NOTES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE.::Improvements'involve constructing a detention pond to store stormwater runoff, constructing a new stormwater'pipe system forthe pond and repairs and upgrades to the existing system. The detention"pond"will be located on City. property located in King County, addressed as 13610 SE 116th Street:The pipe.system improvements-;will occur in right-of-ways located in the City of Renton and King' County. The applicant is"proposing„two alternatives for pipe system . locations;in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located within lop.feet of the'proppsed site. Both wetlands are regulatedlli under the jurisdiction of King;County:. LOCATION OF PROPOSAL: CityROW n NE-.10th'St.to NE 11th St.,Anacortes Ave. NE, King County ROW-&;pond site at:13610 SE 116th St. Advisory Notes to Applicant:. The following notes are supplemental information provided,in conjunction with the environmental determination. Because these notes are provided as information only, they are not subject to the appeal pi ocess for environmental'determinations. Planning: 1. The wetlands found on site and off site must comply with all applicable King County regulations. 2. The applicant is to obtain applicable King County permits. Plan Review-General: 1. This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. 2. System Development Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were. calculated. If connection is made then code required fees would apply. Plan Review-Water: 1. The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level is approximately 68 psi. Plan Review-Sewer: 1. An 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer service outside the City limits of Renton. Plan Review-Storm: 1. There are existing constructed storm water facilities along the frontage of SE 116th street. advisory notes.doc 8 CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE (MITIGATED) APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. LOCATION OF PROPOSAL: City ROW in NE 10th St. to NE 11th St., Anpcortes Ave. NE, King County ROW &pond site at 13610 SE 116' St. LEAD AGENCY: City of Renton Department of Planning/Building/Public Works Development Planning Section The City of Renton Environmental Review Committee has determined that it does not have a probable significant adverse impact on the environment. An Environmental Impact Statement (EIS) is not required under RCW 43.21C.030(2)(c). Conditions were imposed as mitigation measures by the Environmental Review Committee under their authority of Section 4-6-6 Renton Municipal Code. These conditions are necessary to mitigate environmental impacts identified during the environmental review process. Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002.Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. PUBLICATION DATE: December 2,2002 DATE OF DECISION: November 26, 2002 SIGNATURES: 94 e I /4/1041N/a -A 7 6/42-, G e Zim a man dministrator DATE / Departme t Pla �ning/Building/Public Works (((9 (/G•7— Ji Shepherd,Adminis'tr tor DATE C mmunity Services ef eler,F a hie DATE Renton Fire Department dnsmsignature.doc r '+ 1 . CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE (MITIGATED) APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond sitel and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated',under the jurisdiction of King County. LOCATION OF PROPOSAL: City ROW in NE 10th St. to NE 11th St., Angcortes Ave. NE, King County ROW &pond site at 13610 SE 116t St. I LEAD AGENCY: City of Renton Department of Planning/Building/Public Works 1 Development Planning Section The City of Renton Environmental Review Committee has determined that it does not have a probable significant adverse impact on the environment. An Environmental Impact Statement (EIS) is not required under RCVV 43.21C.030(2)(c). Conditions were imposed as mitigation measures by the Environmental Review Committee under their authority of Section 4-6-6 Renton Municipal Code. These conditions are necessary,to mitigate environmental impacts identified during the environmental review process. i Appeals of the environmental determination must be filed in writing on or before 5:00 PM December i6 O02.Appeals must be filed in writing together with the required $75.00 application fee with: Healing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. (D PUBLICATION DATE: December',2002 DATE OF(DECISION: November 26, 2002 SIGNATURES: C G 79e egg Zim a man, dministrator DATE / 7 6/o 2, Departme t Pla ping/Building/Public Works -;-4-4--- r Jir She herd,Adminig{r for DATE V / Community Services L t eler, e hie �� DI- DATE z^ D� Renton Fire Department dnsmsignature.doc 1 CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED MITIGATION MEASURES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. LOCATION OF PROPOSAL: City ROW in NE 10th St. to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE 116th St. MitigationI Measures 1. The applicant shall be required to adhere to the requirements of the City of Renton Aquifer Protection regulations including but not limited to regulation of hazardous materials; a fill source statement; and surface water management standards. Mitigation measures.doc r• 1,0 CITY OF RENTON DETERMINATION OF NON-SIGNIFICANCE- MITIGATED ADVISORY NOTES APPLICATION NO(S): LUA-02-119, ECF APPLICANT: City of Renton Surface Water Utility PROJECT NAME: Detention Pond and Stormwater System Improvements DESCRIPTION OF PROPOSAL: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. LOCATION OF PROPOSAL: 'City ROW in NE 10th St. to NE 11th St., Anacortes Ave. NE, King County ROW & pond site at 13610 SE 116th St. Advisory Notes to Applicant: The following notes are supplemental information provided in conjunction with the environmental determination. Because these notes are provided as information only, they are not subject to the appeal process for environmental determinations. Planning: 1. The wetlands found on site and off site must comply with all applicable King County regulations. 2. The applicant is to obtain applicable King County permits. Plan Review-General: 1. This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. 2. System Development Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were calculated. If connection is made then code required fees would apply. Plan Review-Water: 1. The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level is approximately 68 psi. Plan Review-Sewer: 1. An 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer service outside the City limits of Renton. Plan Review-Storm: 1. There are existing constructed storm water facilities along the frontage of SE 116th street. advisory notes.doc 1 ENVIRONMENTAL REVIEW COMMITTEE MEETING NOTICE CONSENT AGENDA NOVEMBER 26, 2002 To: Gregg Zimmerman, Planning/Building/Public Works Administrator Jim Shepherd, Community Services Administrator Lee Wheeler, Fire Chief From: Jennifer Henning, Development Planning Meeting Date:, Tuesday, November 26, 2002 'Time: 9:00 AM Location: Sixth Floor Conference Room #620 Agenda listed below. PLEASE NOTE: THIS IS A CONSENT AGENDA, THERE WILL BE NO MEETING Honeybrooke Phase 4 Short Plat (Jordan) L UA-02-110,ECF, SHPL-H The applicant is requesting Environmental (SEPA) Review and Hearing Examiner Short Plat Approval for an 8-lot subdivision of a 2.17-acre site. The residential plat would create lots intended for the construction of detached single family homes—ranging in lot size from 7,200 square feet to 12,389 square feet. The subject site contains areas designated as Category 2 wetlands,which are located on the northeastern portion of the property. As part of this development proposal, the applicant has requested to use wetland buffer averaging in order to reduce the required 50-foot wide buffer to 25 feet,which would result in a larger side and rear yard area for proposed Lot 1. The site also contains an existing 1,700 square foot single family residence,which is proposed to remain on new Lot 7. Two other detached non- residential structures (garage&shed)would be removed or demolished as part of this proposal. Location: 5318 NE 4t Street. Detention Pond& Stormwater System Improvements (Fiala) LUA-02-119, ECF The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Class 3 wetland (King;County Classification) is located on the,detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Location: City ROW in NE 10th St. to NE 11th St.,Anacortes Ave. NE, King County ROW &pond site at 13610 SE 116th St. cc: J.Tanner;Mayor J.Covington,Chief Administrative Officer S.Carlson,EDNSP Administrator ® A Pietsch,EDNSP Director® J.Gray,Fire Prevention N.Watts,F P/B/PW Development Services Director ® F.Kaufman,Hearing Examiner L.Rude,Fire Prevention ® J.Medzegian,Council S.Meyer,P/B/PW Transportation Systems Director R.Lind,Economic Development L.Warren,City Attorney ® STAFF City of Renton REPORT Department of Planning/Building/Public Works ENVIRONMENTAL REVIEW COMMITTEE A. BACKGROUND ERC MEETING DATE: November 26, 2002 Project Name: Detention Pond and Stormwater System Improvements Project Number: LUA 02-119, ECF Applicant: City of Renton Surface Water Utility Contact: Daniel Carey, Surface Water Utility Project Manager City of Renton, 1055 South Grady Way 98055 Project Manager: Susan Fiala, AICP Project Description: The Water Utility Division of the City of Renton is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street. The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Class 3 wetland (King County Classification) is located on the detention pond site and a Class 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. Project Location: City ROW in NE 10th St. to NE 11th St., Anacortes Ave. NE, King County ROW & pond site at 13610 SE 116th St. Exist. Bldg. Area gsf: NA ' Site Area: Pond area - 49,036 sq. ft. N-E Suns B a `L Storm System Improvements I NORTH City of RENTON KING County l INEI11tIt SLu tI - - - - - Z A ern nv 2 w r IZI Q � n ' 8 Detention and NE 10 P d° ,Property limi LAnerrotiv 1— Stone Sys em Im mo%em nts NE 10th St SE 116th St —LJ__1 1 DEi NEIGHBORHOOD DETAIL MAP 0 .300' ercr pl.doc NE 10 th ST/ANACORTES AVE NE N Scale 1'=300' DETENTION POND,STORM SYSTEM City of Renton P/B/PW Department Envin ital Review Committee Staff Report DETENTION POND/PIPE REPAIR LUA-02-119,ECF REPORT AND DECISION OF NOVEMBER 26,2002 Page 2 of 6 PROJECT DESCRIPTION(CONTINUED) The stormwater detention pond is located on a 1.12 acre parcel of undeveloped property located in King County and owned by the City of Renton. The detention pond will occupy about 110' x 270' feet (0.68 acres) of the site and will be about 6 feet deep. The existing stormwater system in SE 116th St., NE 10th St., and Anacortes Ave. NE will be replaced with a new system. The new system will connect from the new detention pond to part of the existing system in; Anacortes Ave. NE. depending on engineering design, the new system either will be constructed in NE 10th PL (Alternative 1), or up Anacortes Ave. NE and NE 11th St. (Alternative 2). At the end of each Alternative the new system will connect into the existing system. Project construction is proposed between May 1st and October 31st of 2003 and may extend into the Summer of 2004. Hours of construction are proposed to be Monday through Friday between 7:00 am and 5:00 p.m. A Traffic Control Plan is required to be filed with the city by the contractor to identify hauling routes and traffic control measures for the construction area. Several local streets in the construction area may be limited to one lane during construction. Local access and driveway access will be maintained, except when construction crosses a driveway. B. RECOMMENDATION Based on analysis of probable impacts from the proposal, staff recommend that the Responsible Officials make the following Environmental Determination: DETERMINATION OF DETERMINATION OF NON-SIGNIFICANCE NON- SIGNIFICANCE- MITIGATED. Issue DNS with 14 day Appeal Period. XX Issue DNS-M with 14 day Appeal Period. Issue DNS-M with 15 day Comment Period followed by a 14 day Appeal Period. C. MITIGATION MEASURES 1. The applicant shall be required to adhere to the requirements of the City of Renton Aquifer Protection regulations including but not limited to regulation of hazardous materials; a fill source statement; and surface water management standards. Advisory Notes to Applicant: The following notes are supplemental information provided in conjunction with the environmental determination. Because these notes are provided as information only, they are not subject to the appeal process for environmental determinations. ercrpt.doc City of Renton P/B/PW Department Enviro ,tal Review Committee Staff Report DETENTION POND/PIPE REPAIR LUA-02-119,ECF REPORT AND DECISION OF NOVEMBER 26,2002 Page 3 of 6 Planning: 1. The wetlands found on site and off site must comply with all applicable King County regulations. 2. The applicant is to obtain applicable King County permits. Plan Review-General: 1. This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. 2. System Development Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were calculated. If connection is made then code required fees would apply. Plan Review-Water: 1. The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level is approximately 68 psi. Plan Review-Sewer: 1. An 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer service outside the City limits of Renton. Plan Review-Storm: 1. There are existing constructed storm water facilities along the frontage of SE 116th street. D. ENVIRONMENTAL IMPACTS In compliance with RCW 43.21 C. 240, the following project environmental review addresses only those project impacts that are not adequately addressed under existing development standards and environmental regulations. 1. Earth Impacts: Excavation to construct the proposed utility trenches could result in erosion. About 6,000 to 9,000 cubic yards of soil may be excavated to form the detention pond and is proposed to be transported offsite (see further discussion in Transportation section). Additionally, 1,200 to 1,800 cubic yards of soil may be placed as backfill (imported) for the new/replacement stormwater lines. The imported backfill will be supplied via the contractor from licensed gravel pits for the stormwater line trenches. The applicant indicates that one to three of the large maple trees located in the southeast corner of the detention pond site may be removed depending on the extent of the pond excavation. Several other trees may be removed to repair the system in the Whitman Court area. On the detention pond site, the majority of the vegetation will be removed for construction of the pond (includes grass, shrubs and blackberries). All wetland plants in the Class 3 wetland are proposed to be removed. All disturbed areas not used for the pond, access road and associated features are proposed to be seeded with native grass for long-term erosion control. Shrubs will be planted along the west and south perimeter of the pond property. The site for the detention pond slopes downward from east to west at approximately a 12% grade. The site will be graded to form the detention pond. According to the Soil Survey of King County Area, the dominant soil on the property is Alderwood gravelly sandy loam and Arents-Alderwood Material. The applicant proposes to utilize measures to minimize potential erosion impacts (storm drain inlet protection, silt fences, hydroseeding and replanting) per the King County Surface Water Manual. Soil stockpiles not in use will be covered during rainy periods. It appears the applicant will utilize measures to reduce potential erosion impacts to the site; therefore, no further mitigation measures are recommended. Mitigation Measures: No further mitigation is recommended. ercrpt.doc City of Renton P/B/PW Department Envirc nal Review Committee Staff Report DETENTION POND/PIPE REPAIR L UA-02-119,ECF REPORT AND DECISION OF NOVEMBER 26,2002 Page 4 of 6 Policy Nexus: N/A 2. Air Impacts: A large quantity of earth will be excavated, moved and removed during the construction process. The applicant indicates that if dust conditions develop, the contractor would use a water truck to reduce blowing dust. Dust and exhaust from construction equipment will occur during the project. Maintenance activities will cause temporary emissions from construction equipment. The applicant has indicated the contractor will ensure emissions are kept to a minimum by maintaining truck and construction equipment mufflers and exhaust systems. Mitigation Measures: No further mitigation is recommended. Policy Nexus: N/A 3. Wetlands/Surface Water Impacts: A Wetland Delineation and Classification Report, prepared by CH2MHILL and dated October 2001, was submitted with the land use application. Two wetlands were identified; one on the detention pond site and one off site (located north of the detention pond) in King County. The wetland located on the proposed detention pond site is a Class 3 wetland according to King County classifications. It is 3,070 square feet in size and is hydrologically isolated as identified in the Wetland Report. The off-site wetland has been determined to be a Class 2 wetland and is required to have a 50 foot buffer, which the applicant is. proposing. The Class 3 wetland located within the proposed detention pond, according to King County code 21A.24.330.H.2., may be used for a detention facility if the following criteria is met: a) a public agency and utility exception is granted pursuant to K.C.C. 21 A.24.070; b) all requirements of the Surface Water Design Manual are met; c) the use will not alter the rating or the factors used in rating the wetland; d) the proposal is in compliance with the latest adopted findings of the Puget Sound Wetlands Research Project; and e) there are no significant impacts to the wetland. The Class 3 wetland has been described as isolated with low biological support. The applicant sent the Army Corps of Engineers a copy of the Wetland report to request a determination of the regulation of the onsite wetland. On October 8, 2002, the Corps issued a determination stating that the onsite wetland was isolated, was not under Corps regulatory jurisdiction and would not need a Corps permit for the proposed work. Construction is proposed within 200 feet of the Class 2 wetland (King County Classification) located north of the detention pond property. The wetland buffer area (50 feet) on the detention pond property will need to be crossed by construction equipment during construction. Silt fencing is proposed to help protect the offsite wetland. After construction, the existing vegetation will be removed from the buffer area and will be replanted with native vegetation. It appears the applicant proposes to utilize measures to reduce potential impacts to the wetlands; therefore, ho further mitigation measures are recommended. The wetlands will be required to be protected according to King County Wetland Development Standards (i.e. buffer, permitted alterations, permits/exemptions). Mitigation Measures: No further mitigation is recommended. Policy Nexus: N/A ercrpt.doc City of Renton P/B/PW Department Envin ntal Review Committee Staff Report DETENTION POND/PIPE REPAIR LUA-02-119,ECF REPORT AND DECISION OF NOVEMBER 26,2002 Page 5 of 6 4. Storm Water Impacts: Stormwater runoff into the new detention pond will come from the existing system in SE 116th St., which serves the areas east of the pond. Those areas include open fields, single-family residences, and City and County rights-of-way. Discharge from the new pond will go into the existing system in SE 116th St./NE 10th St. where stormwater currently goes. The existing system runs about 1700 feet to the north in NE 11th PL and Whitman CT, and eventually connects to a culvert in Whitman CT that Honey Creek flows into. Honey Creek flows into May Creek, which flows to Lake Washington. The total amount of stormwater flowing from the detention pond to the existing system is not expected to change. The detention pond is designed to reduce the duration of the peak flow rates from the 2-, 10-, and 25-year storm events by storing part of the runoff water and discharging it at a slower rate. Computer flow modeling predicts that the pond and pipe improvements will reduce the duration of flooding in NE 10th St. from 11 hours to 0 hours for the 25-year, 24-hour storm event. The applicant indicates that the frequency and severity of flooding in City streets is expected to decrease with the detention pond in service. The detention pond is not expected to create new storm water impacts. The detention pond will probably help reduce the amount of sediment in the stormwater runoff. The outflow system in the pond will include down turned elbows that act as an oil/water separator. The pond may help contain liquid spills in the street and aid in cleanup before a spill reached Honey Creek. The proposed project's objective is to reduce the impacts of storm water (flooding) in streets and homes which mitigates potential impacts. Mitigation Measures: No further mitigation is recommended. Policy Nexus: N/A 5. Ground Water Impacts: According to the applicant, there is a shallow groundwater table, approximately 4 to 10 feet below the ground surface and perched on glacial till. There is also a deeper groundwater table located 30 feet below the ground surface. Depending on the time of year and the groundwater table, a small amount of groundwater may drain into the detention pond but is not anticipated to adversely affect the capacity or'function of the detention pond. The site is located in an Aquifer recharge area that would be designated as Aquifer Protection Area (APA) Zone 2 if it fell within the jurisdictional boundary of the City of Renton. Staff recommends that the site be subject to additional requirements of the APA Zone 2, per City code to mitigate any potential impacts to the aquifer. Some of those requirements include: Construct secondary containment may be required if more than 20 gallons of regulated hazardous materials will be present at the new facility (RMC 4-3-050H2d(i)). A fill source statement (RMC 4-4-060L4) is required if more than 100 cubic yards of fill material will be imported to the project site. Construction Activity Standards (RMC 4-4-03007) shall be followed if ;during construction, more than 20 gallons of hazardous materials will be stored on site or vehicles will be fueled on site. Surface Water Management Standards (RMC 4-6-030E2 and 3)-- Biofilters, stormwater conveyance, and water quality ponds may require a groundwater protection liner. Impervious surfaces shall be provided for areas subject to vehicular use or storage of chemicals. This is not intended to be a complete list of the APA requirements nor does this information substitute for the full ordinance, it is only intended to guide the applicant to the City of Renton code book. Mitigation Measures: The applicant shall be required to adhere to the requirements of the City of Renton Aquifer Protection regulations including but not limited to regulation of hazardous materials; a fill source statement; and surface water management standards. ercrpt.doc City of Renton P/B/PW Department Envin rital Review Committee Staff Report DETENTION POND/PIPE REPAIR L UA-02-119,ECF REPORT AND DECISION OF NOVEMBER 26,2002 Page 6 of 6 Policy Nexus: SEPA Environmental Regulations; City of Renton Critical Area Regulations: RMC 4-3-050 Aquifer Protection. 5. Transportation Impacts: The proposal would require the export of 6,000 to 9,000 cubic yards of material and import of approximately 1,200 to 1,800 cubic yards of backfill. Soil import and export would occur via trucks. Provided that separate trips account for export and import, it has been estimated that up to 1,080 dump truck loads of 10 cubic yards each, or an average of 45 truck trips per week could occur during the construction process from May through October (if completed during one year). Several residents have indicated their support of the project but are concerned about the construction work, specifically material and fuel delivery and notice of street closures. A Construction Mitigation description outlining the proposed hauling and transportation routes was submitted with the land use application. Several streets may be reduced to one lane during construction. Access to local driveways would be maintained, except when construction needs to cross the driveway. Renton Municipal Code requires an approved construction mitigation plan including haul routes and hours and a traffic control plan to be filed prior to the issuance of a construction permit. Mitigation Measures: No further mitigation is recommended. Policy Nexus: N/A E. COMMENTS OF REVIEWING DEPARTMENTS The proposal has been circulated to City Departmental / Divisional Reviewers for their review. Where applicable, these comments have been incorporated into the text of this report as Mitigation Measures and/or Notes to Applicant. X Copies of all Review Comments are contained in the Official File. Copies of all Review Comments are attached to this report. Environmental Determination Appeal Process: Appeals of the environmental determination must be filed in writing on or before 5:00 PM December 16, 2002. Appeals must be filed in writing together with the required $75.00 application fee with: Hearing Examiner, City of Renton, 1055 South Grady Way, Renton, WA 98055. Appeals to the Examiner are governed by City of Renton Municipal Code Section 4-8-110. Additional information regarding the appeal process may be obtained from the Renton City Clerk's Office, (425)-430-6510. ercrpt.doc • • . • f ! : co I ,• ! -i. 14 i I — 1 L j r, ,,,- =,----, ; co , ,..., • _ • , iil L. MI 1 . , .. ,... , • ..,, .„ ______,.:„.„.._____,„,___„„0, , , ,_ _..J Mili (ri ! •! I 1- ! .1-----11-U-111. ! ,_,,_, Tp( 1 1 L fly i i I -2 .1 il . 7\ I _ REPLACEMENT .4, ! ! NE 1 2TH ST I L -1- 1. P' _._ .1_ ul 1 i-- I i I 1:,/ • . . 0 ,,,!0 , , a , , , , , , }---"-----, , .------0,- ki ign I I Li=L • ! i 1 CITY OF RENTON _., \.. 1 1 . 10 . 111 i --0 EXISTING CITY OF RENTON ' KING COUNTY _ 15,1.1-- •-i IF---0=uir-----10 -11 STORMWATER LINE i ! I - ! i • I • 4! . r- 11=11= -. .7 !- - --,,-,_L_, ,_, J0: 0 I : D LGOND i NE 1 1 TH CT 3=- • , • • , r,REPCEMENT ,. . III--i-- REPLCMT STORM SYSTEM . 0 1 i ! . i I 0- 1-- ALTERNATIVE ROUTE i • 1:, 1 1 i : i i i i i i .i zi I ki-il i k•v: ,. \ --------• - --- - 1 1_.__ ____0 '21 EX STORM SYSTE0 _.4 ni\...____i i m,,. ,17).7. 440 A D,ri,mii , i I .1.mrdomegi,., , LI t= T ,-.11,„„,. .- i ! , , = , , il k4....11017.117,. --ti-----------*----"-'... oCiiilin , , .,. 45—..,.. •'v _,- i ,..-------':---T-i .- ) 1 o .---•, . 1 IP' . 1111.411/0 ' III.,----' ..; , , ,_ 4- --r i i.. - tilrIN C• .4).Fl-----i I I 'ALTE. .. IFIE- _, I-----..71-----.1 '' .5' .' .1. .,.....a-L-m-..4E,,,A_Fr.i.R..,„TER ph, 1..o-----& • KING COUNTY i rij 0 1 i i i %. i i r—Fli'A.. / ../ ).:--H‘ I 111ii:-.41)' i ' or iso • -1111 . " .. f--- I . I 44-1-t---la .ill ._.-_--,. i•i 1 n I , , , , , ,.. -., , ,_I . __, ,Q,, -,. , ./.•,-,, , Is,_,.4..., i. 0 ' - ,.....,i i .. • &--. i ' ' .' .1 me vik&E-•--' In ...:'--0------------ -1 i L--' j (/) ! i 1 ....., 1 i 1 i r—A-1 H I I I 1 i ID ¢i , i 1 -----i ,--- -,r-..- , i r_'... _..4 1-----!•'whik , ido .-..1k.iiktda-?1=j L Is-..-ELk IS silt/ ,vf.7. i I i ..■ PROPOSED.1 - 1 =! 1.-! i 1 ! ! ! ! - - - e4)/IfIrir '-,, \' . DETENTION POND i I I i CO i rn 1 I r'•.,.‘ -IT. 1 -1 1 r. .C.,)' R CH iiinTi Or- . 1 . ..T. - i ----L"...TE..,,j•71:Jadrij7f iial.i.,/. mr.,..__.s.L2.,..,_,..- '11 i `.."..."'"I'L .i •- 1 i i i•-.-1_..-..__L.___.. r_ 4_ ..4.._._.1 i!,iireJ! i rri--1 i .---1......+-H---F-±---sieigat.Tral- . !-- •-:-'7=:-7--- '..P AV.. I 1 a . Ica I 1 i 111111 1 ! j 1 11111 1 1 i i 1 1 i.. p4ill___I . ! -qmi dirt]ilrEff i MI i ME aim or ! a4,, u i v i i i , i ---i i i ---1---. ----i- --i-----j-..„ L.-1. -I • ILI- '1.---i-.4.14_-i_-131,---i L.... _j_IN , 7.:- •__.-__ ' SE 116TH ST 1 i ii 2 : i,__,1i iii T 141-1 i - r: , • -1 7 iii; i ._.._. c i 0 1 Ii.__ ._.._._ . 0 p. __e i 1 i 1 1 1 gm 1 4;IIIIIi 1 ! ! Uri up . I I r-i.. . 11 TEM LINE I.- ' i : I i IIII In SO• II I El . q-'i:----i : !! i__,) i i i-• i lie i --,.-FI- -1_ ' • ci) i _._..J!! ! i irc-N- ), i .. i 111 A., . i 1-17 il isi a _ ___A i ! i . . , i . i 1-,-.! H i _, _4 I i ! i I 1 IC‘L'Cri 1-11-171-Ell 1+-c-- !t`' 11- 11-4-H-L- ! i NE 10TH ST/ANACORTES AVE.NE no/03/o2 1 ..''''''''"u --7A.S . "....'- '7''' ala CITY OF '''"O.D.Frr ' lik iii‘ RENTON DETENTION POND AND .....- ,..., STORM SYSTEM IMPROVEMENT PROJECT !!!!... I .7.7- I EMI' Flartning/Building/P.Glic Works DepL 1 1 NO. REVISION EP( DATE APPR ..... e...7= Ill SEPA SITE PLAN ... ,.3 D—2 2 6 610 1 • a) = .... ,..5-,;•:' M..".:A .11.'.. IniiitimM ..._. ------- low _:. im , , w .... Y/ 7 .... _,....__ ..., ot, n LbJJ5 . n, i.1011 N —. u i ima ' am;/ REP�LACEYENT-T•RYWAIERLINE ; ' i h P •— REPLCMT, TORM SYSTEM ;� I�I I I - I PI 1 0- - ALTERNATIVE ROUTE' l I �— — 1.... \ I I -_ 0 "�° EX STORM SYSTEM I . '/ N. -I— — �-- — - I J 11111 l'a.CITY OF KING COUNTYI ";:;"°x .�....�< I \. j REPLACEY ENT STORYTOATER ' x �; , 'EN ON L. — — L— I I� , �- • i �. ..... i H-- -- iir . , I -1 i L--------- --- T - - ' , �I�- STORYWAI �I� BOl ..—_.- I II— I 1 1 2,....V t WETLAND CATEGORY2� NOTE-GRYOF RENTON i i - - ^ ""; I WETLAND CATEGORY;] 2, I \ ' '1I�■,I V/ 1 IKo EQUIVALENT TO KING COUNTY CLASS 3 , I I WETLAND BUFFER -11 —\ 50 FEET I ( .. Isy 1'� REPLANT WITH I I I I NATNE VEGETAT_� , ALTERNATWE2 1 i PROPERTYLINEPROPERTY LINEIALTATIVEI I , '1 IO P L REPIACEYENT8TPRYW TERLNE ' y1y WEST,6�FEET 297FEETNORTHSOUTH f ` _ w__--__.._ '— � �I' L ,��z aira r r PROPOSED — 'Inmg gr"." . � .����•A �'%.` •, — . � �'� �1�,��� DETENTION PONp EX18TIN� 1.111 ' Appa.270'.if0' --- --—-' -- I -- f=. _/ , �1!�. �� 1 I�I � 0 CaWCDY APp..,.5_2.GaNt i • STORYWATER 4NE , • y //`eliali 'I I tliRs3706YwAre�u �� _ PON'RIM I�li �� CITY OWNED PROPER*i J ; I_ I ; JII I�- _ App. = U2 ,I t; •�I ��� , IIIII� .` AROUND CHAIN LINK FENCE 1111 / - AROUND ENTIRE PROPERTY - I I i / PUNIINO STIUP AIONa r I -._-._-..--. -..-_.. / wE9TAND SOOhl16DE8 I f IN CONSTRUCTION TION AREA 1— �/ 1 INCUDING BLACKBERRIES, CN AREA 0 7y(/ INCLUDING BLACKBERRIES,SHRUBS IQ • -. �� � 0 4 — �_--" _ UNOFF DITCH H UBS � D CATEGOR R I I• I I I i I REPLACEMENT TORMWATER LINE :11I pp I LESSTHAN S,000 SF j 17 I I .�8. _ - --- 1, DETERMWEDI$OuiEO.Y�TLAND_a I`1 I I I p.-,. I�� 1 II CO PS OF ENGINEERS I I EXISTING STORMWATER LINE I I I� I / .no..,'o'"' I __-_-_ — KEEP IN SER 1 CE ' ' I I1 I 1 1 II - i ' 'I J //I Y PRIMARY INLET I i TO POND i N E ; 10 T H; , GDI�T(iDL'STRDGTURE J REMOVE T S E 1 1 6 T H S T ISTOR' N� I Oi LET FROY POND Y, �/ , I IIF NEEDED) 'tom-- ---�-- _���_� , _-- 11 -� NEWSOEWALK bl ^y"�J//'� ABANDON SIDENTIAL'SEPTIC TANK .-�I i'—.� - I �� —__� r -- ! _.. „Qy31 A 0 yl /CONNECT T ITARY.e ER MAIN n �T MA w.. •,.n . •.. �.. .. +—!_j ��"�.�•• ••••:.vim. J., A 7.1+,���[6e • - --—_ �- _ -- lino _ = IIH 1 .`.•L.` _ _ _ mis I t=z .� - / . ,i ����iGa�W.---.,. � — � NSF. •rz __�.__ _ t__ __ __ _ —._ _ - - , �a �—'1 EXISTING WALE �_ _..__.. T 1 EXISTING --- I!. __—__—I- r STORMWATER L1NEl •KJN..���G,W08 ` �AT ._. T-------- ,'n; ---' -- - . - . 1 �AP318T CHURCH REPUCEMENT STORMWA ERLNE s " . NO•TOR/IWATEAJJ E -� , ,STORNWATER LINE I I :7 I , I ,/ K )j/^_ I -� u mA.sr... �'=' A NE 1OTH ST/ANACORTES AVE.NE 10/le/ox N CITY OF DETENTION POND AND �uwn ` RENTON STORM SYSTEM IMPROVEMENT PROJECT _ ® 1 •w '® Pbnning/BuiN,ng/Pubhc Works OWL e2 NO. NEVISWN BY DN,>; APPR -- e_e SEPA DETENTION POND ,,,2 r.7 D-2266 N ^ / %.i ......... . . . ;"si. y4.p'af-i..-: ,‘:../...... 1 cY r . ., ______- • I _____[ O I N iv,-- _ -. HONEY CR EEN j I III I I :rtf... 1 :kti °_ I ,l f!' ABANDONED CULVERT I\ REMOVE EX PIPE AND PIPE I dl , INSTAW.NEWSTORMPIPE ANDCB'S y I CUT AND PLUG \�C/ EXISTING -- l. '� STORMWATERWE LEGEND VIA / ♦- REPLCMT STORM SYSTEM / h I Co— — ALTERNATIVE ROUTE ; 1 O "'SD EX STORM SYSTEM I j „ I I1 1 1 ' I 1 1 I ; I1�, 1 - , 0 40' ------------------ ----- r--/A-.. �—�..- 11 I I I - _, I ` --- e su-t_rz I L , / . --- i 1 - �; _-I CITY OF Fa NTON . ���� CI Y LIMITS 14 ,, ., ^ --ram � `-w I 1-J EXISTING ^ .STORMWATER LINE \ r/^ — I.— -1 i 5.4"Tr. — ..,r----F—L—F—L--1 —.43 Ell l REM(R7ED(18-STORM PIPE --•--- tr. . L7 INSTALL NEW.STORM PIPE AND GB'S I ' ,PO TIA ST RM oil REMOVE TREESF$)RCONSTRUCTIOwr------ --- p 1 / 1 ,1 I NE uCEM T ( 1 , --T-----T --�--- ---- - 2 / 1 • (N NEED ( , I I I i I � .— —_--_._ a I / \ I I I , •2I II .1 I I I I • I ;/\ \ �1„ �— ;1 1; '� 1E i� 111 I I�--11 rJ �i I 1 i�� .,� CITY OF 0//18/U2 101 mN,snO.o '��,�— A NE LOTH ST/ANACORTES AVE.NE d1N RENTON DETENTION POND AND i ®. STORM SYSTEM IMPROVEMENT PROJECT °� 1-,.�I �� PMnNng/BuilEing/P"'w°'"o.PL SEPA STORM MAINTENANCE 3 N. REVISION BY DATE IPPR — ese D-22661 , fir. ' co 1 1 L_-----j CV I _ —.-. + Aid j I I I I�..-' f. I 11 in^J II L I I I I CITY OWNED PROPERTY I -- , v: s NOTE-CITY OF RENTON ; a IWETLAND CATEGORY 2,3 I a z z I I '�-- — -. EQUIVALENT TO KING COUNTY CLASS 2,3 0�> 1 I ; "J # I 1.. t a 1 I \} J v �i a W4 T I n WI -,,J--- -----, .-- _ se, ',%3Q p „s.e. , • ' MZO 3 ) KING COU - f --- ..- 4 .J x _ SCALE:1INCH=20 FEET I 1,94 I d w -(V 415 l_;-'-�' 5 P ® ' �?` I� I n W II gi u ` ? o -�; �.. t u \u oi, rf/ m 1.., .., a o u .1' \m 01 v, ,\.A...,-.-,.A-,',-A--,-'-\_k_.------),, _ 'l. 0 1 I .:_i1iI -''' s,_, .1)! i UU ti - _. — p .._..__ ..4111—H:) I,•. Y: I CITY LIMITS — I — 1-- ETLAND CAT ORY 3 1 I _ I CITY dF RENTCN HA 5000SF M \ 1 ETERMINED ISOLATED TLAND z J __ V ii I BY ARMY CORPS OF E GINEERS / 11 \ I a'"" —A.sn°-° ='='"" n CITY OF NE 10TH ST/ANACORTES AVE.NE 10/I5/02 ^ DETENTION POND AND ,� RENTON STORM SYSTEM IMPROVEMENT PROJECT ....e NO. REVISION BY GATE APPX -o L® "'�"''°"'/"°"Works°`P`' SEPA WETLAND DELINEATION I 1 D-2266 ... . , - -- -, D6 - 123N R5E W 1/2 ., I a ---- ' ' - L. 7F14 R - t: C 1 ,---- _A R M----N----------- 1 ce 1, '.....ylsiE 11111th IstAz: I W ---1\--- 1 -( Cr) I i___c/11_._... !N\ ._J, IP _p-'5. • - (13 --1.---- -00,\ . -., Nx,1 ,/ \I\ - -0 I > -=0 R—8 ----\-- -..--1 . -1,-4.Igth .-im - L—--------_ .% •• ' IR-1,1__J 1 I ° --- - : cr, ; ---' NE 1cith St. - ---------- -------- , • , 3 I-.----------.i -- . _11 1._‘ 1---___(-•• --f-- - l'- ( 1 • . _R4.1 1 ---t . 1 ., 1 , - \ -- --.L.. X it*. 1••-. • ---1 iiiIr 1 l_j_ii...{..1. 11 •_Rij 8 , 1 [T --T. \ -- coo y w __t_LJ___, ., I 1 f i._. --t'-• '------1-..-1-C I -.00 I I C/D C 1-IIP ' SE 118th St. [ ri....__1_1.]....1 1 f__. , ---------_____. )th cc-- ... ----'d.--------------R-8-1 ' iri 6 6 -8 -.-4 _..______________ ,- -ci - Z t4--/-et-Tlig. .. 12Eaa --ri [-I— p=_, Z ii ?P 17-- ---- - ..---: ir SE 121st St. . •. --. , , / / ,--,.7,: 1 [ • ---—0 a 1 N •E\--,61 q--- \ (.1) —1'1- . z R M—I r I R HBLI ---- --" 1 i I 11111 , R—14 7' I -r-----711 Ea 77-7-/-1-71. ildI- -0-- , QS I - •.-_.:- -;,-----e --, - .---1 l'. - ' IMBLIT,-,7 es R TR-T.8. : •10- • i ..._NE., 5 1 h Sti lEIECI I= Ke\•\,.. i?:.:::: 1----- r-----.5 "‹r ------ --:1___ 11111111111E.2 ----1§7/271ir hiE i i .___ 1 1--.1 --- - C S 1 CS 1 1 CS lir _Ilig_ I-1 CS . - ---,- ---; r-- F-------- - 1________I ------ --St. ----• 1 (-NE 14th St 1 I R-lor-- 71 . ,_________:___. 1 , 1 i - , 1 , 6' 1 1---- -----'------ g . I 1 ----1-------1----,---r-f . 1 ,_..._ ___ -----1 L. 1 1 1 1 1 ..... r.T.,. 11 1 I - 11 1 , i! F6 • 15 T23N Ft5E W 1/2 limit0 724"1° • E6 ob. zom.G Renton Chy + P/B/PW TECHNICAL SERVICES 10 T23N R5E W 1/2 i'.4.. 0 03/15/02 iriq 5310 ZONING MAP BOOK :41raiaiii :K!ifida 1 AI. effr*:::':.'' igi 9 IL 1 Mt athIPL111,11 459 W2E-w, 7.. ±-14111 -11pm MEN- ir---,__:i-i --it _ ----- / :':-: iNa Mi myr.4'LlIME• tifi Sir"":-: t Ill '' -'1 '6•N a 1?:1 igrn agi'w 7 Vggi IR m.4%, rim. II) l' 114 Ell j.ag ER iiir i Si WiVliji 'ID rneilklitirm0r-A-Z 61,7Tingi!-.4.4pir%imui„_,Afg*: L. { • 41 „.....,.:. ._........_, --t----.--. /-,------------ ; '' - ,Awei iik:- -v4a1;.k t; 28 T24N ilk P\rli :.:::iiii iii iffC. 0.-------,ip.v.ammo .1 rimitiol-, i1/4----t 464• i ti*JK,K,K, tit WESKfrti:KiErin::. .-- di„--,WARN •,_, ,, 4 _,_, ,_ :• .. \re:11111 iir-K..-0:;:lk-. tZlitiggi•IIA A 1017,111211i f ' . ----- ' Wainii!iiiig a Wi.::--1-40 d VE::':aik :IlifkrA.041 F.1 f*'*''11*'L I, - 11.111EN SRUNed gaiieke/;2.__4- 1iNLVIIIII it: id6W2 '' gratNiiin:-:liataign iffifirc..-1.411,741agrAll. :.i;',0X ..,- ir'"NiEltuiel' - 1*rim . ,.w,..,.-.........::;.____lrrjir7.:_,7.,___._.._Ave . :ftalika.„......_ 15 •4N R5E 'lit:WHIN\• ' , Nf. iiimEek.06, Equip 14.% i il,.-401.10., iamitgimm NAP:IIIR1141W, . .,....:M E:Kt 11.911r Wil 1 011. AA.7)graTil I .*:ii:E:iX5 XxXX :::-?.- :K,Eri: iim ,,,,,,„1,,,L.:7 ii„.,:,„,:•„,:„„„,,ii, :,:„:,..,:,:i„„, „:„. ,..95w. ., -11411.1 I.11111 k.,:7',A"';'. :::;:Ei .4..7..........O. ' iiiifil ;9-filkiOrii?g-44E :::::2intillBriljliqr gin.oitilik611 .................... ;:jim!fit.' hiTrifillillt in1W.gigaig7tW /14's\ -7.0pririganii .- 7;6 - .72. iallikilli 4.I-E-417-11=NETE'P \ ii ' li' lirliMihatilm-1 nu ii , __-,romilt 114=1_,_, ,2. •. Al, :di tele'=j1111 iiii ii\---0-.011.4.si'-- . \ 454•11 au;4.0.!_.,Emiri, i 1 N -NI awl ilm IITP,d7•=::',. 9-\ " .1-:&.:---4I41,.1 - WI 4 kVI-III 0,M1,1 a Nut AlliNtil ii1 1 l! 111..1-0.i Ace Mg. E.Jig a_ III i N,Naamv.,„,„1,-,rocot-, v„,,,,,,,,.. rikfAii -61,Lim-1-- --.121 , el-_• .. . i lir ..,.._,I,..4.....i.„..._..,. ,,,,..r.,... .,.... ... a.amiriat --' [II'R5E •.4- 16 I-"'.1 ",, h, I pr. vaL._kin.44_siirivromptinp," :rpro sii -rromig-lis ol,4 zum , 0,wk..,0,,,o4u, , c ..... p . .1 i 1.12,4 , --. iiii, -.,-1 ,------11, 11,- Illi- ----,7fr „_kw--10,4"111. A - t• te,A,NP, te ----"1"*.-I-41P aijOi aim 011-11 E-4-V.4 C14 ..111' kri",1 il if-.'14'' ! %-ii,--wew NI..-1 - -=- n..,.. lei : Is 1 , f„ 1 0 '.liti. Sig 1 IMAAVISIPIth..: ellik +-- -1,"&giti: - ' 1 j - ......4„," ti,1-„,,, • -'1•Vg. farillttar - ''. -; fgAri4* l'ilii•%.... 1,, :;, / , , •.,..-----"fr -- I 'Ai- , '.4 i.di 0.0, •__-,'m • ,,itg,! ,g ' "' ' 16.A ii, *lb 411S ItAlizi\tqwAlktv.•bi,. it. 1,1=1.3ap, IN b=tit-Ili ---4'-'-fAlotit L ,....:,....,:„.,_ , i ,1 IT. 1'55 'ill. ' J'-' ni .._: 22 T23N'-=,1 " 23 T23N R5E ii 412 ' il i K, -! Intur IIMI-111;170101-6,--3riritz7, 821 -- - rli. I ----f""----,1 I. Frill ii - M 4411 - 0,-4-mite Mit,lkil , _ . re,A... -11111111.7 A 111 Mill '- !eM‘--I" Pr; Nirej.,',4i. . Mil ,AI Ism= 4=1 rff- . r ....t 4,01,evz ... ,A. ,' it•tahl. 14;, --- dittikii._ _ Tif337-71;4.11 • rnin41.1 kil 5:1 _. 011 ;4 i !Fp riflTi g 1 11 Ir_1 •%) 825!Wm,,,j .-.1,74 ,Vgn --lin BMUS : , _ II)) `• .i t i / ,,, r , IIII 1 f*A7-72j. \.._ F74,211111 •Jo 11.1; ow. „_,ff)gfok--„ . . ---m. "." i og i • ii, A . I .0 diiilr An( / C ile: 1 -,,, ,--__ - ,::il p ,.44,-",_ ,..,,-,.. r•3N'•-',EL, Et. 1 pi, Iii,W 1 I , it F .• pa/P.3N-' 1-.14a. r , . 35 T23N-4., --ATI 61 •-111 ! • '' .i 1 En inik EVII i 833 :INN • ,Il -----•----- ---1 r e 1 , immotri, N . ,._ , Ad ,.... :__.:„............,:......:...„..., II' L ti, ., . . ., ,m . IF ,10,-7, j -v.ir K:sti: :,... 2 T22N R5E ::iii?:-"z:i. UMIIIIIIIIIIIIMIIIIMMIMMwimmma.......-...r ........,7. ,-,SITIFNT741, '..'' .40T1.: rrrm gy„ t'l ,'. ;I" . 43 • May include Overlay Districts. See Appendix 1-1 Resource Conservation ' I UP'„Cen(er Neighborhood* maps. For additional regulations in Overlay 4! Districts, please see RMC 4-3. ET Residential 1 du/ao ,t I-I Center Suburban* TT Residential 5 du/ac il F-1 Center Downtown*' (P) Publicly owned I-I Residential it du/ac * Cal Center Office Residential Renton City Limits - a.3 Residential Manufactured Homes COMMFMAIL -.-.-.-Adjacent City Limits an Residential 10 du/ac '' I-I Commercial Arterial* ammo Book Pages Boundary an Residential 14 du/ac I-I Commercial Office* KROLL I RH-1 I Residential Multi-Family Infill 1-1 Convenience Commercial 1:11 Residential Multi-Family Neighborhood Center INDUSTRIAL PAGE# PAGE lee-C I Residential Multi-Family Suburban Center El Industrial - Heavy SECTROWNNIANGE I RM-U1 Residential Multi-Family Urban Center* nj Industrial - Medium INDEX 1 ii. 1 Industrial - Light , . .• . , .. City of Rom.:.✓.t Department of Planning/Building/Public ......s ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENT: l �t�tLO�'OFf T 10ESRENTOiV ct u��� COMMENTS DUE: NOVEMBER 13, APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30,2002 OCT 3 2002 APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 RECEIVED LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 116th St. SITE AREA: Pond Only—49, 036 sq.ft. BUILDING AREA(gross): N/A SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County,addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics _ Water Light/Glare Plants _ Recreation Land/Shoreline Use ' Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet B. POLICY-RELATED COMMENTS C. CODE-RELATED COMMENTS `> 217a2_ We have reviewed this lication with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where additio inf rm tion is needed to properly assess this proposal. 'r l?—©Z Signature of Dir r or Authorized Representative Date Routing Rev.10/93 • City of R. _1 Department of Planning/Building/Public ENVIRONMENTAL & DEVELOPMENT APPLICATION 'REVIEW SHEET REVIEWING DEPARTMENT:7r6N.—s COMMENTS DUE: NOVEMBER 13, 2002 APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30, 2002 APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 ' ..LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 116th St. SITE AREA: Pond Only—49, 036 sq.ft. I BUILDING AREA(gross): N/A SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information ' Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet B. POLICY-RELATED COMMENTS OCT 3 �® 2002 ‘D/AIG DiiuuN C. CODE-RELATED COMMENTS 1 %- / zaaZ We have reviewed this application with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas wheradditional information is needed to properly ass th' proposal. /i //%?vZ Signature of Direct'or Author•-ed Represe tive Date Routing Rev.10/93 City of Ra.:=a Department of Planning/Building/Public ENVIRONMENTALn & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENT:( • COMMENTS DUE: NOVEMBER 13, 200 c��nS rUicQ.S �rryorr+tNrory APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30,2002 E C E' t/E f) APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala OCT ; 3 PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 t2UlLuING LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 1 ir4b1§ON SITE AREA: Pond Only—49, 036 sq.ft. BUILDING AREA(gross): N/A • SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet B. POLICY-RELATED COMMENTS RETCEIVED C. CODE-RELATED COMMENTS OCT � `�� BUILDIN DIVISI231 • We have reviewed this ap ' tion with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where addition for tion is needed to properly assess this proposal. •2 ///3—a2 Signature of Director or Authorized Representative Date Routing Rev.10/93 _ R City of R&,,..,t Department of Planning/Building/Public ...,.;a ,,'.ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENTS4c.. /t!Z)�s�c COMMENTS DUE: NOVEMBER 13, 2QQ2Tr_F IV ED 11 `` APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30, 2002 APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala OCT • PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049• BUIt p�NG DIVISION •• • LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 116th St. 'SITE AREA: Pond Only—49, 036 sq.ft. I BUILDING AREA(gross): N/A ' SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g. Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare _Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet B. POLICY-RELATED COMMENTS t\1" C• C. CODE-RELATED COMMENTS • ,telf 2g 0 R._ We have reviewed this appli i n with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where additional inf rmati n ' needed to properly assess this proposal. mix 1((1-0Z Signature of Director or Authorized Representative Date Routing Rev.10/93 CITY OF RENTON MEMORANDUM Date: November 12, 2002 To: Susan Fiala 4 From: Mike Dotso. Subject:, Detention pond and pipe repair; LUA-02-119,ECF I have reviewed the subject Environmental and Development application. The following are my comments related to the environmental impacts, policy, and code-related comments: Please Note: This lot is outside of the City Limits of Renton. Therefore connection to City utilities and services, if any, may be subject to special conditions. Existing i Conditions: • WATER The site is served by City of Renton Water services. This site is located in the 565 Pressure Zone. The static pressure at street level is approximately 68 psi. This site is not located in the Aquifer Protection Area (APA) (However, it would be mapped as APA zone 2 if it was inside the City Limits). There is a hydrant available at the frontage of this site. SEWER A 8" sewer main exists in SE 116th Street. Connections to this line are subject to conditions for sewer service outside the City limits of Renton. STORM There are existing constructed storm water facilities along the frontage of SE 116th street. STREETS No curb, gutter or sidewalk improvements exist along the frontage of this site. CODE REQUIREMENTS Note: System Development Charges may be applicable if this project makes connection to City services. Because no connections were proposed in the project description or preliminary plans, no fees were calculated. If connection is made then code required fees would apply. WATER , No fees if not connecting to City Water. SANITARY SEWER No fees if not connecting to City Sewer. • • 1-I:1Division.s\Develop.serlDev&plan.ing\PROJECTS\02.119.susan\Plan Review GF.doc SURFACE WATER No fees; project is outside city limits. TRANSPORTATION No fees; project is outside city limits. RECOMMENDED CO ONS i Prior to any construction activities on the site, Temporary Erosion and Sedimentation Control (TESC) shall be installed and maintained to the satisfaction of the representative of the Develop nt Services Division for the duration of the project. . Install a silt fence along the downs eter of the area that is to be disturbed. The silt fence shall be in place before clearing and gra in 's-i sated, and shall be constructed in conformance with the specifications presented in of the in County Surface Water Design Manual. This will be required during the construction of both of -s' d on-site improvements. 3. The site is located in an Aquifer recharge area that would be designated as Aquifer Protection Area (APA) Zone 2 if it fell within the Jurisdictional boundary of Renton. It is therefore recommended that it be subject to the additional requirements for APA Zone 2, per City code. Some of those requirements include: Constructed secondary containment )* may be required if more than 20 gallons of regulated hazardous materials will be present at the new facility (RMC 4-3-050H2d(i)). A fill source statement (RMC 4-4-060L4) is required if ,; • more than 100 cubic yards of fill material will be imported to the project site. Construction Activity Standards (RMC 4-4-03007) shall be followed if during construction, more than 20 gallons of hazardous materials will be stored on site or vehicles will be fueled on site. Surface Water Management Standards (RMC 4-6-030E2 and 3)--Biofilters, stormwater \ / conveyance, and water quality ponds may require a groundwater protection liner. Impervious surfaces shall be provided for areas subject to vehicular use or storage of chemicals. This is not intended to be a complete list of the APA requirements nor does this information substitute for the full ordinance, it is only intended to guide the applicant to the City of Renton code book. fig► U H:\Division.s\Develop.ser\Dev&plan.ing\PROJECTS\02-119.susan\Plan Review GF.doc City of Rc.:-_.7 Department of Planning/Building/Public cs ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMEN COMMENTS DUE: NOVEMBER 13, 2002 APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: • • .v APPLICANT: Daniel Carey PROJECT MANA PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 116th St. SITE AREA: Pond Only—49,036 sq.ft. BUILDING AREA(gross): N/A SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water LightGlare Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet n \ B. POLICY-RELATED COMMENTS C. CODE-RELATED COMMENTS We have reviewed this application with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where additional information is needed to properly assess this proposal. O�r"01x I I- 12..-b2 Signature of Director or Authorized Representative Date Routing Rev.10/93 City of Rie Department of Planning/Building/Public DDT s ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENT: a,rLs COMMENTS DUE: NOVEMBER 13, 2002 APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30,2002 APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 LOCATION: Various: City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site at 13610 SE 116th St. SITE AREA: Pond Only—49,036 sq.ft. I BUILDING AREA(gross): N/A SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare Plants Recreation ' Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet t1S B. POLICY-RELATED COMMENTS t"2/''' C. CODE-RELATED COMMENTS \, /LIZ/A, 0/a_, Il7r)vf/rrpaCtC-tk f(./),‘.4 We have reviewed this,application with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where addlional information is n d to properly asse s this proposal. /30 Signature of Director or Authorized Representative Date Routing Rev.10/93 City of Rc....:11 Department of Planning/Building/Public ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENT: FC nti C Cl-0 . COMMENTS DUE: NOVEMBER 1 , -,olt;.0,r.n p 0 APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBER 30,2002 APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala OCT 3 1 2002 PROJECT TITLE: Detention Pond/Pipe Repair WORK ORDER NO: 77049 ECoNt. NElGrit3UHHU,,�; LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site -- .40 f.&' _._NNING SITE AREA: Pond Only—49, 036 sq.ft. BUILDING AREA(gross): N/A SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The detention pond will be located on City property located in King County,addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet B. POLICY-RELATED COMMENTS C. CODE-RELATED COMMENTS We have reviewed this application with particular attention to those areas in which we have expertise and have identified areas of probable impact or areas where additional information is needed to properly assess this proposal. Signature of Director or Authorized Representative Date Routing Rev.10/93 CITY OF RENTON ECONOMIC DEVELOPMENT NEIGHBORHOODS, AND STRATEGIC PLANNING MEMORANDUM DATE:, November 12,2002 TO: Susan Fiala FROM: Rebecda Lind STAFF CONTACT: Don Erickson SUBJECT: New Detention Pond/Pipe Enlargement&Repair, City ROW in NE 10th St. to NE 11th St.,Anacortes Avenue NE; LUA-02-119, ECF The applicant,Renton Storm Water Utility, is proposing to construct a stormwater detention pond on a 142 acre parcel of undeveloped property in King County that is owned by the City. The applicant has applied for permits in Renton and King County for this proposed action. As the project proponent, the City apparently is the lead agency under SEPA for both the construction within the city as well as that in King County. In addition to the new detention pond the existing stormwater system in SE 116t Street,NE 101 Street, and Anacortes Avenue NE will be replaced with a new system that will connect into the new detention pond. The intent of this project is to reduce the frequency and severity of flooding in NE 10th Street, Anacortes Avenue NE, and Anacortes Court NE. The subject site of the detention pond is within Renton's PAA and presumably would be annexed into the City with the next few years. The parcel the detention pond is sited on is designated Residential Single Family on the Renton Comprehensive Land Use Map and is zoned R-6 — Residential 6 du per acre in the County. Relevant City Comprehensive Plan Utility Policies: Policy U-13. Coordinate the extension of utility services with expected growth and development. Policy U-17. Timely and orderly extension of City provided utility services (water, sanitary sewer, surface water, solid waste) should be provided within the City's existing and future service areas to meet public health and safety requirements. Policy U-20. All development should be required to pay an equitable share of construction costs for improvements to utility systems for water, sanitary sewer and stormwater necessitated by that development. When utility improvements will provide a general public benefit, the City may contribute funds for the construction of improvements to utility systems to,support the public interest. Policy U-26. In the event of a threat to public health and safety, the City utilities may use utility resources to prevent or mitigate such threats. NE 10th St/Anacortes Avenue i. Detention Pond&Storm System Impro Project 2 11/12/02 Analysis: The subject work appears necessary to mitigate flooding along NE 10th Street, Anacortes Avenue NE, and Anacortes Court NE. Since this area was annexed into the City in 1962, it is unlikely that the same development standards that apply today applied back then. It appears that the proposed improvements will help mitigate a potential threat to the public health and safety (Policy U-26). Recommendation: Support the upgrading of the stormwater system in the vicinity of Whitman Court NE, Anacortes Avenue NE, and NE 10th Street, including the construction of larger stormwater pipes and a 0.68 stormwater detention pond on a parcel on the north side of SE 116th Street abutting the City. cc: Don Erickson Document2\d • ` City of Rci::.i.i Department of Planning/Building/Public :..,,.cs ENVIRONMENTAL & DEVELOPMENT APPLICATION REVIEW SHEET REVIEWING DEPARTMENT: �� re_ Pr 2 J2n t\0A COMMENTS DUE: NOVEMBER 1 2 , 2 _ „ 1 ll _ Vi LE i�` APPLICATION NO: LUA-02-119, ECF DATE CIRCULATED: OCTOBEF�I QlOJI 1; APPLICANT: Daniel Carey PROJECT MANAGER: Susan Fiala� I;I i Li PROJECT TITLE: :Detention Pond/Pipe Repair , WORK ORDER NO: 77049 ` J. OCT 3 0 2002 1 LU j LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave. NE, King County ROW &site.at 136ifLSEJ16th St. i CI t Y Ut- RENTON i SITE AREA: Pond Only-49,036 sq.ft. I BUILDING AREA(gross): N/A FIRE DEPAITRIFNT SUMMARY OF PROPOSAL:The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff,constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system. The.detention pond will be located on City property located in King County,addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County.The applicant is proposing two alternatives for pipe system locations in the right-of-ways.A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the proposed site. Both wetlands are regulated under the jurisdiction of King County. A. ENVIRONMENTAL IMPACT(e.g.Non-Code)COMMENTS Element of the Probable Probable More Element of the Probable Probable More Environment Minor Major Information Environment Minor Major Information Impacts Impacts Necessary Impacts Impacts Necessary Earth Housing Air Aesthetics Water Light/Glare Plants Recreation Land/Shoreline Use Utilities Animals Transportation Environmental Health Public Services Energy/ Historic/Cultural Natural Resources Preservation Airport Environment 10,000 Feet 14,000 Feet / J B. POLICY-RELATED COMMENTS C. CODE-RELATED COMMENTS 7 • .,. •• . X.,)a (�� (��0`Iasi ZGt t5 We have review:0 this application with particular attention to those areas in which we have expertise and have identified areas of probable impact or . areas where ad,' Tonal information i eded to properly assess this proposal. L%jjM ci i d j j d Signature o D'e`tor or Authorized R press- ative Date Routing Rev.10/93 LIST OF SURROUNDING PROPERTY OWNERS WITHIN 300-FEET OF THE SUBJECT SITE City of Renton Development Services Division 1055 South Grady Way, Renton, WA 98055 Phone: 425-430-7200 Fax: 425-430-7231 PROJECT NAME: NE 10th St 1 Anacortes Ave. NE Detention Pond . and Storm System Improvement Project APPLICATION NO: t--U-14 O2- ►1`'‘ The following is a list of property owners within 300 feet of the subject site. The Development Services Division will notify these individuals of the proposed development. NAME ADDRESS ASSESSOR'S PARCEL NUMBER See attached List of Property Owners O, 0 9 0�G �®0 0 222 H:File Sys\SWP-27-2266\01\1300\01\020710-Property Owners v10.doc 10/18/02 C Applicant Certification I, .Da i i e/ ar , hereby certify that the above list(s) of adjacent property (Print Name) owners and their addresses were obtained from: Title Company Records King County Assessors Records from City Technical Services Section Records Signed Date /o'z2- jP gS o%jk,A1'II ( licant) � I! •0 NOTARYY i p NOTARY ; i co: ATTESTED: Su scribed and sworn before me, a Notary Public, in and for;hs Sipa hP Nasilingtyn, residing at J huh, 7i JI 1'S)-/ . on the 21 day of 0 ir ,•.,,' .... DA �•.• ,,200a. Signed C - kh� /L 4ttmav WAS. , a®®0®e (Notary Publ. ) ****For City of Renton Use**** CERTIFICATION OF MAI �- WOE`6z 9Nnr I, d 2Q D13,4t 3 &i )iereby certify that notices of the pr•,•accAstassmwoo ry �ed to (City Employee) � ^'�t�'.1.'� M each listed pro erty owner on a4. 53 2.00Z 0Il9nd A VION A039014 NA1IH lIN Signed ` Date: /vJvc NOTARY ATTEST: Subscribed and sworn before me, a Notary Public, in and for the State of Washington residing at` R ,n-tb-,n on the )5,_' day of---n ,20 tY1,. Signed � )� a /I-et -i.c/Lef MARILYN KAMCHEFF MY APPOINTMENT EXPIRES:6-29-03 H:File Sys\SWP-27-2266\01\1300\01\020710-Property Owners v10.doc 10/18/02 2 NE 10th St./Anacortc =.NE Detention Pond and Storm System I . vement Project Property owners within 300 feet. Page 1 of 9 Name Address Assessor's Parcel Number AMIEN GUSTAVO 961 ANACORTES AV NE 102305941704 RENTON WA 98059 BALYEAT CHRISTINE 18724 SE 43RD ST 102305910808 ISSAQUAH WA 98027 BAUMANN JOHN N 4325 NE 11TH ST 345040019001 RENTON WA 98059 BEALE DOROTHY 4325 NE SUNSET BL 32305905500 RENTON WA 98059 BERGSMA JUDY 956 ANACORTES CT NE 345041007005 RENTON WA 98056 BOUN PHANNY 19617 12TH AV W 102305913901 LYNNWOOD WA 98036 BOWMAN SHELLY L+GOODE 1058 ANACORTES CT NE 345040027004 VICTO RENTON WA 98059 BOYDSTON DONALD J+MARJORIE 4313 NE 10TH ST 345041001008 RENTON WA 98056 BREDA LIVING TRUST C/O BROWNE MGMT CO 102305900601 PO BOX 48005 SEATTLE WA 98148-0005 BREDA LIVING TRUST C/O BROWN MGMT CO 102305915203 PO BOX 48005 SEATTLE WA 98148-0005 BROCK JAMES K 950 BREMERTON CT NE 102305930202 RENTON WA 98055 4 BROWN CHRISTIAN P NASS TONYA M 556145003001 �e cn ecf—AclAress L,no,o-r) 950 ANACORTES AV NE ►tig/oa RENTON WA BUCHAN BROTHERS INV PROPS 2630 116TH AV NE#100 32305903703 BELLEVUE WA 98004 BUI VU PHONG&HIEP QUY 4233 NE 10TH PL 345040036005 RENTON WA 98059 BURNS KENNETH D+CAROLYN J 974 ANACORTES CT NE 345041010009 RENTON WA 98059 H:Fi1e Sys\SWP-27-2266\01\1300\O1\PID Names Addresses v 10.doc\DWC\tb NE 10th St./Anacorte .NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 2 of 9 Name Address Assessor's Parcel Number BURT JOSEPH+ELIZABETH J 4229 NE 10TH ST 102305917100 RENTON WA 98056 4 C R PROPERTIES LLC 400 108TH ST NE#600 32305928304 — (ithcake.e_ -t jot ver BELLEVUE WA ttf y/tip a-ct (es5eI 98004 CAMERON JAMES P 4216 10TH ST NE 345030034002 RENTON WA 98055 CARLSON WILLIAM H 967 ANACORTES CT NE 345041003004 RENTON WA 98059 CASCADE HEIGHTS INVESTORS 500 ELLIOTT SUITE A 102305930103 LLC SEATTLE WA 98119 CASCADE HEIGHTS INVESTORS 500 ELLIOTT SUITE A 345050000503 LLC SEATTLE WA 98119 CHAVEZ AMADO 1075 WHITMAN CT NE 345030022007 RENTON WA 98059 CHEVAOSOT VECHAYANT 11610 137TH AV SE 102305928800 RENTON WA 98056 CLAYTON ROBERT&DAWN 966 BREMERTON CT NE 102305929907 .\-*e4t rn 4a -S cle r RENTON WA <<(g` oa. 98056 CLAYTON ROBERT+DAWN 966 BREMERTON CT NE 345030030000 RENTON WA 98055 DALPAY PROPERTIES LLC PO BOX 2436 345041002006 RENTON WA 98056 DALRYMPLE JR WALTER+LYNN 4217 NE 10TH PL 345030033004 RENTON WA 98056 DELAURENTI MICHAEL F 19900 SE 125TH 345040024001 ISSAQUAH WA 98027 DWYER THOMAS N+LAURIE J 955 ANACORTES CT NE 345041005009 RENTON WA 98056 ELLINGSON DEE R 1059 ANACORTES CT NE 345040030008 RENTON WA 98056 Document3 NE 10th St./Anacorte NE Detention Pond and Storm System I-=, __,°vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number ERSKINE PATRICIA A 1066 ANACORTES AV NE 345040011008 RENTON WA 98055 FISHER SCOTT A+RENA J 4333 NE 10TH PL 345040041005 RENTON WA 98059 FISHER SCOTT E+CHAE K 4332 NE 10TH ST 345040043001 RENTON WA 98059 FUNG HELEN PUI-LING ET AL 4324 NE 9TH PL 556145020005 RENTON WA 98059 GONG ROBERT F 4208 NE 11TH ST 345030012008 RENTON WA 98059 GREER JASON C+JOYCE B 4324 NE 10TH ST 345040044009 RENTON WA 98059 HANNING ROBERT W 1067 WHITMAN CT NE 345030027006 RENTON WA 98059 HANSEN JOHN A 1108 ANACORTES AVE NE 3450400080 RENTON WA 98059 HANSON JOSEPH L+SHARON M 4113 NE 11TH ST 345030020001 RENTON WA 98059 HARSCH FRANKLIN D PO BOX 2344 345041004002 RENTON WA 98059 HARSCH PATTI J PO BOX 2344 345030028004 RENTON WA 98056 HAZEN MILDRED M 11235 137TH AVE SE 1023059107 RENTON WA 98059 HERO MR+MRS 4213 NE 10TH ST 102305924502 RENTON WA 98059 HESS JAMES A+CAROL M 968 ANACORTES CT NE 345041009001 RENTON WA 98059 HICKSON CHRISTOPHER 4225 NE 10TH ST 102305927109 RENTON WA 98059 Document3 • NE 10th St./Anacorte .NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number HINO TERRY N 1061 ANACORTES CT NE 345040029000 RENTON WA 98059 .4- HOFFMAN DENNIS E 4307 NE 10TH PL 345040038001 e4-krned-Acic\resse e UrikilO&n RENTON WA IWOQ. 98056 HORACIO'S INC 4201 NE SUNSET BL 32305904909 RENTON WA 98059 HORNE STEPHEN L 4333 NE 11TH ST 345040020009 RENTON WA 98059 HOSKOVICH JOSEPH A 4318 NE 9TH PL 556145019007 RENTON WA 98056 JENKINS PAUL H 4400 NE 11TH ST 3450400060 RENTON WA 98059 JOHANSEN HOLGER E 1016 ANACORTES AV NE 345040015009 RENTON WA 98059 JOHNSON DAVID S+PAULA D 965 ANACORTES AV NE 102305941605 RENTON WA 98059 JOHNSON G CRAIG+LANE 4332 NE 11TH ST 345040004003 VICTORIA L RENTON WA 98059 JOHNSON SCOTT R 4324 NE 10TH PL 345040026006 RENTON WA 98059 JORGENSEN MARY 0 2411 GARDEN CT N 1023059138 RENTON WA 98056 JORGENSEN MARY 0 2411 GARDEN CT N 102305907606 RENTON WA 98056 JUSTAD KARI E 4317 NE 11TH ST 345040018003 RENTON WA 98059 KEEGAN MR+MRS 1116 WHITMAN CT NE 345030014004 RENTON WA 98059 KEY R 1008 ANACORTES NE 345040016007 RENTON WA 98059 Document3 • NE 10th St./Anacorte_ NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number KIELGASS MICHAEL J 4325 NE 10TH PL 345040040007 RENTON WA 98055 KIHLMAN ROVERT C+SHERI L 11608 137TH AV SE 102305930509 RENTON WA 98959 KIM MIJO 4420 NE 10TH ST 102305915500 RENTON WA 98059 KINDER CARE LEARNING CENTER ATTN: TAX DEPARTMENT 32305904404 PO BOX 6760 PORTLAND OR 97228-6760 KING COUNTY 500 KC ADMIN BLDG 102305942405 500 4TH AV SEATTLE WA 98104-2337 KING MARTIN LUTHER JR MEMRL PO BOX 2145 102305921102 RENTON WA 98056 LACKIE MARK T+JANA C 962 ANACORTES CT NE 345041008003 RENTON WA 98056 LANE JAMIE A+BOBBI C 958 BREMERTON CT NE 102305922803 RENTON WA 98059 LILLYGREN TERESA A 4401 NE 11TH ST 345040021007 RENTON WA 98059 LONG GARY 11404 137TH AV SE 102305920203 RENTON WA 98059 M L KING JR BAPTISH CHURCH PO BOX 2145 102305907507 RENTON WA 98055 4 MARSHALL KENNETH W JR 11301 LAKE CITY WY 102305920005 • e,.A-Lm-r) l— A-cAdres5,ee (,(Aknoupr8EATTLE WA tl/,sfo a 98125 MARTIN LUTHER KING JR MEMORIAL BAPTIST CHURCH 102305916805 PO BOX 2145 RENTON WA 98055 MCDANIEL JILL A 4308 NE 10TH PL 345040031006 RENTON WA 98059 MEDGARD CALVIN&DENISE 12931 168TH AV SE 345040009002 RENTON WA 98059 Document3 NE 10th St./Anacorte. ._...NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number NASET C A 4332 NE 10TH PL 345040025008 RENTON WA 98055 NEWTON DENNIS M+BARBARA E 1024 ANACORTES AV NE 345040014002 RENTON WA 98056 NGO MINH&PHAN PHAN 962 ANACORTES AV NE 556145001005 RENTON WA 98059 NGUYEN DUC V+TUYET N HOANG 4316 NE 11TH ST 345040002007 RENTON WA 98059 NICHOLAS DEBORAH LEE 4225 NE 10TH PL 345040035007 RENTON WA 98059 PATTIE ROBERT DUANE 4316 NE 10TH 345040045006 RENTON WA 98055 PETERSON REBECCA L 4330 NE 9TH PL 556145021003 RENTON WA 98059 PHAN DONALD T+LEHANG N 957 ANACORTES AV NE 556145025004 RENTON WA 98059 PHU HOA DON+HUY DON 3710 NE 10TH LN 556145024007 RENTON WA 98056 PILLO LINDA 11622 137TH AV SE 102305911905 RENTON WA 98059 PORTA CONSTANCE J 920 ANACORTES AV NE 556145004009 \cl fYlqvea J L 44 Ko Foruzar nJ , RENTON WA l`�O et acgaQ 98059 PRESSLY WILLIAM D+PHYLLIS M 4301 NE 10TH PL 345040037003 RENTON WA , 98059 PUBLIC HOSPITAL DIST 1 VALLEY MEDICAL CENTER 102305900502 400 SOUTH 43RD ST RENTON WA RANDALL MONICA M 4324 NE 11TH ST 345040003005 RENTON WA 98059 RATTANANONGSY MANOPNOI J 4200 NE 11TH ST 345030011000 RENTON WA 98059 Document3 NE 10th St./Anacortc ';; '.NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number RAY DORIS+RICHARD 4224 NE 10TH ST 345040048000 RENTON WA 98059 RESOR ANDREW J 4232 NE 10TH PL 345040033002 RENTON WA 98055 RICHARD SHAWN+MELISSA ANN 4309 NE 11TH ST 345040017005 RENTON WA 98059 A_ RONGHOLT LLOYD A+KATHRYN C 11414 137TH AV SE 102305933206 "uokiiN Qar{ces deceased RENTON WA t�5/off 98059 4- ROWLEY T B 4209 NE 11TH ST 345030021009 nec1— Frc.9arcli/t5 RENTON WA "d4res5 '5K kreI 98059 SABIN PAUL O+MARLA C 4232 NE 10TH ST 345040047002 RENTON WA 98056 SANDOVAL RAUL T 1060 ANACORTES CT NE 345040028002 RENTON WA 98059 SHIMIZU YOSHIAKI B&AMY M 4308 NE 11TH 345040001009 RENTON WA 98056 SHIPLEY MICHAEL L 4340 NE 10TH ST • 345040042003 RENTON WA 98055 SISSON MATTHEW E 1067 ANACORTES AV NE 345040023003 RENTON WA 98059 SMITH JAMES A 1074 ANACORTES AV NE 345040010000 RENTON WA 98055 SMITH LE BARON V+BARBARA W 4111 NE 11TH ST 345030019003 RENTON WA 98055 SUCIU ELENA 1060 WHITMAN CT NE 345030025000 RENTON WA 98059 SUCIU ELENA 4224 NE 10TH PL 345040034000 RENTON WA 98059 SUMMERS BRIAN L+KIMBERLY R 950 ANACORTES CT NE 345041006007 RENTON WA 98059 Document3 NE 10th St./Anacortc NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number TERAO KATHLEEN S 1117 WHITMAN CT NE 345030013006 RENTON WA 98056 THAMI ABDERRAHMANE+MAURA 11425 137TH AV SE 102305913307 E RENTON WA 98056 THATPHAVONG SILEUAME 1068 WHITMAN CT NE 345030024003 RENTON WA 98059 THOMAS CHRLES B+PMELA M 4408 NE 11TH ST 3450400070 RENTON WA 98059 THOMPSON ALAN L+SUSAN M 4301 NE 11TH ST 345030023005 RENTON WA 98056 THONGPONH OUDOMSAP 4140 NE 11TH ST 345030010002 RENTON WA 98056 THORP CHARLES PHILIP 4300 NE 10TH PL 345040032004 RENTON WA 98056 TING ANTONIO+CHEN LAN-LAN 14625 JAYSTONE DR 102305920500 SILVER SPRING MD 20905 TSUCHIDA SATOSHI 4109 NE 11TH ST 345030018005 RENTON WA 98059 VALESKO ALBERT D&VIVIAN J 4317 NE 10TH PL 345040039009 RENTON WA 98059 VERFAILLIE TERESA 10026 BAYVIEW RD KPN 345030009004 VAUGHN WA 98394 VUONG BINH K+HA TAT 658 BLAINE AV NE 102305912903 RENTON WA 98056 WARREN G 1058 ANACORTES AV NE 345040012006 RENTON WA 98055 WEBER ROBERT E 1075 ANACORTES AV NE 345040022005 RENTON WA 98059 WEST CHESTER C+FREEMAN JEFF 1645 INTERLAKEN PL E 32305904800 SEATTLE WA 98112 Document3 - NE 10th St./Anacortc NE Detention Pond and Storm System I vement Project Property owners within 300 feet. Page 9 of 9 Name Address Assessor's Parcel Number WILLIAMS BRADLEY J 4208 NE 10TH PL 345030029002 RENTON WA 98059 WILLIAMSON DIVID A+TIFFANY 1059 WHITMAN CT NE 345030026008 RENTON WA 98059 WILLIAMSON RANDY+LISA S 1032 ANACORTES AV NE 345040013004 RENTON WA 98056 WITCHEY DALE E 4340 NE 11TH ST 3450400050 RENTON WA 98059 WOOD DENNIS F+KERRI A J 4401 NE 10TH ST 102305911004 RENTON WA 98055 ZAPINSKI DAVID 956 ANACORTES AV NE 556145002003 RENTON WA 98059 ZIMMERMAN HARRY F 4308 NE 10TH ST 345040046004 RENTON WA 98059 ZUKOVSKI EFIM+VALENTINA GOOBES IFTCH+SABINA 32305902408 4311 NE SUNSET BL RENTON WA Document3 • November 11 ,2002 Development Services Division 1055 South Grady Way Renton, WA 98055 Attention: Ms. Susan Fiaia • Subject: LUA-02-119, ECF Detention Pond and Pipe Repair. Ms. Fiaia, We support the proposed project. We do have concerns about the construction phase and maintenance of the detention pond. The contractor will be working in an residential area. The City of Renton must require the contractor to strictly follow Renton work rules. In addition we would like to have the following restrictions: A. Equipment and material delivery or removal during normal work hours only. B. Equipment maintenance and fuel delivery during normal work hours only. C. Ample notification if any driveway or street to be closed. D. A City of Renton phone number to call with question or concerns. After the detention pond is completed the City of Renton must have a mosquito control plan. A detention pond at NE 10th and Duvall Ave. has about six feet of standing water ever since it was completed. NinDEVELOP �QV C17yFR MoNINING Ro ert and Rose ar Key 100 Anacortes A yNE Rento , WA 98059 RECEIVED King County Department of Development and Environmental Services �FV 900 Oakesclale Avenue Southwest C1)' Renton,WA 98055-1219 I OFRE• NTpN��NG October 31, 2002 NM/ ® 20,2 Cev Jennifer Henning City of Renton, Principal Planner Development Services Division 1055 South Grady Way Renton, WA 98055 Re: SEPA Lead Agency Status City Storm System Improvement Project Dear Ms Henning: Thank you for your letter of October 24, 2002 concerning SEPA lead agency status for the referenced City of Renton storm water improvement project. I have discussed the City of Renton's request with King County's Department of Development and Environmental Services (DDES's) SEPA Responsible Official and in accordance with the SEPA rules covered under the Washington Administrative Code (WAC) it is appropriate for the city to assume the lead agency role. As stated in WAC 197-11-926 this is a public project that the city is initiating and therefore the city is lead agency for the required SEPA review. Furthermore, the City's use of its Development Services Division for the SEPA review conforms to part"C" of WAC 197-11-926 where agency people (Renton's Development Services Division)responsible for the SEPA review should be different then the agency people (Renton's Surface Water Utility)making the proposal. If you have any further questions on the SEPA lead agency status please call me at(206) 296-7157. Sincerely, Rich Hudson, Planner III, Current Planning Section, Land Use Services Division, DDES cc: Greg Borba, Supervisor, Current Planning Section, LUSD I / ,. Comments on the above application must be submitted In writing to Ma.Susan Fiala,Senior Planner,Development CI:NYTO Services Division,1055 South Grady Way,Renton,WA 98055,by 5:00 PM an November 13.2002. If you havequestions about this proposal,or wish to be made a party of record and receive additional notification by mail,contact the IProject Manager.Anyone who submits written comments will automatically become a party of record and will be notified of any decision on this project. • ' 1. CONTACT PERSON: SUSAN FIALA;(425)430.7382 NOTICE OF APPLICATION PLEASE INCLUDE THE PROJECT NUMBER WHEN CALLING FOR PROPER FILE IDENTIFICATION AND PROPOSED DETERMINATION OF NON-SIGNIFICANCE(DNS) . LII SunsetBh_ .' DATE: October 30,2002 • LAND USE NUMBER: LUA•02.119,ECF , MI NAME: Detention Pond/Pipe Repair ■ br Storm System PROJECT DESCRIPTION: The applicant is proposing improvements to the atormwater system to reduce the provartuomebn frequency end severity of flooding In the vicinity of NE 10th Street and Anacorlee Avenue NE.Improvements involve NORTH■' constructing a detention pond to store atormwater runoff,constructing a new stonnwater pipe system for the pond and repairs and upgrades to the existing system.The detention pond will be located on City property located In King County, � , addressed as 13610 SE 116th Street.The pipe system Improvements will occur in right-of-wayslocated in the City of ally of RENTON Renton and King County.The applicant Is proposing two alternatives for pipe system locations In the right-of-ways.A Category 3 wetland Is located on the detention pond site and a Category 2 wetland is located within 100 reel of the I ,�®�,,, proposed site.Both wetlands are regulated under the Jurisdiction of King County. ,''� PROJECT LOCATION: Various:City ROW In NE 100i St.to NE 110151.,Anacones Ave.NE,King County imt mi ROW&silo at 13610 SE 116°St. 811r:�Sa MIMI . OPTIONAL DETERMINATION OF NON-SIGNIFICANCE,MITIGATED(DNS-M): As the Lead Agency,the City of •• Renton has determined that significant environmental impacts are unlikely to result from the proposed project.Therefore, I ki '=; as permitted under me RCW 43 Comment 0,the City of Renton is using the Optional DNS-M process to give notice that a ' I�i�®�P'- atonu• •and DNS-M is likely to be issued. Comment periods for the project and the proposed DNS-M are Integrated into a single propery comment erlod. There will be no comment period followingthe Issuance of the Threshold Determination of Non- ———— I Significance Mitigated(DNS-MI.A 14day appeal period will follow the issuance of me DNS-M. I PERMIT APPLICATION DATE: October 24,2002 , I "cillai. - NOTICE OF COMPLETE APPLICATION: October 30,2002 .w I ®$RE■. II APPLICANT/PROJECT CONTACT PERSON: City of Renton Surfaceweter Utility I NE 10111 St SE 116th St Daniel Carey,Project Manager;(425)430-7293 I .■_ ._ 1.1 Il Permits/Review Requested: Environmental(SEPA)Review, NEIGHBORHOOD DETAIL MAP 1 0 300' I NE10th ST/ANACORTES AVE NE ITN Scale 1'=300' •Other Permits which may be required: City of Renton Construction Permit and King County Permits DETENTION POND,STORM SYSTEM Requested Studies: Wetland Delineation Report ,I, Location where application may be reviewed: Planning/Building/Public Works Division,Development Services Department, 1055 South Grady Way,Renton,WA 98055 • PUBLIC HEARING; N/A . CONSISTENCY OVERVIEW: if you would like to be made a party of record to receive further information on this proposed project,complete this form Land Use: The land use designations in the project area are predominantly Residential and return to:City of Renton,Development Planning,1055 So.Grady Way,Renton,WA 98055. • Single Family.The zoning In the area is Residential 8 Dwelling Units per Acre File No.Meme:LUA-02.118,ECF/Detention Pond/Pipe Repair • ' • within the City of Renton and R•6 in King County.The proposed storm pipe Improvements and detention pond are consistent with these designations and NAME: zones. Environmental Documents that ADDRESS: Evaluate the Proposed Project: SEPA Checklist TELEPHONE NO.: _ ___ Development Regulations ,Used For Project Mitigation: The project will be subject to the City's Environmental Procedures,Zoning . • Regulations,Public Works Standards and other codes and regulations as ' . • . applicable. Proposed Mitigation Measures: N/A NOTICE OF APPLICA1101 NOTICE OFAPPIICATI01 ,g:AR YN ,..Ali CHFFF CERTIFICATION TAR PUBLIC ' STATE OF WASHINGTON COMMISSION EXPIRES JUKE 29, 2003 I Z..1,/ ,hereb Y co certif that ies of the p above document were posted b me in conspicuous places on or nearby the described property on c.A" • '3 � 7 c�D Z • SignecVT)G)•i' ATTEST:Subscribed worn before me,a Notary Public,in and for t State of Washington residing ii ,on the / day of d U- �043-. MARL°LYN JdCHEFF MV APPOIIUT f1ENT EXPIRES:6-2g.03 • •• CITY1111Alt RENTON :.a z Planning/Building/PublicWorks Department Jesse Tanner,Mayor Gregg Zimmerman P.E.,Administrator DN October 24, 2002 CO),FR airAs N iVNING ACT 2020 King County DDES—Land Use Services Division 2 Attn: Rich Hudson, SEPA Coordinator ECEjv 900 Oakesdale Ave. SW Renton, WA 98055-1219 . • SUBJECT: SEPA LEAD AGENCY STATUS FOR THE NE 10'•"ST/ANACORTES AVE NE DETENTION POND AND STORM SYSTEM IMPROVEMENT PROJECT - SWP-27-2266 Dear Mr.Hudson: The City of Renton Development Services Division has received a SEPA Environmental Checklist from the City of Renton Surface Water Utility for the NE 10th St/Anacortes Ave.NE Detention Pond and Storm System Improvement Project. The project consists of constructing a detention pond to help reduce flooding in City streets, and the associated stormwater pipes needed to improve the stormwater system. The detention pond and part of the stormwater system will be located in King County, on a piece of property owned by the City,next to the City Corporate Boundary. The City of Renton Development Services Division has determined under WAC 197-11-924 and 197-11-926 that it should be the SEPA lead agency for this proposal because the property is owned by the City and the project is proposed by a City Agency,the Surface Water Utility. Accordingly, I am enclosing a copy of the Environmental Checklist and application for your information. Please examine the checklist and let me know if you agree with this request within 14 days of this letter. If you have any questions please call me at(425)430-7286. Sincerely, Eko, Jennifer Henning,Principal P ner Development Services Division cc: Ron Straka Daniel Carey H:File Sys\SWP-27-2266\01\1300\01\020826-KC SEPA Lead-Final.doc/DWC\tb 1055 South Grady ��Way-Renton,Washington 98055 RENTON AHEAD OF THE CURVE CSC)This nanarrnntains6n%rnrvdnd,,nterial30%nnstrnncumor • Cl Y p° CD VP 'Nrc0 . NOTICE OF APPLICATION AND PROPOSED DETERMINATION OF NON-SIGNIFICANCE (DNS) DATE: October 30,2002 LAND USE NUMBER: LUA-02-119,ECF APPLICATION NAME: Detention Pond/Pipe Repair • PROJECT DESCRIPTION: The applicant is proposing improvements to the stormwater system to reduce the frequency and severity of flooding in the vicinity of NE 10th Street and Anacortes Avenue NE. Improvements involve constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond and repairs and upgrades to the existing system.The detention pond will be located on City property located in King County, addressed as 13610 SE 116th Street.The pipe system improvements will occur in right-of-ways located in the City of Renton and King County. The applicant is proposing two alternatives for pipe system locations in the right-of-ways. A Category 3 wetland is located on the detention pond site and a Category 2 wetland is located within 100 feet of the • proposed site.Both wetlands are regulated under the jurisdiction of King County. PROJECT LOCATION: Various:City ROW in NE 10th St.to NE 11th St.,Anacortes Ave.NE,King County ROW&site at 13610 SE 116th St. OPTIONAL DETERMINATION OF NON-SIGNIFICANCE, MITIGATED (DNS-M): As the Lead Agency, the City of Renton has determined that significant environmental impacts are unlikely to result from the proposed project. Therefore, as permitted under the RCW 43.21C.110,the City of Renton is using the Optional DNS-M process to give notice that a DNS-M is likely to be issued. Comment periods for the project and the proposed DNS-M are integrated into a single ' • comment period. There will be no comment period following the issuance of the Threshold Determination of Non- '- Significance Mitigated(DNS-M). A 14-day appeal period will follow the issuance of the DNS-M. • PERMIT APPLICATION DATE: October 24,2002 NOTICE OF COMPLETE APPLICATION: October 30,2002 APPLICANT/PROJECT CONTACT PERSON: City of Renton Surfacewater Utility Daniel Carey,Project Manager;(425)430-7293 • Permits/Review Requested: Environmental(SEPA)Review, • Other Permits which may be required: City of Renton Construction Permit and King County Permits Requested Studies: Wetland Delineation Report • Location where application may be reviewed: Planning/Building/Public Works Division, Development Services Department, 1055 South Grady Way,Renton,WA 98055 PUBLIC HEARING: N/A CONSISTENCY OVERVIEW: Land Use: The land use designations in the project area are predominantly Residential Single Family.The zoning in the area is Residential 8 Dwelling Units per Acre within the City of Renton and R-6 in King County. The proposed storm pipe improvements and detention pond are consistent with these designations and zones. • Environmental Documents that Evaluate the Proposed Project: SEPA Checklist • Development Regulations" „Used For Project Mitigation: - - The project will be subject to the City's Environmental Procedures, Zoning . Regulations, Public Works Standards and other codes and regulations as • applicable. Proposed Mitigation Measures: N/A • NOTICE OF APPLICATIO1 Comments on the above application must, `'ubmi ;1 writing to Ms. Susan Fiala, Senior P r, De ment ' Services Division, 1055 South Grady Way, rienton, WA 98055, by 5:00 PM on November 13, 20 '2. If ;:-,: have questions about this proposal,or wish to be made a party of record and receive additional notification by mail,contact the Project Manager.Anyone who submits written comments will automatically become a party of record and will be notified 11 of any decision on this project. . CONTACT PERSON: SUSAN FIALA;(425)430-7382 ' PLEASE INCLUDE THE PROJECT NUMBER WHEN CALLING FOR PROPER FILE IDENTIFICATION N Sunset Blvil LI Li_ • . • z ._ V Storm System I Improvements I NORTH • City of RENTON KING County JNE 11t�t St ON MI IIMI NM MI, tu Afem}ativt 2_t i . m' rDetention PondE 10tty P I Property 11• In ow — mot- i pla— Anemativ 1�4 ' . Storm Sys em Imlrovem nts NE 10th St • SE 116th St - 1 1 If I 1 ( III 1 I II NEIGHBORHOOD DETAIL MAP t 0 300' NE 10 th ST/ANACORTES AVE NE N Scale 1"=300' DETENTION POND,STORM SYSTEM If you would like to be made a party of record to receive further information on this proposed project,complete this form and return to:City of Renton,Development Planning,1055 So.Grady Way,Renton,WA 98055. • • File No./Name: LUA-02-119,ECF/Detention Pond/Pipe Repair NAME ** T .,,.i%c:{*•pr 1 ADDREE ,• • I' ,;• . TELEP � ," ;:.;.,.'I Almiln � Z HOLGER E.JOHANSEN CITY:OF RENTON • •. 1016 Anacortes Ave NE,Renton,WA 98059 R E C E 1 V E D 4� � 2 2�02 BUILD NGNG DIVISION NOTICE OF APPLICATIO1 ' CITY OF RENTON MEMORANDUM Date: October 30,2002 To: Daniel Carey, Surface Water Utility Dept. From: Susan Fiala,Development Planning Ite Subject: Detention Pond/Pipe Repair Project No.LUA-02-119,ECF The Development Planning Section of the City of Renton has determined that the subject application is complete according to submittal requirements and,therefore,is accepted for review. It is tentatively scheduled for consideration by the Environmental Review Committee on November 26, 2002. Prior to that review,you will be notified if any additional information is required to continue processing your application. Please contact me, at 430-7382,if you have any questions. acceptancememo -4 1, I ' City of Renton LAND USE PERMIT MASTER APPLICATION PROPERTY OWNER(S) PROJECT INFORMATION I NAME: City Of Renton PROJECT OR DEVELOPMENT NAME: NE 10th St I Anacortes Ave NE Detention Pond and Storm System Improvement Project ADDRESS: 1055 South Grady Way PROJECT/ADDRESS(S)/LOCATION AND ZIP CODE: CITY: Renton, WA ZIP:98055 City ROW in NE 10th St,Anacortes Ave NE, NE 10th PL, NE 11th ST,Whitman CT. King County ROW in SE 116th St about 600'west of 138th Ave SE. TELEPHONE NUMBER: (425) 430-7293 City owned property at approx. 13610 SE 116th St. APPLICANT (if other than owner) I KING COUNTY ASSESSOR'S ACCOUNT NUMBER(S): 102305 9129 (City Owned Property) NAME: Daniel Carey, Project Manager EXISTING LAND USE(S): Open Field, City ROW, COMPANY(if applicable): City Of Renton, King County ROW Surface Water Utility PROPOSED LAND USE(S): City Owned Stormwater Detention Pond ADDRESS: 1055 South Grady Way EXISTING COMPREHENSIVE PLAN MAP DESIGNATION: CITY: Renton, WA ZIP:98055 Residential Single Family PROPOSED COMPREHENSIVE PLAN MAP DESIGNATION TELEPHONE NUMBER (425) 430-7293 (if applicable): NA CONTACT PERSON I EXISTING ZONING: Residential (Renton R-8), King Co R-6 NAME: Same as above PROPOSED ZONING (if applicable): NA SITE AREA (in square feet): Pond Property—49,036 sf COMPANY(if applicable): DEVELOPMENT 'ATV OF — ' " AINCNTON , SQUARE FOOTAGE OF ROADWAYS TO BE DEDICATED FOR SUBDIVISIONS OR PRIVATE STREETS SERVING ADDRESS: OCT 2 nG 2002 THREE LOTS OR MORE(if applicable): NA RECEIVED CITY: ZIP: PROPOSED RESIDENTIAL DENSITY IN UNITS PER NET ACRE(if applicable): NA TELEPHONE NUMBER AND E-MAIL ADDRESS: NUMBER OF PROPOSED LOTS (if applicable): NA (425)430-7293 dcarey@ci.renton.wa.us 1 H:\FILE.SYS\SWP-27-2266\01 Pond Design\1300 SEPA\020709 Master Appl\DWC\tb .. d PRO, :;T INFORMATION (continue NUMBER OF NEW DWELLING UNITS (if applicable): PROJECT VALUE: Approx.$620,000 none IS THE SITE LOCATED IN ANY TYPE OF NUMBER OF EXISTING DWELLING UNITS (if applicable): ENVIRONMENTALLY CRITICAL AREA, PLEASE INCLUDE None SQUARE FOOTAGE(if applicable): SQUARE FOOTAGE OF PROPOSED RESIDENTIAL BUILDINGS(if applicable): NA ❑ AQUIFER PROTECTION AREA ONE SQUARE FOOTAGE OF EXISTING RESIDENTIAL 0 AQUIFER PROTECTION AREA TWO BUILDINGS TO REMAIN (if applicable): NA ❑ FLOOD HAZARD AREA sq.ft. SQUARE FOOTAGE OF PROPOSED NON-RESIDENTIAL ❑ GEOLOGIC HAZARD sq.ft. BUILDINGS(if applicable): NA SQUARE FOOTAGE OF EXISTING NON-RESIDENTIAL CI HABITAT CONSERVATION sq.ft. BUILDINGS TO REMAIN (if applicable): NA 0 SHORELINE STREAMS AND LAKES sq.ft. NET FLOOR AREA OF NON-RESIDENTIAL BUILDINGS (if 0 XX WETLANDS . 3,070 sq.ft. applicable): NA NUMBER OF EMPLOYEES TO BE EMPLOYED BY THE • NEW PROJECT(if applicable): NA LEGAL DESCRIPTION OF PROPERTY (Attach legal description on separate sheet with the following information included) SITUATE IN THE NW 1/4 QUARTER OF SECTION 10 , TOWNSHIP 23N , RANGE 5E , IN THE CITY OF RENTON, KING COUNTY, WASHINGTON. (Detention Pond is in King Co.) TYPE OF APPLICATION & FEES List all land use applications being applied for: 1. AV E:med,3 Mo. OD 3. 2. 4. /00M. 00 Staff will calculate applicable fees and postage: $ -/'f Ala Cpa5-1") IAFFIDAVIT OF OWNERSHIP I, (Print Name/s) _Da n i e / Carey declare that I am (please check one) _the current owner of the property involved in this application or X the authorited representative to act for a corporation (please attach proof of authorization) and that the foregoing statements and answers herein contained and the information herewith are in all respects true and correct to the best of my knowledge and belief. I certify that I know or have satisfactory evidence that Da h I e_I G signed this instrument and acknowledged it to be his/her/their free and.MQ ct for the ;� • ,( /0"2 Z0, uses and purposes mentioned in the instrument. _ -0 F ER/( _yrwY� "�P ''' Sk°N�' �S' t° (Signature of Owner/Re resentative) 1 Zo;' .�5 -�,o., - l/ icy NOTAFty m:O 11, eotitit . Je)de.otA4uh , p, i PUBLIC ' 5 Notary Public in and for the State ashington 11 tf>'•.• � •��= • �t.O••.... ` " (Signature of Owner/Representative) I / 1 p ,, I / r ltt��1I�A8� Notary(Print) Li N DA- C . 1 iz�C/ "' (�-S/ My appointment expires: 61 '' I a 6 0`t" 1 H:\FILE.SYS\SWP-27-2266\O1 Pond Design\1300 SEPA\020709 Master Appl\DWC\tb LEGAL DESCRIPTION OF PROPERTY NE 10th ST/Anacortes Ave. NE Detention Pond Property SITUATED IN THE NW 1/4 QUARTER OF SECTION 10 TOWNSHIP 23N , RANGE 5E , IN KING COUNTY, WASHINGTON. THE WEST 164 FEET OF THE SOUTHWEST QUARTER OF THE NORTHEAST QUARTER OF THE NORTHWEST QUARTER OF SECTION 10, TOWNSHIP 23 NORTH, RANGE 5 EAST, W.M. IN KING COUNTY, WASHINGTON; EXCEPT ROADS, (OR 49,036 SQUARE FEET OR 1.125 ACRES MORE OR LESS). KING COUNTY PARCEL NO. 102305-9129 H:FILE SYS/SWP-27-2266\01\1300\01\020709B-Legal Descrp Property v10.doc\DWC\tb 1 DEVELOPMENT SERVICES DIVISION ENVIRONMENTAL CHECKLIST City of Renton Development Services Division REV ci 0�OF PMENT p 1055 South Grady Way, Renton, WA 98055 RENTpNN'NG Phone: 425-430-7200 Fax: 425-430-7231 OCT PURPOSE OF CHECKLIST: ?002 RECEIV The State Environmental Policy Act(SEPA), Chapter 43.21C RCW, requires all governmental agenc e'to consider the environmental impacts of a proposal before making decisions. An Environmental Impact Statement (EIS) must be prepared for all proposals with probable significant adverse impacts on the quality of the environment. The purpose of this checklist is to provide information to help you and the agency identify impacts from your proposal (and to reduce or avoid impacts from the proposal, if it can be done) and to help the agency decide whether an EIS is required. INSTRUCTIONS FOR APPLICANTS: This environmental checklist asks you to describe some basic information about your proposal. Governmental agencies use this checklist to determine whether the environmental impacts of your proposal are significant, requiring preparation of an EIS. Answer the questions briefly, with the most precise information known, or give the best description you can. You must answer each question accurately and carefully, to the best of your knowledge. In most cases, you should be able to answer the questions from your own observations or project plans without the need to hire experts. If you really do not know the answer, or if a question does not apply to your proposal, write "do not know" or"does not apply". Complete answers to the questions now may avoid unnecessary delays later. Some questions ask about governmental regulations, such as zoning, shoreline, and landmark designations. Answer these questions if you can. If you have problems, the governmental agencies can assist you. The checklist questions apply to all parts of your proposal, even if you plan to do them over a period of time or on different parcels of land. Attach any additional information that will help describe your proposal or its environmental effects. The agency to which you submit this checklist may ask you to explain your answers or provide additional information reasonably related to determining if there may be significant adverse impact. USE OF CHECKLIST FOR NONPROJECT PROPOSALS: Complete this checklist for nonproject proposals, even though questions may be answered "does not apply." IN ADDITION, complete the SUPPLEMENTAL SHEET FOR NONPROJECT ACTIONS (part D). For nonproject actions (actions involving decisions on policies, plans and programs), the references in the checklist to the words "project," "applicant," and "property or site" should be read as "proposal," "proposer," and "affected geographic area," respectively. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 A. BACKGROUND 1. Name of proposed project, if applicable: NE 10th ST/Anacortes Ave NE Detention Pond and Storm System Improvement Project 2. Name of applicant: City Of Renton Surface Water Utility 3. Address and phone number of applicant and contact person: Daniel Carey, Project Manager, Surface Water Utility 1055 South Grady Way Renton,WA 98055 425-430-7293 4. Date checklist prepared: October 2002 5. Agency requesting checklist: City of Renton Development Services Division 6. Proposed timing or schedule (including phasing, if applicable): Construction in Summer 2003 Construction may also occur in Summer 2004 if it is not possible to design and build both the pipe system and detention pond in 2003. 7. Do you have any plans for future additions, expansion, or further activity related to or connected with this proposal? If yes, explain. No. 8. List any environmental information you know about that has been prepared, or will be prepared, directly related to this proposal. Wetland Delineation and Classification Report—October 2001 9. Do you know whether applications are pending for governmental approvals of other proposals directly affecting the property covered by your proposal? If yes, explain. None known. 10. List any governmental approvals or permits that will be needed for your proposal, if known. City of Renton Exemption for Category 3 Wetland less than 5,000 sf in size. U.S.Army Corps of Engineers Wetland Determination (obtained 10/8/02). Washington State Dept. of Ecology Administrative Review for Isolated Wetlands. NPDES Construction Permit(may be needed). King County Clearing and Grading Permit. King County Right-of-Way Use Permit. H;File Sys\SWP-27-2266\01\1300\O1\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 2 KING County Sensitive Area Review(may be needed). King County Site Engineering Plan Submittal (may be needed). King County Conditional Use Permit(may be needed). 11. Give brief, complete description of your proposal, including the proposed uses and the size of the project and site. The project involves constructing a detention pond to store stormwater runoff, constructing new and replacement stormwater pipe systems for the pond, and repairing and upgrading parts of the existing stormwater system (hereinafter "system"). The purpose of the pond is to reduce the frequency and severity of flooding in NE 10th ST, Anacortes Ave. NE, and Anacortes CT NE. The stormwater detention pond is located on a 1.12 acre parcel of undeveloped property located in King County, and owned by the City of Renton. Surface water runoff from the existing system in SE 116th ST site will be directed into the pond, stored, and released at a slower rate into the existing system west of the site. The detention pond will occupy about 110' x 270' feet (0.68 acres) of the site, and will be about 6 feet deep. On the east side of the pond the cut will be about 15 feet deep because of the slope of the existing hillside. New stormwater pipes will be installed in SE 116th ST to direct flow into and out of the detention pond. The existing stormwater system in SE 116th ST, NE 10th ST, and Anacortes Ave NE will be replaced with a new system. The new system will connect from the new detention pond to part of the existing system in Anacortes Ave NE. From there, depending on engineering design, the new system either will be constructed in NE 10th PL (Alternative 1), or up Anacortes Ave NE and NE 11th ST (Alternative 2). At the end of each Alternative the new system will connect into the existing system. The existing systems consist of 8- to 18-inch stormwater pipes. The new system will consist of approximately 12-to 30-inch diameter pipes. Approximately 1400 to 1800 feet of pipe, and new manholes and catch basins, will be installed. The exact pipe size and location of the new system will be finalized after the design work is completed. In Whitman CT NE,the existing system will be replaced at two locations with a new system intended to reduce maintenance problems. In the 1100 block of Whitman CT NE the existing 15- to 18-inch stormwater pipe has problems with joint separation and root intrusion and blockage. The existing pipe will be replaced by a new 24- to 30-inch pipe that will resist root intrusion. Approximately 50 to 200 feet of pipe, and new manholes and catch basins,will be installed. In the 1200 block of Whitman CT NE the existing system was constructed as an 18-inch vertical siphon to run under a pair of culverts that Honey Creek use to run through. The siphon is a maintenance problem due to sediment buildup and the difficulty to access the pipe for cleaning. Honey Creek was diverted away from the culverts in about 1980. The abandoned culverts will be removed in the center of the street and the siphon will be eliminated. A new 24- to 30-inch storm water pipe will be installed to replace the 18-inch siphon. Approximately 50 to 100 feet of pipe, and new manholes and catch basins, will be installed. 12. Location of the proposal. Give sufficient information for a person to understand the precise location of your proposed project, including a street address, if any, and section, township, and range if known. If a proposal would occur over a range of area, provide the range or boundaries of the site(s). Provide a legal description, site plan, vicinity map, and topographic map, if reasonably available. While you should submit any plans required by the agency, you are not H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHKlist v 23.doc\DWC\tb 10/18/02 3 required to duplicate maps or detailed plans submitted with any permit applications related to this checklist. The project is located in the NW 1/4 of Section 10, Township 23N, Range 5E, in the City of Renton, and in King County,Washington. The project is located in three nearby areas. The detention pond is located on a piece of undeveloped property in King County, next to the City of Renton Corporate Boundary. The property is located on the north side of SE 116th ST, approximately 300 feet east of the intersection with Anacortes Ave NE and 600 feet west of 138th Ave SE. Stormwater system pipe improvements for the detention pond will occur south of the detention pond property in SE 116th ST in the King County ROW. Pipe system improvements will also occur in the City of Renton ROW in the 4300-4400 blocks of NE 10th ST, the 1000-1100 blocks of Anacortes Ave NE, the 4200-4300 blocks of NE 10th PL, and 4200-4400 blocks of NE 11th ST. • Repairs and maintenance to the existing stormwater system will occur in the 1100 block of Whitman CT NE in City of Renton ROW, and in the adjacent apartment building parking lot that the City has an easement over (ORD. No. 2957, Aug 11, 1975). A second maintenance area is in the City ROW in the 1200 block of Whitman CT NE, about 300 feet south of NE Sunset Blvd. B. ENVIRONMENTAL ELEMENTS 1. EARTH a. General description of the site (circle one); flat, rolling , hilly, steep slopes, mountainous, other. Rolling, 5 to 10 % slope on pond site. b. What is the steepest slope on the site (approximate percent slope?) About 12% on the pond site. c. What general types of soils are found on the site (for example, clay, sand, gravel, peat, muck)? If you know the classification of agricultural soils, specify them and note any prime farmland. The soils are generally common forms of glacial till and are typically silty sands with some gravel. They are classified as Alderwood Gravelly Sandy Loam (AgC) and Arents- Alderwood Material (AmC). d. Are there surface indications or history of unstable soils in the immediate vicinity? If so, describe. No e. Describe the purpose, type, and approximate quantities of any filling or grading proposed. Indicate source of fill. About 6,000 to 9,000 cubic yards of soil may be excavated to form the detention pond. About 1,200 to 1,800 cubic yards of soil may be placed as backfill for the new or replacement stormwater lines. The contractor will supply the backfill from licensed gravel pits. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 4 f. Could erosion occur as a result of clearing, construction, or use? If so, generally describe. Minor erosion could occur during construction of the detention pond. g. About what percent of the site will be covered with impervious surfaces after project construction (for example, asphalt or buildings)? About 2.5 percent (1,200 sf) of detention pond site may be covered with an asphalt access road and pad. About 120 feet of new sidewalk may be constructed along the north side of NE 10th ST and SE 116th ST right-of-ways. Excavations in the existing asphalt roads will be replaced with new asphalt. h. Proposed measures to reduce or control erosion, or other impacts to the earth, if any: Typical erosion control measures such as silt fencing, catch basin inlet protection, hydroseeding, and replanting of the site should reduce and control any erosion from construction activities. 2. AIR a. What types of emissions to the air would result from the proposal (i.e., dust, automobile, odors, industrial wood smoke) during construction and when the project is completed? If any, generally describe and give approximate quantities if known. During construction, dust and exhaust from construction equipment will occur. After construction, no emissions are expected from the site. Maintenance activities, such as cleaning the pond every 3 to 5 years will cause temporary emissions from construction equipment. b. Are there any off-site sources of emission or odor that may affect your proposal? If so, generally describe. No. c. Proposed measures to reduce or control emissions or other impacts to air, if any: Construction equipment will have mufflers and exhaust systems in good working order. Dust will be kept down by watering the excavation as needed. 3. WATER a. Surface Water: 1) Is there any surface water body on or in the immediate vicinity of the site (including year- round and seasonal streams, saltwater, lakes, ponds, wetlands)? If yes, describe type and provide names. If appropriate, state what stream or river it flows into. One Category 3 wetland is present in the southern half of the detention pond property. The wetland is 3,070 sf in size, and is described as hydrologically isolated in the Wetland Delineation and Classification Report. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 5 One Category 2 wetland was found on the property north of the detention pond property, and drains to an unnamed tributary noted below. The wetland area within 100 feet of the property line was measured at 1,033 sf. City of Renton Category 2 and 3 wetlands correspond to King County Class 2 and 3 wetlands. There is a small, unnamed tributary about 400-600 feet north of the detention pond property that drains the Category 2 wetland to the upper part of Honey Creek and to May Creek (#0285A, "May Creek Current and Future Conditions Report", King County Surface Water Management Division 1995). Development has occurred on the properties north of the detention pond site, and the northern part of the unnamed tributary has been culverted for residential and business development. In addition, a large portion of Honey Creek north of the project site was culverted 30 to 40 years ago. The culverted portion of Honey Creek located in Whitman CT is about 90 feet from the existing storm pipe and siphon that will be replaced as part of the maintenance work. 2) Will the project require any work over, in, or adjacent to (within 200 feet) the described waters? If yes, please describe and attach available plans. The onsite Category 3 wetland will be removed when the detention pond is excavated. The Wetland Delineation Report describes the Category 3 wetland as an isolated wetland with low biological support. The wetland appears to meet the isolated wetland definition in King County 21A.06.1410. King County regulations allow alterations to wetlands if they do not serve any of the wetland functions as identified in KC 21A.06.1415(KC 21A.24.330). The City sent the Army Corps of Engineers (Corps) a copy of the Wetland Delineation Report and requested a jurisdictional wetland determination to determine if the Corps would regulate the onsite Category 3 wetland. On October 8, 2002, the Corps issued a determination stating that the onsite wetland was isolated, was not under Corps regulatory jurisdiction, and would not need a Corps permit for the proposed work. Construction will be within 200 feet of the Category 2 wetland located north of the detention pond property. King County requires a 50-foot buffer from Category 2 wetlands. The buffer area on the detention pond property will need to be crossed by construction equipment during construction. Silt fencing will be used to help protect the offsite wetland. After construction, the existing vegetation will be removed from the buffer area and it will be replanted with native vegetation. The culverted portion of Honey Creek located in Whitman CT is about 90 feet from the existing storm pipe and abandoned siphon that will be replaced as part of the maintenance work. The abandoned siphon will be removed and replaced with a new 24- to 30-inch diameter stormwater pipe. The exact pipe diameter will be determined for the final plans. 3) Estimate the amount of fill and dredge material that would be placed in or removed from surface water or wetlands and indicate the area of the site that would be affected. Indicate the source of fill material. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 6 . The entire onsite Category 3 wetland (3,070 sf)will be removed when the detention pond is excavated. 4) Will the proposal require surface water withdrawals or diversions? Give general description, purpose, and approximate quantities if known. No. 5) Does the proposal lie within a 100-year flood plain? If so, note location on the site plan. No. 6) Does the proposal involve any discharges of waste materials to surface waters? If so, describe the type of waste and anticipated volume of discharge. No. b. Ground Water: 1) Will ground water be withdrawn, or will water be discharged to ground water? Give general description, purpose, and approximate quantities if known. There is a shallow groundwater table, about 4 to 10 feet below ground surface, perched on glacial till under the site. The permeability of the glacial till is typically low (estimated at 1x10-4 to 1x10-5 cm/sec). There is also a deeper ground water table about 30 feet below ground surface. Depending on the groundwater level, the detention pond may intercept the shallow groundwater table and some groundwater may drain into the pond. Assuming the ground was saturated during the winter, approximately 2 to 20 gallons per minute (gpm) of groundwater could flow into the entire pond area based on the typical soil permeability. At other times of year when the groundwater table is lower, the inflow amount would probably be less then 2 gpm for the entire pond area. If the glacial till is less permeable, the potential groundwater inflow rate would be less than 2 gpm for the entire pond area. Any groundwater flowing into the pond would either evaporate, infiltrate into a different soil layer, or flow out the pond discharge pipe into the City drainage system. The amount of groundwater that may flow into the detention pond is expected to be insignificant, and not adversely affect the capacity or function of the detention pond. Depending on the groundwater level in the shallow groundwater table and permeability of the glacial till, stormwater in the detention pond could infiltrate into the soil during some parts of the year. As with the inflow scenario, the amount of possible infiltration into the soil is estimated to be low. 2) Describe waste material that will be discharged into the ground from septic tanks or other sources, if any (for example: Domestic sewage; industrial, containing the following chemicals...; agricultural; etc.). Describe the general size of the system, the number of such systems, the number of houses to be served (if applicable), or the number of animals or humans the system(s) are expected to serve. None. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 7 c. Water Runoff(including storm water): 1) Describe the source of runoff (including storm water) and method of collection and disposal, if any (include quantities, if known). Where will this water flow? Will this water flow into other waters, If so, describe. Stormwater runoff into the new detention pond will come from the existing system in SE 116th ST,which serves the areas east of the pond. Those areas include open fields,single-family residences, and City and County ROW. Discharge from the new pond will go into the same existing system in SE 116th ST/NE 10th ST where stormwater currently goes. The existing system runs about 1700 feet to the north in NE 11th PL and Whitman CT, and eventually connects to a culvert in Whitman CT that Honey Creek flows in. Honey Creek flows into May Creek,which flows to Lake Washington. The total amount of stormwater flowing from the detention pond to the existing system is not expected to change. The detention pond is designed to reduce the duration of the peak flow rates from the 2-, 10-, and 25-year storm events by storing part of the runoff water and discharging it at a slower rate. Computer flow modeling predicts that the pond and pipe improvements will reduce the duration of flooding in NE 10th ST from 11 hours to 0 hours for the 25-year, 24-hour storm event. The frequency and severity of flooding in City streets is expected to decrease with the detention pond in service. 2) Could waste material enter ground or surface waters? If so, generally describe. Any liquid spills in the street could enter the drainage system and new detention pond. The same potential currently exists without the detention pond. d. Proposed measures to reduce or control surface, ground, and runoff water impacts, if any: The detention pond is not expected to create new water impacts. The detention pond will probably help reduce the amount of sediment in the stormwater runoff. The outflow system in the pond will include down turned elbows that act as an oil/water separator. The pond could act to help contain liquid spills in the street, and aid in cleanup before a spill reached Honey Creek. The detention pond will help control stormwater runoff impacts to Honey Creek and May Creek by reduce the duration of the peak flow rates from the 2-, 10-, and 25-year storm events by holding part of the stormwater runoff and discharging it at a slower rate. 4. PLANTS a. Check or circle types of vegetation found on the site: _x_ deciduous tree: alder, maple, aspen, other maple, poplar, other unidentified deciduous trees. evergreen tree: fir, cedar, pine, other x shrubs _x grass H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 8 • pasture crop or grain _x_ wet soil plants: cattail, buttercup, bullrush, skunk cabbage, other slough sedge,soft rush, daggerleaf rush water plants: water lily, eel grass, milfoil, other _x_ other types of vegetation blackberry, bentgrass, misc. grass and shrubs b. What kind and amount of vegetation will be removed or altered? On the detention pond property the majority of the vegetation will be removed for construction of the pond. That includes grass, brush, shrubs, and blackberries. All wetland plants in the Category 3 wetland will be removed. Depending on the extent of the pond excavation needed, one to three of the large maple trees (42", 36", and 36" diameter) in the southeast corner of the site may be removed. In the easement in the apartment building parking lot north of Whitman CT about 2 to 4 poplar trees may need to be removed to replace the existing stormwater pipe. c. List threatened or endangered species known to be on or near the site. None known. d. Proposed landscaping, use of native plants, or other measures to preserve or enhance vegetation on the site, if any: All disturbed areas not used for the pond, access road, and associated features will be seeded with native grass for long-term erosion control. Shrubs will be planted along the west and south perimeter of the pond property. After construction is completed the existing vegetation in the 50-foot wetland buffer will be removed and the buffer area will be replanted with native vegetation. 5. ANIMALS a. Circle any birds and animals, which have been observed on or near the site or are known to be on or near the site: Birds: hawk, heron, eagle, songbirds, other . small birds in general Mammals: deer, bear, elk, beaver, other Typical small mammals such as mice and squirrels may be present Fish: bass, salmon, trout, herring, shellfish, other b. List any threatened or endangered species known to be on or near the site. None known. c. Is the site part of a migration route? If so, explain No. d. Proposed measures to preserve or enhance wildlife, if any: None. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 9 6. ENERGY AND NATURAL RESOURCES a. What kinds of energy (electric, natural gas, oil, wood stove, solar)will be used to meet the completed project's energy needs? Describe whether it will be used for heating, manufacturing, etc. None needed for the completed project. b. Would your project affect the potential use of solar energy by adjacent properties? If so, generally describe. No. c. What kinds of energy conservation features are included in the plans of this proposal? List other proposed measures to reduce or control energy impacts, if any: Not applicable. 7. ENVIRONMENTAL HEALTH a. Are there any environmental health hazards, including exposure to toxic chemicals, risk of fire and explosion, spill, or hazardous waste that could occur as a result of this proposal? If so, describe. During construction fuel and oil spills could occur. 1) Describe special emergency services that might be required. Typical emergency services by the Fire Department in case of fire, injury, or fuel spills. 2) Proposed measures to reduce or control environmental health hazards, if any: The Contractor will be required to keep construction equipment in good operating condition, and will be responsible to cleanup any oil or fuel leaks and spills, and repair leaking equipment. b. Noise 1) What types of noise exist in the area which may affect your project (for example: traffic, equipment, operation, other)? None. 2) What types and levels of noise would be created by or associated with the project on a short-term or a long-term basis (for example: traffic, construction, operation, other)? Indicate what hours noise would come from the site. Short-term: Noise from construction equipment may occur between the hours of 7 AM to 5 PM, Monday through Friday during construction. 3) Proposed measures to reduce or control noise impacts, if any: The contractor will be required to keep the construction equipment's mufflers and exhaust systems in good operating condition. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 10 8. LAND AND SHORELINE USE a. What is the current use of the site and adjacent properties? The stormwater detention pond is located on a 1.12-acre parcel of undeveloped property in King County, owned by the City of Renton. The site is vacant and is covered with a variety of grass, blackberry vines, shrubs, and three Maple trees. The adjacent properties are mainly single-family residences. The Martin Luther King Baptist Church on SE 116th ST is across from the site. The existing stormwater drainage system in SE 116th ST is located in King County ROW, which is used as an asphalt street. The existing systems in NE 10th ST, Anacortes Ave NE, NE 10th Place, and Whitman CT are located in City of Renton ROW and are also used as asphalt streets. Part of the existing system south of Whitman CT is located in a City easement in an apartment building parking lot. The properties next to the system improvement areas are used for single-family residences, apartment buildings or condominiums, and some small businesses (Whitman CT). b. Has the site been used for agriculture? If so, describe. The site has not recently been used for agricultural (in at least the last 10 years or more). c. Describe any structures on the site. Wood and wire fences. d. Will any structures be demolished? If so, what? The old fences will be removed and replaced with new 6-foot high chain link fence around the entire site. e. What is the current zoning classification of the site? The detention pond property in King Co. is zoned R-6. The areas around the City of Renton street ROWs are zoned R-8, Residential (Renton). In Whitman CT near Sunset Blvd the zoning is CN, Center Neighborhood, and RM- N, Residential Multi-Family Neighborhood Center. f. What is the current comprehensive plan designation of the site? Residential Single Family g. If applicable, what is the current shoreline master program designation of the site? NA h. Has any part of the site been classified as an "environmentally sensitive" area? If so, specify. Unsure, the Category 3 isolated wetland may be an "environmentally sensitive" area. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHKlist v 23.doc\DWC\tb 10/18/02 11 Approximately how many people would reside or work in the completed project? None. • j. Approximately how many people would the completed project displace? None. k. Proposed measures to avoid or reduce displacement impacts, if any: NA Proposed measures to ensure the proposal is compatible with existing and projected land uses and plans, if any: The site will be fenced to discourage children from entering. 9. HOUSING a. Approximately how many units would be provided, if any? Indicate whether high, middle, or low-income housing. None. b. Approximately how many units, if any, would be eliminated? Indicate whether high, middle, or low-income housing. None. c. Proposed measures to reduce or control housing impacts, if any: NA 10. AESTHETICS a. What is the tallest height of any proposed structure(s), not including antennas; what is the principal exterior building material(s) proposed. An approximately 6-foot high chain link fence will be placed around the entire detention pond site. b. What views in the immediate vicinity would be altered or obstructed? None. c. Proposed measures to reduce or control-aesthetic impacts, if any: Re-establish grass cover in areas disrupted by construction. Shrubs will be planted along the west and south site boundaries. 11. LIGHT AND GLARE a. What type of light or glare will the proposal produce? What time of day would it mainly occur? None. H;File Sys\SWP-27-2266\01\1300\O1\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 12 b. Could light or glare from the finished project be a safety hazard or interfere with views? No. c. What existing off-site sources of light or glare may affect your proposal? None. d. Proposed measures to reduce or control light and glare impacts, if any: NA 12. RECREATION a. What designated and informal recreational opportunities are in the immediate vicinity? None. b. Would the proposed project displace any existing recreational uses? If so, describe. No. c. Proposed measures to reduce or control impacts on recreation, including recreation opportunities to be provided by the project or applicant, if any: NA 13. HISTORIC AND CULTURAL PRESERVATION a. Are there any places or objects listed on, or proposed for, national state, or local preservation registers known to be on or next to the site? If so, generally describe. None known. b. Generally describe any landmarks or evidence of historic, archaeological, scientific, or cultural importance known to be on or next to the site. None known. c. Proposed measures to reduce or control impacts, if any: NA 14. TRANSPORTATION a. Identify public streets and highways serving the site, and describe proposed access to the existing street system. Show on site plans, if any. The detention pond site is located on SE 116th ST(King County). It can be reached by 138th Ave SE in King County, or by Union Ave NE and NE 10th ST in Renton. The other project areas for stormwater pipe construction are in the City of Renton ROW in NE 10th ST, NE 10th PL, NE 11th ST,Anacortes Ave NE, and Whitman CT. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 13 b. Is site currently served by public transit? If not, what is the approximate distance to the nearest transit stop? There are bus routes on major adjacent streets such as Unions Ave NE, Sunset Blvd NE, and 138th Ave SE approximately 600 to 1400 feet away. c. How many parking spaces would the completed project have? How many would the project eliminate? No parking spaces will be created or eliminated. d. Will the proposal require any new roads or streets, or improvements to existing roads or streets, not including driveways? If so, generally describe (indicate whether public or private? Approximately 120 linear feet of new sidewalk may be placed on the north side of NE 10th ST and SE 116th ST. The sidewalk would extend from the existing walk on NE 10th ST to the new detention pond driveway. e. Will the project use (or occur in the immediate vicinity of)water, rail, or air transportation? If so, generally describe. No. f. How many vehicular trips per day would be generated by the completed project? If known, indicate when peak volumes would occur. None. g. Proposed measures to reduce or control transportation impacts, if any: NA 15. PUBLIC SERVICES a. Would the project result in an increased need for public services (for example: fire protection, police protection, health care, schools, other)? If so, generally describe. The new detention pond will need occasional maintenance and cleaning by the City of Renton. b. Proposed measures to reduce or control direct impacts on public services, if any. The project will help reduce impacts on public services by reducing the frequency of flooding events in the City ROW, and the emergency response needed on those occasions. 16. UTILITIES a. Circle utilities currently available at the site: electricity, natural gas, water, refuse service, telephone, sanitary sewer, septic system, other. Electricity, natural gas,water,telephone,sanitary sewer are all available at the site. H;File Sys\SWP-27-2266\01\1300\01\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 14 b. Describe the utilities that are proposed for the project, the utility providing the service, and the general construction activities on the site or in the immediate vicinity, which might be needed. The new detention pond and pipes are stormwater utilities owned by the City of Renton. Construction and operation will be provided by the City of Renton through private contractors and the City Maintenance Dept. The new detention pond will be excavated at the site. New and replacement stormwater pipes will be installed in adjacent streets. C. SIGNATURE I, the undersigned, state that to the best of my knowledge the above information is true and complete. It is understood that the lead agency may withdraw any declaration of non-significance that it might issue in reliance upon this checklist should there be any willful misrepresentation or willful lack of full disclosure on my part. Proponent: � / Ce7-- Name Printed: Da n i e/ C r 7 Date: /d - 22- 02 H;File Sys\SWP-27-2266\01\1300\O1\020709c-SEPA CHK1ist v 23.doc\DWC\tb 10/18/02 15 iv PROJECT NARRATIVE OCT 2` ON G We NE 10TH ST/ANACORTES AVE NE DETENTION POND 141ECE/V AND STORM SYSTEM IMPROVEMENT PROJECT The project involves constructing a detention pond to store stormwater runoff, constructing a new stormwater pipe system for the pond, and repairing and upgrading parts of the existing system. The purpose of the pond is to reduce the frequency and severity of flooding in NE 10th St, Anacortes Ave. NE, and Anacortes CT NE. The stormwater detention pond is located on a 1.12-acre parcel of undeveloped property located on SE 116th St in King County, and owned by the City of Renton. The pond will occupy about 110' x 270' feet (0.68 acres) of the site, and will be about 6 feet deep. Because of the slope of the hill, the east side of the pond will involve a cut of about 15 feet. The existing stormwater systems located in SE 116th St, NE 10th St, and Anacortes Ave NE will be replaced with a new system. The new system will connect from the new detention pond to part of the existing system in Anacortes Ave NE. From there, depending on engineering design, the new stormwater system either will be constructed in NE 10th PL (Alternative 1), or up Anacortes Ave NE and NE 11th St (Alternative 2). At the end of each Alternative the new system will connect into the existing system. The new system will consist of 12- to 30-inch diameter pipes. Approximately 1400 to 1800 feet of pipe, and new manholes and catch basins, will be installed. The exact size and location of the new system will be finalized after the design work is completed. The existing stormwater system located in Whitman CT NE will be replaced at two locations with new systems intended to reduce maintenance problems. In the 1100 block of Whitman CT NE the existing 15- to 18-inch stormwater pipe will be replaced by approximately 50 to 200 feet of new 24- to 30-inch pipe. In the 1200 block of Whitman CT NE the existing system was constructed as a siphon to run under a pair of culverts. The culverts are no longer in use and will be cut and plugged.. The old siphon will be replaced with approximately 50 to 100 feet of pipe of new 24-to 30-inch pipe. The following land use permits may be needed: City of Renton Exemption for Category 3 Wetland less than 5,000 sf in size; U.S. Army Corps of Engineers Wetland Determination (obtained 10/8/02); NPDES Construction Permit (may be needed); Washington State Dept. of Ecology Administrative review for isolated wetlands; King County Clearing and Grading Permit; King County Right-of-Way Use Permit; King County Sensitive Area Review.( may be needed); King County Site Engineering Plan Submittal (may be needed); King County Conditional Use Permit (may be needed). The detention pond property in King County is zoned R-6. The areas around the City of Renton street ROWs are zoned R-8, Residential (Renton). H:File Sys\SWP-28-2266\01\1300\01\020709d-Project Narrative v10.doc\DWC\tb Page 1 In Whitman CT near Sunset Blvd the zoning is CN, Center Neighborhood, and RM-N, Residential Multi-Family Neighborhood Center. The stormwater detention pond is located on a 1.12-acre parcel of undeveloped property owned by the City of Renton. The site is vacant and is covered with a variety of grass, plants, shrubs, and three Maple trees. There are wood and wire fences on the site. The existing stormwater system in SE 116th St is located in King County ROW and is used as an asphalt street. The existing stormwater systems in NE 10th St, Anacortes Ave NE, NE 10th Place, and Whitman CT are located in City of Renton ROW and are used as asphalt streets. Part of the existing system south of Whitman CT is located in a City easement in an apartment building parking lot. A 3,070 sf Category 3 wetland was found in the southern half of the detention pond property. On October 8, 2002, the Corps issued a determination stating that the onsite Category 3 wetland was isolated, was not under Corps regulatory jurisdiction, and would not need a Corps permit for the proposed work. A Category 2 wetland was found just north of the detention pond property. The Category 2 wetland area within 100 feet of the property line was measured at 1,033 sf. City of Renton Category 2 and 3 wetlands correspond to King County Class 2 and 3 wetlands. The soils are generally common forms of glacial till and are typically silty sands. They are classified as Alderwood Gravelly Sandy Loam (AgC) and Arents-Alderwood Material (AmC). The detention pond site drains from east to west. The detention pond property will be used to construct a detention pond to store stormwater runoff. Other work in the right-of-way involves constructing new and replacement pipe systems for the pond, and repairing and upgrading parts of the existing system. Approximately 120 linear feet of new sidewalk may be placed on the north side of NE 10th St and SE 116th St. The sidewalk would extend from the existing walk on NE 10th St to the new detention pond driveway. The estimated construction cost of the detention pond and storm water improvements is $620,000 About 6,000 to 9,000 cubic yards of soil may be excavated to form the detention pond. About 1,200 to 1,800 cubic yards of soil may be placed as backfill for the new or replacement stormwater lines. The contractor will supply the backfill from licensed gravel pits. Depending on the extent of the pond excavation, one to three of the large maple trees (42", 36", and 36") in the southeast corner of the detention pond site may be removed. Two to four poplar trees along the fence line of the apartment building parking lot in Whitman CT need to be removed to repair the system in that area. H:File Sys\SWP-28-2266\01\1300\01\020709d-Project Narrative v10.doc\DWC\tb Page 2 /ELOPMENT SERVICES DIVISION WAIVER OF SUBMITTAL REQUIREMENTS FOR LAND USE APPLICATIONS LAND::U:SE PERMIT SUBMITT k1°: :< »<:::: WALVE01:::>: :MOD F ���• .: `[:}[{ .yiy: hii::.i:.ii:.i:..:i::is is ii:;.iiiX'vi;:::.iii;.::;:n A.:':.:..;.:::'.' .:is ..4:::::::::.�..:.�:::::::::::::::::::::::::::::: :.:�:.:..::.:::..:::.:.�:....:.: v.. ..:...�::::::: ;Jy � �r.Y]*�i7'•]':J\. '::.iiiii:.:4;{niiii::.ii?:ii:.. :v<.n:is?:::^:: i..:.:.:'i. i:.:is ;"•i:vi:v<•iiJ:''i:!i:''rii:'iiiiiiiJ'i::.i'ri:iiii:::^:.i:•:isvi:•.:{•iiiiiii:::ii:v::::.:::.:.:•.�.iii,:}iii::::.i:':.iii ...:...:.....�W+.:.::rll:.y::::y:.�::::::..::.::.::::.:::v:.::::.:���:::.:.:.�:.::...::•.... �t:.:::.:::v.:::v:::v:::::v:..:::::.:.::::: ::.�::::::::::.::v:.:u::::::. .::.: : ..:... Calculations, Survey, 6 Drainage Control Plan 2 3 �1!✓ ` ,cr�c Elevations,Architectural 3 AND 4 Existing Covenants(Recorded Copy)4 Eitiri .:)=.sarrar.s .:::.....::::::._::.:::::::::.::::::::::.:::::::::::::.:::::.::.::::::::::.::::::::::.:.:. .:.:..:... ................:. Flood Plain Map, if applicable4 Geotechnical Report 2AND 3 ............................................................................................ Grading Plan, Detailed 2 Landscaping Plan, Conceptual 44) List of Surrounding Property Owners Mafl�n ;:#�ak7etsN1.::P:.......:. Avyn..ers::.:::::.::::::.:::.:::::::::::. .::::::.:::::.:: Map of Existing Site Conditions 4 a‘tt- Monument Cards(one per monument) i Plan Reductions (PMTs)4 Preapplication Meeting Summary 4 Rehabilitation Plan:4 This requirement may be waived by: � '`- 1. Property Services Section PROJECT NAME: 2. Public Works Plan Review Section 3. Building Section DATE: 81)-3/6 2- 4. Development Planning Section Q:\WEB\PW\DEVS ERV1AFORM\aformwaiver.xls06/25/02 DEVELOPMENT SERVICES DIVISIC WAIVER OF SUBMITTAL REQUIREMENTS FOR LAND USE APPLICATIONS 'r'�l-� :><MI:::SUBMI ::: AiL <;<>>::::>::::;:>:::Illi...... ..............................AI..:I:I}::.::..::ertoQ ..� :::..::.:.>::.::>::.:.::::...........................F.............. . ........ .............................. ........... ... Screening Detail 4 t .01 files >' '>>gaits : `'> ``grail llige< Title Report or Plat Certificate 4 .........................................................:... ......:.......:.:..::.:::.::.:.::.:::::. :::.............................................. it Traffic Study 2 •>. . . . ::::::::.: ::;:::.::..:.;•..:•... Try::�..t�... ...... ................... .......... ........... ..................:...:....... .. .. . ::::.:::.�:::.::::::::::.:.................. ..... . ...... . :�.... �... �:.... Urban Center Design Overlay District Report 4 71 • :>:::;: : . :• : :...::::::«:>::>:::: Wetlands Delineation Map 4 Wetlands'li lanttng) lat < > 1 >ll > > < l> mi.... Wetlands Study 4 mium 1'ommi > > 1»< <<>`'> >'> im<> :::.;:ate;::::ent ':; << > <'> € >A.. Iicarit' : reem i l Sta .txt . ..........�......................�................................... .aria.�.................... ............................ ..... ...................... ............................................................................................... ............................................................................................................................................ .............................. ............................................................................................... ............................................................................................................................................................................... ............................................................................................... ............................................... ......................................................... .................................. .............................. . ............................................................................................ ............................................ .................................................................. ......................................................... .................................................................................................. This requirement may be waived by: ye ,,�,( 1. Property Services Section PROJECT NAME: N� /(J Sf/41/fracsAt.- g � " 2. Public Works Plan Review Section r-red - 3. Building Section DATE: 0 /02.- 4. Development Planning Section DEV C OPM NT DF REMONN/NG OCT 2 ' 2002 RECEIVE®. Q:\WEB\PW\DEVS ERV\AFORM\aformwaiver.xls06/25/02 CONSTRUCTION MITIGATION DESCRIPTION NE 10TH ST/ANACORTES AVE NE DETENTION POND AND STORM SYSTEM IMPROVEMENT PROJECT Proposed Construction Dates: Construction may occur between May 1, 2003 and October 31, 2003, and May 1, 2004 and October 31, 2004 (if the entire project can not be built in 2003) Hours of Operation: Monday through Friday between 7:00 AM and 5:00 PM. Work on weekends is not expected. If work on weekends becomes necessary, it will require approval from the City Project Manager. Proposed Hauling/Transportation Routes: The contractor will probably use 1-405, SR-900 / Sunset Blvd NE, or NE 3rd / 4th ST to reach the site vicinity, and Union Ave NE, Duvall Ave NE / SE 138th Ave, and NE 10th ST/SE 116th ST to reach the construction site. The contractor will be required to file a Traffic Control Plan with the City to identify the hauling routes and traffic control measures for the construction area. SE 116th St, NE 10th ST, Anacortes Ave NE, NE 11th ST, and Whitman CT will probably be limited to one lane while construction is occurring in those streets. Access to local driveways will be maintained, except when construction actually needs to cross a driveway. Measures to Minimize Impacts Erosion control measures such as storm drain inlet protection and silt fences per the King County Surface Water Manual will be used. Any soil stockpiles not in use will be covered with plastic sheets during rainy periods. If dust conditions develop, the contractor will be required to use a water truck to reduce blowing dust. All construction equipment will be required to have muffler and exhaust systems in good working order. DEVFLO p CIj OF FM pNN/NG OCT 2 2002 RECEIVO H:File Sys\SWP-27-2266\01\1300\01\020709e-Project Constr Mitigate v10.doc\DWC\tb '-_ � � . ' '............. ' ....... ........................ _' N� 8U0S8towu | Storm System NORTH City of RENTON KING County NE I Ith St kjN1co 0 Detention Pond cu Property Storm Sys ern | NN ^ NE 10th St L SE 116th St | / ` ---^----`—^ ----^—^--- -�-------�---^-^-- ' NEIGHBORHOOD DETAIL MAP O 300' NE1OthST/ANACORTES AVE NE 'Scale / |N Sca|e1"=3UO' [JETENT|ONP(]NO, STORK8 SlSTEK8 | DEVEFLOPM —' , uF RIEC—~VEb� DEV E opA P �'OF RENydrliNG INTERFUND TRANSFER OCT 2 2002 Transfer Number. Date: /(,/ (�ZCE/Vcb 1 General Description: ' vvrm kilin.i/t x".e 11.f! �- / � 10 skea- A na ) Department To Be Charged (Transfer Out-From) Pg/11407 l t/S s*rsc�-- Description Account Number WO/Function Amount //i5- /67-11 4 e,A-k4 Raped Sea gZ>.oaoLao, 0/8.s a,o 38 4s7eiY/5 Department Authorization: & 161-frt6 Department To Be Credited (Transfer In - To) P/8 (13 c reiGPia Description Account Number WO/Function Amount ghtA-11,tf,- 49-siVizA) .3lf5, gf,DO, t9O07 Sir L0 /MO, CO OD.05,5 iq. • 1 6ys5 qy, eta • Distribution: White: Finance Department Yellow: Department to be Charged Pink: Department to be Credited _ CY OF RENTON 1055 S. Grady Way Renton, WA 98055 Printed: 10-24-2002 Land Use Actions RECEIPT Permit#: LUA02-119 Payment Made: 10/24/2002 10:06 AM Receipt Number: R0206195 Total Payment: 1,044.40 Payee: INTERFUND TRANSFER Current Payment Made to the Following Items: Trans Account Code Description Amount FZO A11-1 5010 000.345.81.00.0007 Environmental Review 1,000.00 OF��TA 5955 000.05.519.90.42.1 Postage 44.40 Oct FMp�v/NQ Payments made for this receipt *kik Trans Method Description Amount Payment Other 1,044.40 Account Balances Trans Account Code Description Balance Due 3021 303.000.00.345.85 Park Mitigation Fee .00 5006 000.345.81.00.0002 Annexation Fees .00 5007 000.345.81.00.0003 Appeals/Waivers .00 5008 000.345.81.00.0004 Binding Site/Short Plat .00 5009 000.345.81.00.0006 Conditional Use Fees .00 5010 000.345.81.00.0007 Environmental Review .00 5011 000.345.81.00.0008 Prelim/Tentative Plat .00 5012 000.345.81.00.0009 Final Plat .00 5013 000.345.81.00.0010 PUD .00 5014 000.345.81.00.0011 Grading & Filling Fees .00 5015 000.345.81.00.0012 Lot Line Adjustment .00 5016 000.345.81.00.0013 Mobile Home Parks .00 5017 000.345.81.00.0014 Rezone .00 5018 000.345.81.00.0015 Routine Vegetation Mgmt .00 5019 000.345.81.00.0016 Shoreline Subst Dev .00 5020 000.345.81.00.0017 Site Plan Approval .00 5021 000.345.81.00.0018 Special Permit Fees .00 5022 000.345.81.00.0019 Variance Fees .00 5023 0 .00 5024 000.345.81.00.0024 Conditional Approval Fee .00 5036 000.345.81.00.0005 Comprehensive Plan Amend .00 5909 000.341.60.00.0024 Booklets/EIS/Copies .00 5941 000.341.50.00.0000 Maps (Taxable) .00 5954 604.237.00.00.0000 Special Deposits .00 5955 000.05.519.90.42.1 Postage .00 5998 000.231.70.00.0000 Tax .00 • • n: • r :' Vi �. ,}. is ;1. `_ �,''(•. i • (. /' I •( % 1',y /,{.I7.;fbµ' s ...,,( 1 '`•, ) %�� .ly•:f „I ,(' \ ti )' „ ,!' A ' I`� '.,!i . ( '"rn, • ,i , ( ��1-;�.( �' --' I �,r •,-• �.,'.•'0� • I �,:11V. ,• 'r :O O. I %� J O lO �'��� - 1. .�`v :1;\':j.r'. '`.��:� `(`�� y5 � 1'I .l% �. ( i° •�I .- / • � O '�',1..'I ^�_',�1,, y�l ,\(.��f`?'�c\: :I'j/.. _�t / ,'�' _�� r. Lf '� \ /, r ..l 1L;t`a 'IOi' F�-�i -fy e'11°LL 1 '� \ 1; " r • i r N Ff''I(''�\r\ti -Jl . .r/ ✓:.�,-'r :(:�4._ -_ ''a`,� 'j:; '. (' W\,`} , :{:.i;, �J'��' i �i y,4`�L ,C'• /,.' :� I N x O C '\; '� 'c11 `. yj, I.j\'�.,.j . .3 4 ���:{r, ,L.j I ,I" (�f1 .P��.{l;l' '/ .�� - �__ r' • .!� = m 7;:;..��._.'' ;'f (. .'r: �> ,. Y i j r jfl- : , 1 :. ,..:I it 2 1,. 'r ` U rn -r ' '. 0J' V`, , ' Y )'` O 1 (:� �: 'ram,. ` O ''11:" " l J'!''4;"1'j: _ �;j • (.' ' i jr/, ,\ 1.`f 3 \ / ,-r' � 0 .I; Q . i;11,?.� 1•-,��r �'': {µ't j„,:.,.a< \ 'I`' ;"i • O/i1;'I\ )110 ' iell` (`•� 1 `l.r/\`'•V- {^ ' f'l `\ ai CO '1' - - -/..��1i :'1`�. .� �„�: / 1�"!Y....,�'1 %�'�I . C I� F• l�'':•` - -. 1 - ,-�/- .,) �i,--1 '! i l l� •,i' !I,• ..�� �' ��,Jlri:,. l - Y 0,',�nr e' _.')' / r., .1.�. ` !; `-;,1 -}: • '(, ;.'. �.j • ' } - N >-` '. } .`�+ iAiiiii '4�'.'�� '1 ;, r +( `� /,. .Z. `:' : .. • , , i- • ,1 -• -' ,' ' . I'• � •-'''',: (1:•,.,( ;',-. i- ,( .----/,`i/ • !, j' 'r'''1� '/., II, >T• 7 A> / i 1';• 1-•-•• (i Z55.;' -f =i '!tee !, i (f I /n - rf • i'�_ 1 'ice'.\ = Z 1 �''�, rI •'�� °L.' {(r ` '`•ra.':,i' ,,,;. 1. ,` }•_ "ice, •1,4 ;; , i,; .,'r �. r+i ;`:/ , \• \' ).J j^:, \; ,' . .' 4�a,N �t-- • ' _ i`;?,�, .( '1.. �; I r... �y • ,� .,�,j:(;�,i t).; \,''- 'y,'-�'', J 'y �� ,A-_ ,r( •(`. .)1 ) 1',.i�:Y. U>� 9 • i „� H/: • C ,1 ,,, >�r' r ;( / mac' r_. , ..1- ;:��y � r Wit`. �.�!,�' • �\ti-1�.1,�1Uy. �1.: -,+J, "r ' \ 1,' 1! 'ir 'l �I\. ���: / , - Y:,�,`',�.�•. ..1 '-.°.- ;(2 . '`y T \ jt.; r.^ -�:rY- -) ' %- ,,:' ;.i -`�-' A, i •', ..i •�.', J' _ �.JI c �% 't._ ` �., (,,1..!.Y'`,�{,� •: �J-<{�;'�.-�.'\ '�;`i-,: s�: 1,, ,, ,:II. ��( � ;.\��/i f��.l' I. - 'J, j I. , j� ��. '''+'•� - ;r:}'•.I ;}-:-/;.;�,_ f •'.v. GI ,,,,,y_.,., 'i_•,;r`,, '�./'I ::f';' '\!..', .I :!, Ll:,y, _ �`�;/.. �' I _ .�r ..1, t!!=il'� `/,�•: =,. r . : :. � ',,'S".•.•;X;;'. �{�'!, � r�'� )j �tf _ `�,�. I'll \\(,y ; //'\. - a� ��� .3q;. _�� :'E�:�;.. =�'�I:.:�: 1� :�.)� �'J�.� Sri; _T -� = '.,; r -'�:_ ./';SC i.i a. ,/'J `', � f . \;;i�) 1'�.� " flit)' ,;' _ �' � • )�' .f� - '' lY'.•''' r f ' ii Y.r. rh /, ;,: a `yl�`• -4:. <I•, ,(. , 'i C' b% �' .: ;} ) y;; ,' 'd ,y '.fg..-i'. lrl`. \'r'\ri •' )N/ (.",2. `J,.r /, i1 . �7? . 4. ).j-, > F:..,Uc,�%1,., C .;-x h ,,i( , -.,.1 ,'I .f'. •\'-? ~('4( 1( • s''\ \1 /' ? , -/\ J �,_Y lam) •• - •iIf •�,••,�)tjl\Ytij '•` ,.� i /1 l • .,l. - ''/: :�.•,1 J - —1 •c`. •_ 7:'i ,.r 1. �% � � V� r: - 1. ,�.,.�. ',ter. 'C ';`_ ` ; / >' :,�:° f; ?\;2` /...- r, 1 `.1., ram '•I' f" ,, Y``:�;1 '-•' . •• )11. 1:'ir.'. ,, .:!"-: .^:� -•(.•� °` ;.i ..l' _ :\s /'.-t 'i:J' '''''I , ',(( -• i:i. ,.�,4' • ,,: ' ••`/ ). • ;i;.r.—r:\r. -�-�" ,\ :'i.(1: ",. :1, •,G,'. ''?''':; ,}..;.. .lc;ij�'i: -J� ;, C' ),•.Ii '.�e.i( - �',/:r�� �: ( _ "i'<.' • • /:.. /aq:,`\ ?� /rr.:'M'="h{l\ J:�'c.� :,j.-_S., ;.1. v ( 1(. �, �. !",.. it 'P _•.`/ % '^: �A ,',; f/,. .\ .:1.I', .r 1;' , ''J. -L,'ram y ( .ice, f,ri (' -':\i1 ', t I-: •' i:' ,i r •''•\ t( .i- '(�':' ;1'` i�'`1'�•f,? �.ar %•;,/. F_ �i' ' �'!'� / ,i .,/' •i � ;r::r,;�:'.. 1••�1 l;'`x',l ;,, li • •• • �. �.ti={,1{i )'..Yf, .-I,--/.' ' }®.r: 1: ): ;, �l ) 't',jj./ I 1 /:(. +'t; C` . •:C. \✓.''lg._ / !t ?...1, r �l / :,' ;i :(r' ]1/�- ,a.. 1 ' i s _ • t; /. l ....`; ...4.., A_'T:�jr /'�1. ii _N-. ; ,, —.: .-_�' ,r v, /:: 'A �•I y,. ;.. -'�'` ,•.. 11 /,f; .;7 T -a i•• '.. . rr - L s -1 ,,, l'i` ^l, \l • 1 ,(. - /.'�_ • • • a • fl./ v, f( t, ce,[�]� ) / j; ' \.. .��� l.' f '(� • '�f^._:t),5'•.:',� ;.h�'.:i%- t: :'l,!' 'C Y' l: ,>> _ ,.11' •, _ > "{r ` `_,1' , • • /•_',../',.\,L, .iIr r:II�� °'P,� I,L}-.-° ,,�r .�: - �')'- a; ';l,-/ i..,. )�1- r`,•t ,'j'� i,, 7 - ,: .G'. fl'�. . ,,;i` 1 a. .'t,,' l" .-,(: 'r:• 1 r:. `.,I '� - ' ,., •— );l'rC„ Sr,�_e. 1 5 '�'���, `:):' � •.L. �L�'L`- 'y,�. -\`.h. (. ,�-,, � ,1y ,.S• ,I'v. - `b` ';i`,�,. 1?. ;>' a.,',,.,'.J`;�.,. p -}j,. ":j> .., . .-C ,y \ - ,�-1.i1' �1?ii'• \". • I�' 1 \' ;: .:: -.(-.� .-;'35. ;.,, -� y;'.i. •';1.� - , (,`, 'x.1.•,. .t h' . • .i'. �,Y'- l l ' ' ' 1 •:( '/... /:• .,,, :�' /�` _ v d+1J-4. C✓4 .r.> ;: ;4` ,)' %<Iti !, .,., C�, ,� (, p' '.4'?' Lj j,,\. + r ' ; :` v ;':;fin-. .�"�:�..!, .:q:e�'Jur'i •�',/ .{^/J.I' <f-'�, ( 't1 v -), •1 \„\ r„ �y(a 'h- ., fr. r\',`_. ,y_ ' •.'fit \ _ .t. '(•`'" ic ;\f_ .J /}' 1' f;: �; _ r..�,.i1, >1"rVi:/,.n� `-'ypili-,� :' r .l.'. ;/° i' ) 1•% f i , •l,f', r�':;(.1�`.. lY-' '•'G.\,y,,.,�`.i�i/)...I 4/��.,:, b /':� -' ' :,'t;`r'•� , :. { '\ ..l •. i' :/;1. . fin- / (; t • , , (-- ,I'' ,.i.•'c1i4. '(•. .!�'. :i, /'r. (r- . >il i. :. ) j ..1.: A.\: �� • I .!—� I\i , .~r IL.' ,t �•-rs•`-.�'.4.... i ':,. '•, . �•.,,r': s 1, (- ,, ,_ 1.. (' 'i "' .\' ( ,a � '!! `4, :_'Ai �� �;: '.r: ':cam - ` `)>7•''1,1 .V. v '�T`• f�-�`\�'I l , 'T ,\,.�7),i,S'. _.,' `�- )1� \r� f •/ /'�. •,I ., f, L'IL /, ..•:'-;-� >> C; '`. ,V.\.-).Y.4;1_; f ti'?.,j� (:, t f,(',`,i \ .+ t� AI -.l "�:. , / / '.'% l \ !..!...:'...a...:„...;., ,r._` ,. !`'','-1,.j. f'0' .1,�,/`r�.•r?'�1- �'i.Z)J ;� -\" -I, n =, ,l ( ="`"}/. '9 'll� '� ':� _ :f`'jK - `i.'' ''j� '/ � 'L:a,-.w'. ''i` ('''i. rl .r^ ,. `�., `f" -- ',(, /: r,i _I: •i :,i'I \ \ • `. 'lr, .�,;1 .ri!:,` !Y',1%1�;a.,•'; .1.1: - .. - \4,�� y:. . G' ``J:'r • d 7.�' /.. `r',;�a-(.: 1, fir' `; - / 4' -I,. • 1 Final Report Wetland Delineation and Classification Report for the NE 10th Street/Anacortes Avenue NE Stormwater System Improvement Project Submitted to City of Renton 'SY.O October 2001 I CH2MHILL CH21VIIHILL Hans Ehlert and Tim White conducted the wetland delineation.Hans Ehlert prepared the Wetland Delineation and Classification Report. i4t l 0,12 (C)! Hans Ehlert Date Professional Wetland Scientist(Society of Wetland Scientists,#0001165) te./-44r- o/247,/ Tim Wh. e,Ph.D. Date Profess' nal Wetland Scientist(Society of Wetland Scientists,#000305) II 1 Contents 1.0 Summary 1 2.0 Purpose 3 3.0 Wetland Study Methodology 3 3.1 Pre-Field Data Collection 3 3.2 Wetland Analysis 3 4.0 Applicable Regulations 5 4.1 City of Renton Wetland Jurisdiction 5 4.2 U.S.Army Corps of Engineers Wetland Jurisdiction 7 4.3 Washington State Department of Ecology Jurisdiction 8 5.0 Site Conditions 8 5.1 Site History 8 5.2 Soils 8 5.3 Hydrology 9 • 15.4 Wetland Descriptions 10 6.0 Wetland Impact Avoidance 14 7.0 • References 21 Appendices A Field Data Forms B U.S.Corps of Engineers Nationwide Permit 43 C Photographs • Tables 1 U.S.Fish and Wildlife Service Wetland Indicator Status 4 2 Renton Wetland Categories 6 3 Renton Wetland Buffer Requirements 7 4 Wetland Summary 10 Figures 1 Vicinity Map 1 2 Site Map 2 3 Surveyed Wetland Map 12 4 National Wetlands Inventory 15 5King County Wetlands Inventory 16 6 Renton Wetlands Inventory Map 17 • 7 King County Soil Survey 18 8 Water Features,May Creek Basin 19 9 Lower Basin Conditions,May Creek Basin 20 • SEAT:11598871WETLANDS DEUNEATION REPORTIRENTON WETIAND_FINALDOC V WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT i 1.0 Summary The ifollowing report describes the analysis to determine the presence and extent of jurisdictional wetlands on the western 1.5 acres of the±2.25-acre Vuong property.The site is located just outside the City of Renton(City)in King County,Washington(Figure 1). However,if the City purchases the property,the City would annex it before developing the proposed stormwater project.The property,which consists of one parcel,is bounded to the south by NE 10th Street(SE 116th Street),to the east by Chelan Avenue,and to the west and north by residential lots(Figure 2).The site is currently undeveloped. This report is being prepared to help evaluate the feasibility of the site for a proposed stormwater detention pond. Two;wetlands were identified: one on site and one off site.Both exhibited the three parameters characteristic of a wetland(i.e.,soils,vegetation,and hydrology).Wetland B was identified on site,is 3,070 square feet(ft2),and meets the City's criteria for a Category 3 wetland,except that it is less than 5,000 ft2;therefore,the City would not regulate this wetland,but the U.S.Army Corps of Engineers (COE) could.Wetland C was identified off site,is larger than 1,000 ft2,and meets the City's criteria for a Category 2 wetland.Both the City and COE would regulate Wetland C. The City's wetland categories indicate the quality and value of wetlands;the criteria are described later in this report. Possible impacts to Wetlands B and C could result from construction of the proposed stormwater detention pond. FIGURE 1 Vicinity Map Wetland Delineation and Classification Report I � 4 : Il� f:j 'IoNe ica ;'}lee s _.1..; :irge g7,..*‘;. IL-,:7'.4 "..en,i,..-C, s.. .'.,, , ":'Y,..F.:.;:,... . ;',"` --,'''''.'" 3r.i;': ri'Y3-5•-i-s- ,�r,U'J � g ^ g�'(]mil�.��.. .y••. - - :- :1_.`; Ems' ' - , ,, Nt� =maj ,Ii�yr-,-' i _- )&'••• ti.,T ILA- ��fLLQ' NWitk �.w�?3 is ,c... 7.6— .l`:'^^i1 -"_. .. '..1;;:,..' 1!! ��tl l �a5%X"ss B `SA 128]. .''"i"--i,�i; o d,it Li- -w ...t ui:r,F'• �d`,'4�g.&'�i.7T.. °A�a.r�:r.\"a� .� "J�_ �OOQ`•�^3._,.:` '�>Q�'�'�•i 1 ;. '.. - l y,,l"' `;../J' M 5'-r.•' urr :t i< ;;ter, k:.n�'; w 'alile6 d', . : ", .i. a, ,11 .. :u: rot:_. !' liE'r' s'eig a k-j; r il '. ' ,yr..3ye+r .C• i .y.* Y err<. :L : .. weiii >t Lj; r �f'-sx z',..�, ti'@�S.,t.r''dc,^<'-'6kc:""�x.k�'. fin;.:<-:!' ..�[ •%^_v. 51.5_�? �:_.�v��' [r(v�. :s r..ti.,p��y;.�ts.�8► a.,.,h�;cw.Y,'�' c>� . �;,�F�:... ©.1989 M pCdue'steam:,Inc C1I fl9:NaGgatoh%Te"dinolbi7es,�e '1�N:.-. =it%::r:.'=ft. I SEA1E:11598671WERANDS DELINEATION REPORT\RENTON_WETLAND_FINALDOC 1 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT FIGURE 2 Site Map Wetland Delineation and Classification Report • 1ssaaceA1ts`�I 91 dt y. • ,•ter .r 3",,itr '`. iy r k. • �'n `�yam- t h.e j._;:.. �V P I A 1 R I", -t •i !A +I:'A • _ •(� C.L y 3�y ��£ xI ��. in �Y7 R; R'.t l• sot x` - S� "y � e M1',{S - r`1t S,,,,,,..,. .....__,Az,.i - .;. .3�.' �F.J-C •.-,- s4 " rc•'t T ''i ax.�. ,__ s+tL Y..�` , •. 1 1 .. ,rti y q' r 4 i4 �` E - „y7. 3 t .41541.,`. i �; .z :. I Property 3'$-- . „ ,e: 7 pa. E.. k. ....x gin,•A43 4 y �ji & • } g� 1 .` t,-a S``� '3 �aftir•• r ",y'r1,rL,>'4•ei ,. t 4 o 1 r cx ,t '' 1 � •a i ?,l y-4 x,�q 3. 1 ,2 ' 3's ' ,4 kE" 1# Otentlal I '4` rL� .. ) .sR 4r".�, �',l �h - L "'Detention fi 1 *• `s 01 mar- y*r ;'�'� . x `�',`""' { Ia ,ete Site : a kt' t d `„`,'w Y e $1; . t -c. .3@,. t, .''1a. - a r of 2'h 1•4 l +'3, r•+• ,1,.- . 5 3. ak,.'kf �R S < %1^i 9" §.- 1 1... +A 1 L y i Y • s1°" i,.ra a. r 4.'i 1 I '' Iom' "` '.},.• a t s, ; ,A,x t'1 • t-r- s ♦ .. r `i«.:;, t1 ...R ;`ys ., - _ r 13 t 1- s- - r ,.t.-.... 'r'' '..*4c �.. c.3•t.:s'h�a.<. :•.w.ww+c_-'-''. `8 " ;7��s' Scale:—1-=500' • • • SEA111SIMBALPROJ1159867\WETLANDS DELINEATION REPORTIRENTON_WETLAND_FINALDOC 2 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT 2.0; Purpose The purpose of this wetland delineation is to objectively determine the presence and extent of jurisdictional wetlands on the western 1.5 acres of the±2.25-acre Vuong property to help evaluate the feasibility of the site for a proposed stormwater detention pond. 3.0 Wetland Study Methodology 3.1 Pre-Field Data Collection Prior to conducting the on-site wetland analysis,existing information for the site was collected and reviewed.This information was overlaid on the project site map to identify potential wetland areas requiring detailed field investigation: • U.S.Fish and Wildlife Service(USFWS)National Wetlands Inventory(NWI),Mercer Island Quad • May Creek Current and Future Conditions Report(Foster Wheeler et al.,1995) • King County Sensitive Areas Map Folio(King County,1990) • U.S.Soil Conservation Service Soil Survey of King County Area, Washington(Snyder et al., 1,1973) and Hydric Soils List,King County Area, Washington(NRCS,2000) 3.2 Wetland Analysis 3.2.1 Methods CH2M HILL assessed the site for wetlands on August 10,2000,using methods of the Corps of Engineers Wetlands Delineation Manual(Department of the Army Environmental Laboratory,1987)and the Washington State Wetlands Identification and Delineation Manual (Washington State Department of Ecology,1997),for"Routine Determination"with on-site inspction.The wetland boundaries were delineated in the field by observing plant communities,evaluating soil conditions,and observing standing water and/or saturated soils.The delineated wetland boundaries were located using standard land surveying methods. Where access was allowed,wetlands on adjacent properties within 100 feet of the Vuong property were also delineated and classified,as required by City ordinance.Where access was denied,identification and dassification of wetlands on adjacent properties was limited to visual observation from the Vuong property. Field data were collected to support the wetland delineation(Appendix A).Observations of vegetation,soils,and hydrology at representative sample plots(upland and wetland)were documented.Habitat identified as wetland was dassified in the field using Cowardin et al. (1979). 3.2.2 Vegetation Presence of wetland vegetation was determined according to information found in the National List of Plant Species that Occur in Wetlands:National Summary for Region 9(Reed, SEAT:\159867\WETLANDS DEIJNEATION REPOR1\RENTON_WEILAND_FINALDOC 3 - I WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT 1988)and the Supplement to National List of Plant Species that Occur in Wetlands:Northwest (Region 9) (USFWS,1995).These sources assign wetland and nonwetland plants to a range of classifications,based on the prevalence of their occurrence in either wetland or upland areas.A plant's dassification is referred to as its"indicator status" (i.e.,whether it indicates the presence of wetlands). Within a 2-meter radius of each sample plot,dominant plant species were determined for each vegetative stratum:herb,woody vine,shrub,sapling,and tree.Percent cover of most species in a plot was estimated and the indicator status recorded.Dominant species were assigned based on at least 20 percent cover within a stratum.Plots where more than 50 percent of the dominant species were facultative,facultative wetland,or obligate wetland species were considered to have hydrophytic vegetation(Table 1)and,therefore,to meet the wetland vegetation criterion. • TABLE 1 U.S.Fish and Wildlife Service Wetland Indicator Status Wetland Delineation and Classification Report Classification Percent Occurrence in Wetlands Obligate Wetland(OBL) More than 99 Facultative Wetland(FACW) 67 to 99 Facultative(FAC) 34 to 66 Facultative Upland(FACU) 1 to 33 Obligate Upland(UPL) Less than 1 No Indicator(NI) Insufficient data to determine indicator status Source: Reed(1988). 3.2.3 Soils Data on soil texture and color,presence of mottles and/or concretions,organic matter content,moisture content,and presence of oxidized root zones were recorded.Using Mu1isell®color charts,soil matrix,and mottle colors(hue,value,and chroma)were determined immediately below the A horizon,or within the surface(10 inches)if no A horizon boundary occurred before that depth.Munsell®soil colors are reported in the wetland descriptions below in parentheses following the soil color description.Soils with low'c.hromas(i.e.,two with mottles present;one or less independent of mottles)or soils with high organic accumulations in the upper horizon(i.e.,muck or peat layers or heavy organic sta x ing)indicated the presence of wetland or hydric soils and,therefore,meet the wetland soils criterion. 3.2.4 Hydrology Visual observations of soil saturation,surface inundation,visible drainage patterns, deb ris/sediment deposits,and surface scour were recorded.Depth to water in unlined boreholes was measured after allowing sufficient time for water to accumulate.If any of these characteristics were observed,wetland hydrology was considered to exist. SEAIE1159867\WETLANDS DELINEATION REPORTRENTON_WERAND_FINALDOC 4 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT 3.2.5 Wetland Boundary and Sample Plot Markings Wetlands were delineated with red-and-white striped flagging numbered alphanumerically. Orange flagging marked numerically("SP-#")was used to mark sample plots where site- specific soils,vegetation,and hydrology data were collected and recorded. 4.0 Applicable Regulations Wetlands regulations applicable(or expected to be applicable) to this project include those of the City,the U.S.Army Corps of Engineers(COE),and the Washington State Department of Ecology(Ecology).The site is currently located in King County;however,if the City decides to purchase it,the City would also annex it,and the site would then fall under the City's jurisdiction.Permitting would vary,depending on the specifics of any project proposed on the subject property.These agencies will ultimately determine the applicability of the regulations. 4.1 City of Renton Wetland Jurisdiction The City's wetland regulations are embodied in their critical areas regulations(Ordinance No.4835,RMC 4-3-050).The purposes of their wetland regulations are to accomplish the following: a. Ensure that activities in or affecting wetlands not threaten public safety,cause nuisances,or destroy or degrade natural wetland functions and values;and b. Protect public health,safety,and welfare by minimizing and managing the adverse environmental impacts of development within and adjacent to wetlands;and • c. Preserve,protect,and restore wetlands by regulating development within them and around them;and d. Protect the public from: (1) Preventable maintenance and replacement of public facilities needed when wetland functioning is impaired;and (2) Costs associated with repair of downstream properties resulting from erosion and flooding due to the loss of water storage capacity provided by wetlands;and (3) Unnecessary costs for public emergency rescue and relief operations;and (4) Potential litigation on improper construction practices occurring in wetland areas; and e. Provide City officials with information to evaluate,approve,condition,or deny public or private development proposals;and f. Prevent the loss of wetland acreage and functions,and strive for a net gain over present conditions. For establishing buffer widths,replacement ratios,and avoidance criteria,the City's ordinance(RMC 4-3-050-B.7.b)requires that wetland categories be designated according to the criteria in Table 2. SEA1E:11598671WETLANDS DELINEATION REPOR11RENTON_WETLAND_FlNALDOC 5 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT TABLE 2 Renton Wetland Categories(per Ordinance 4835,RMC 4-3-050-B.7.b) Wetland Delineation and Classification Report Category Description Category 1: Category 1 wetlands are wetlands which meet one or more of the following criteria: Very High 1. The presence of species listed by Federal or State government as endangered or Quality threatened,or the presence of essential habitat for those species;and/or Wetlands 2. Wetlands having 40 to 60 percent permanent open water(in dispersed patches or otherwise) with 2 or more vegetation classes;and/or 3. Wetlands equal to or greater than 10 acres in size and having 3 or more vegetation classes, one of which is open water;and/or 4. The presence of plant associations of infrequent occurrence;or at the geographic limits of their occurrence;and/or 5. Wetlands assigned the Unique/Outstanding#1 rating in the current King County Wetlands Inventory 1991 or as thereafter amended. Category 2: Category 2 wetlands are wetlands greater than 2,200 ft2 which meet one or more of the following High Quality criteria: Wetlands 1. Wetlands greater than 2,200 ft2 that are not Category 1 or 3 wetlands;and/or 2. Wetlands that have heron rookeries or raptor nesting trees,but are not Category 1 wetlands; and/or 3. Wetlands of any size located at the headwaters of a watercourse,but are not Category 1 wetlands,and/or 4. Wetlands assigned the Significant#2 rating in the current King County Wetlands Inventory 1991 or as thereafter amended;and/or 5. Wetlands having minimum existing evidence of human related physical alteration such as diking,ditching,or channelization. Category 3: Category 3 wetlands are wetlands greater than 5,000 ft2 which meet one or more of the following Lower criteria: Quality 1. Wetlands that are severely disturbed.Severely disturbed wetlands are wetlands which meet Wetlands the following criteria: a. Are characterized by hydrologic isolation,human-related hydrologic alterations such as diking,ditching,channelization,and/or outlet modification;and b. Have soils alterations such as the presence of fill,soil removal,and/or compaction of soils;and c. May have altered vegetation. 2. Wetlands that are newly emerging.Newly emerging wetlands are: a. Wetlands occurring on top of fill materials;and b. Characterized by emergent vegetation,low plant species richness,and used minimally by wildlife.These wetlands are generally found in the areas such as the Green River Valley and Black River Drainage Basin. 3. All other wetlands not classified as Category 1 or 2 such as smaller,high quality wetlands. Category designations for each wetland involved in this project are described below under Wetland Descriptions.Width of buffers required to protect wetlands is based on wetland categories,as shown in Table 3. Activities within regulated wetlands and/or buffers include both activities that directly remove or alter wetlands(e.g.,excavation,filling,placement of pilings or structures,vegeta- 1 SEA1E:11598671WETLANDS DEUNEATION REPORi1RENTON_WETLAND_FINALDOC 6 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT tion removal)and activities that affect wetland functions(e.g.,disturbance of water levels, changes to water temperature or physical characteristics,application of pesticides or other chemicals).In addition to measures to protect directly affected wetlands,the City may require protection measures or erosion control measures to provide protection of a wetland and buffer when any of the regulated activities are proposed on a site,but are not within a wetland and/or buffer.Regional stormwater management facilities operated by the City may receive an exemption from the City wetland regulations and may be located in a critical area or buffer. TABLE 3 Renton Wetland Buffer Requirements Wetland Delineation and Classification Report Wetland Category Standard Width 1 100 feet 2 50 feet 3 25 feet Source: Renton Ordinance No.4835,RMC 4-3-050-M.6. All activities within regulated wetlands and/or buffers must be mitigated according to City Ordinance No.4835 (RMC 4-3-050-M.9).The overall goal of any compensatory project shall be no net loss of wetland function and acreage and to strive for a net resource gain in wetlands over present conditions.The concept of"no net loss"means to create,restore, and/or enhance.a wetland so that there is no reduction to total wetland acreage and/or function. The City's Ordinance exempts Category 2 wetlands smaller than 2,200 ft2 and Category 3 wetlands smaller than 5,000 ft2 from regulation. 4.2 U. S. ArmyCorpsEngineers of En ineers Wetland Jurisdiction Placement of fill in wetlands within the City is also regulated by the COE and requires a permit under Section 404 of the Clean Water Act(CWA) .Currently,the COE regulates only those wetlands delineated under its 1987 Corps of Engineers Wetlands Delineation Manual (Department of the Army Environmental Laboratory,1987). The COE issues two types of wetland permits:individual and nationwide.Nationwide permits are prescriptive and apply to a limited set of activities that meet certain conditions. Recent changes to the nationwide permit program(U.S.Army,2000a)would apply to a qualifying project if unavoidable impacts to wetlands were proposed.Individual permits are required for activities that are not covered under the nationwide permit program. Depending on the specific details,Nationwide Permit 43(NWP 43,Stormwater Management Facilities)might apply to this stormwater system improvement project.The complete text for NWP 43 is attached in Appendix B.Basically,this nationwide permit applies to discharges of dredged or fill material for the construction and maintenance of stormwater management facilities,including activities for the excavation of stormwater ponds/facilities,detention basins,and retention basins;the installation and maintenance of SEA1E:11598671WETLANDS DELINEATION REPORITRENTON_WETLAND_INALDOC 7 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT water control structures,outfall structures and emergency spillways;and the maintenance dredging of existing stormwater management ponds/facilities and detention and retention basins,provided the activity meets specific criteria(Appendix B). Due to a recent court ruling,the COE may no longer regulate isolated wetlands.The U.S. Supreme Court recently rejected the COE's claim to jurisdiction over isolated,intrastate waters(Solid Waste Agency of Northern Cook County vs.U.S.Army Corps of Engineers, January 9,2001).The court's opinion goes beyond the migratory bird issue and means that no intrastate,isolated water is subject to the provisions of Section 404(a) of the CWA (regardless of any interstate commerce connection). Projects requiring a federal permit decision(i.e.,both nationwide and individual 404 permits)also require compliance with the Endangered Species Act(ESA) (U.S.Army,2000a and I2000b).Projects that are considered"not likely to affect"or"likely to affect"threatened and/or endangered species will require a biological evaluation/biological assessment (BE/BA).The COE is experiencing significant delays reviewing projects for ESA compliance and consulting with other federal agencies(e.g.,National Marine Fisheries Service [NMFS] and/or USFWS).As a result,nationwide permits,which were once relatively simple to obtain,now must be submitted well in advance of construction(in many cases a year or more)due to ESA. 4.3 Washington State Department of Ecology Jurisdiction Section 404(b)permits also require a Section 401 Water Quality Certification from Ecology. An individual 401 certification is required for certain projects affecting wetlands. Ecology has the authority during the permitting process to review development plans,impacts to wetlands,and the proposed mitigation measures. 5.0 Site Conditions 5.1 Site History The history of the subject site is not known.The site is currently undeveloped;however,at one time the site was cleared and seeded with common pasture grasses.The site might have once been used as pasture.Minor earthwork was done to cut a short ditch,which might convey septic overflow or gray water from the residence located at the southeastern corner of the,site.Residential lots adjoin the site to the west.On several of these adjacent lots,fill has been placed,retaining walls constructed,and fences erected. 5.2 11 Soils The Soil Survey of King County Area, Washington(Snyder et al.,1973)reports Alderwood gravelly sandy loam as the dominant soil on the property.This soil type is not listed as a hydric soil(NRCS,1992).However,actual soil conditions on site varied from what was reported. Alderwood gravelly sandy loam,6 to 15 percent slopes (Map unit AgC). Alderwood soils are moderately well drained and have a weakly consolidated to strongly consolidated substratum at a depth of 24 to 40 SEA1E:11598671WETLANDS DELINEATION REPORTIRENTON_WETLAND_FINALDOC 8 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT it '- inches.These soils typically occur on uplands.They formed under conifers,in glacial deposits.However,it is not unusual for inclusions of poorly drained(hydric)soils such as Norma,Bellingham,Seattle, Tukwila,and Shalcar to occur in areas mapped as Alderwood. Permeability of this soil is moderately rapid in the surface layer and subsoil,and very slow in the substratum.Roots penetrate easily to the consolidated substratum where they tend to mat on the surface.Water moves on top of the substratum in winter.Available water capacity is low.Runoff is slow to medium,and the hazard of erosion is moderate. The geotechnical investigation(CH2M HILL,2001)completed concurrently with this wetland investigation discovered dark brown,stiff/medium dense sandy silt to silty sand with scattered organics at the ground surface.Approximately 20 to 25 feet of glacial till underlay the 2-to 3-foot-thick surficial layer: 5.3 Hydrology The site is located in the Honey Creek subbasin,which drains to the May Creek watershed, and eventually to Lake Washington.Albeit limited,coho salmon are known to rear and spawn in approximately the lower one-half mile of Honey Creek(Foster Wheeler et al., 1995),which is approximately one mile downstream from the Vuong property. The site is located at the headwater of a small,unnamed tributary(0285A) that drains into the upper part of Honey Creek(Foster Wheeler et al.,1995).However,development has occurred north of the site and it appears that the northern part of tributary 0285A has been culverted and is no longer an open channel connecting to Honey Creek.In addition,a large portion of Honey Creek north of the project site was culverted in the last 30 to 40 years.Fish passage to the upper portion of Honey Creek might be difficult or impossible due to • impeldiments and blockages,beginning where Honey Creek runs under Union Avenue NE, approximately two-fifths mile northeast of the site. Water was not directly observed on the site during the delineation.However,indicators of hydrology were used to infer its presence or absence.Direct observation and measurement of surface water and shallow groundwater are more conclusive determinants of the presence and extent of wetland hydrology.To better understand the hydrology of the site, direct observation should occur in the early growing season(late February to early March). The geotechnical investigation(CH2M HILL,2001)summarizes the results of groundwater monitoring that was conducted from August 2000 to May 2001 using piezometers installed at thel site.The piezometers were installed in boreholes 30 feet deep(B-1)and 8 feet deep (B- 1A).Piezometer B-1 detected water only for the first reading in August 2000,at a depth of 29.0 feet below ground surface(bgs);water was not detected during any other readings. Readings at Piezometer B-1A recorded groundwater fluctuations from 4.0 feet to 12.8 feet bgs.These results indicate that water is perched in the upper till layer throughout much of the year,if not year round.However,it should be noted that this year has been one of the drier years on record;therefore,groundwater levels may have been lower than normal. • SEAT:1159 671WETLANDS DELINEATION REPORTIRENTON_WELAND RNALDOC 9 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT 5.4 Wetland Descriptions CH2M HILL identified one wetland on site and one off site,which are summarized in Table 4.The soils,vegetation,hydrology,rating category,and functions of these wetlands are described below.The approximate location of each wetland is depicted in Figure 3.The wetland acreage reported is calculated from the survey of the delineated boundaries. The wetlands delineated are palustrine,which describes "...all non-tidal wetlands darn inated by trees,shrubs,persistent emergent vegetation,emergent mosses,or lichens..."(Cowardin et al.,1979).Palustrine wetlands are further divided into dasses and subclasses based on characteristics of their substrate,dominant vegetation,and flooding regime. During the delineation,normal environmental conditions were present in the area,and the growing season was well advanced. TABLE 4 Wetland Summary Wetland Delineation and Classification Report Wetland Approximate Cowardin classy Renton wetland Renton buffer wetland a category width(feet) B—On site 3,070 ft2 b PEMC 3° NA C.d l C—Off site 1,033 ft2 e PFOC 2 50 d aCowardin et al.(1979): PEMC = palustrine emergent,seasonally flooded PFOC = palustrine forested,seasonally flooded bWetland area surveyed on site. °Category 3 wetlands less than 5,000 ft2 are exempt from Renton wetland regulations;however,it would still be regulated by the COE. dCOE may require vegetated buffers,but usually only related to mitigation plans. eRepresents off-site wetland area surveyed only within 100 feet of the site. 5.4.1 Wetland B General Description.Occurring completely on site,Wetland B is a small,isolated wetland with a surveyed area of 3,070 ft2(Figure 3).It is located in the west-central portion of the site.See Appendix C for a photograph of Wetland B.Data from two sample plots were collected(Appendix A).This wetland was not identified on the NWI map (Figure 4),King County Wetland Inventory(Figure 5),Renton Wetlands Inventory Map(Figure 6),the King County soil survey(Figure 7),or May Creek Basin Water Features Map (Foster Wheeler et at.,1995)(Figure 8). 1. This wetland is not accessible to fish and does not provide habitat suitable for fish rearing or spawning. Soils.Snyder et al. (1973)identified the soils as Alderwood gravelly sandy loam,which is not listed as a hydric soil in King County(NRCS,2000).However,soils observed in Wetland B in the B horizon(12 to 14 inches bgs)were very dark brown(10YR 2/2)gravelly silty loam with dark yellowish brown mottles(10YR 3/6),which does not match the description for Alderlwood.See SP-02 in Appendix A. SEA E\1598671WETLANDS DEUNEATION REPORTIRENTON_WETLAND FINALDOC 10 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT Soils observed in the B horizon(10 to 14 inches bgs)in adjacent uplands were dark yellowish brown(10YR 4/4),which more closely matches the description for Alderwood. See SP-01 in Appendix A. Vegetation.Wetland B is dominated by palustrine emergent vegetation(PEM),with several isolated shrubs.Vegetation is dominated by slough sedge(Carex obnupta;OBL).Also occurring,but not dominant,were,soft rush(juncus effusus;FACW),daggerleaf rush(Juncus ens folius;FACW),small-flowered willowherb (Epilobium minutum;NL),bull thistle(Cirsium vulgare;FACU),red elderberry(Sambucus racemosa;FACU),colonial bentgrass(Agrostis tenu�is;FAC),and cut-leaf blackberry(Rubus laciniatus;FACU+). Adjacent uplands are dominated by cut-leaf blackberry and colonial bentgrass,with scattered red elderberry,bracken fem(Pteridium aquilinum;FACU),timothy(Phleum pratnse;FAC-),and velvet grass(Holcus lanatus;FAC). Hydrology.The sources of water to Wetland B are primarily precipitation and shallow seasonal groundwater from the adjacent drainage area.No streams or culverts flow into Wetland B,but a defined intermittent drainage flows from Wetland B(See Wetland C below).A ditch from the house to the east drains to Wetland B.This ditch is believed to be a septic overflow or gray water line. No sltanding water or soil saturation was observed during the field visit.The wetland appears to be seasonally flooded,but becomes dry in summer.Wetland B occurs in the headwaters of a small,unnamed creek that drains to Honey Creek and is identified in the May Creek Basin Lower Basin Conditions Map as stream 0285A(Foster Wheeler et al.,1995) (Figure 9).However,the northern part of the unnamed creek appears to have been culverted and is no longer an open channel.Also,a large portion of Honey Creek north of the site has been culverted. The presence of both wetland and upland plants in Wetland B indicates that water is present in the early growing season,but drains rapidly enough to allow upland plants an opportunity to establish and develop in the late spring,summer,and fall. Wetland Category.Applying the City's rating(Table 2),Wetland B is considered Category 3.The basis for this rating is that Wetland B is hydrologically isolated with low-diversity emergent vegetation that has been altered.Wetland B is less than 5,000 ft2.Category 3 wetlands less than 5,000 ft2 in size are exempt from the City's wetland regulations(RMC 4- 3-0501-B.7.a).A letter of exemption from the City would be required. A permit or exemption to build in Wetland B would be required from the COE.Permitting with the COE would depend on the nature of the wetland impacts associated with the proposed stormwater system improvement project.As discussed above(Section 4.2,U.S. Army Corps of Engineers Jurisdiction and Appendix B),Nationwide Permit 43 for stormwater management facilities would likely apply to this project.Mitigation might be required.However,due to the recent court ruling mentioned previously,it is also possible that the COE might not regulate this isolated wetland. SEA1EU1598671WETLANDS DEUNEATION REPORT%RENTON-WETLAND FINALDOC 11 • C-4 CC-4 1 I _ SITE LOCATION INFORMATION L------ BWOUNDARY (SURVEYED AUG 00) LEGAL DESCRIPTION SECTION 10, T23N, R5E 0C-3 PARCEL NUMBER 1023059129 CC-3 ' ' ADDRESS 13642 SE 116TH ST. , , SP-05 1 1 CC-2 A 0-2 1 / 1 a5 cc-I r �'_��" "A.&m.. .., --..... �,., WIRE FENCE 'y I4 tt 1 1 wry / I' , r, Ea 1 i 1 Z I, SP 03t tt tt 1 1 S dt , I II t 1 ''- i. ',BLACKBERRIES -.1 r I 111 5 y 0I \ l 1 I 1 I I I t 1 3 cc' I i t i I 1 '1 r 1 t I t t L J-L. I t 1 i t t l t t 1 r + I tit , 1J t 1 / 1 1 1 + I t pi 1 1, (S I r + 1 i I I I t t + PRELIMINARY i• /� ! I 1 I t it I I xi t / 1 I t A. 1 t t POND LOCATION r I t I s I T t I t t t J 14,0' 1 I I I tt1 t I t t t r/ I t 1 t t ( ' ' t1 t t t` I 1 1 �—s 1 I t O \, , I u/ll ; t 1 V1 i 11 Il ; tt t1 tt 1 z I BLACKBERRIES 1 I 1 1 It t , I t \t t 4 1 t , t I t 1 / r r t ' I 1 1 t ZI 60',' 1 1 t '� ®" t r t = / SP-04 c -'( y ( 1 I 1 \ U I i I t I t t • II 1 t S' i t BORING1B-1 3.1 .1I I 8 ACKB RIES PIEZQMETER .' ( ' I t I I I .1 s BORING 8-1 1 2=1 ,f t1 t5 1t FOUND %"1EBAR� -t t I ( J I I I I I 5 I t t 1 I t I • c FENCE CE . 3 l t 1 CN Al rt/060 tt PO§T 88M FENCELINE GAP IN i .8-6 x I r WETLAND I N 151484_67 t7 -, e 1 --'6k8-5 t BOUNDARY E 1/312801,060, r e , 1 (SURVEYED I EIT 418.41 , �( t r r Al(G.8/001 1 I , I t i FOUND �/�" TB-7 r rt ' -� I i I I / l 4"11D TILE PIPE IP W/ PLUG t I Ir ! ®4' 3 -. ,,f ,/ ,/TIP OF PIPE - 419.75 BOTTOM HALF OF PIPE 53 8 S�-02 t rr t'e t-` r / /f BROKEN AWAY t 83 1 II 1 I , / I FOUND 1I/i" 1r B-�i I r 1 / /1 / ,/ t,,, IP W/ PLUG y I t l / ,I` , , -- I 1 r I I t / t I X' r 1! 8-1/ I r 1 ) 1 I I I l 4� 1 , B-10 1 ., I , 1 r r rr 1 A I 4 t 3 , 1 t 1 l r f I 1 SP-01 t .s.` L I 1 tt I r tt rr 1 + i,f } (r It I + , J ' t B-2 r + t , , r I I I c� w 1 t r I r , Il z c.7 , I-'L t l i ta 1 ! r r t II 1 ,I A it r p t r , , f p z 1 r C4. j It ll 7 ,I t ilk)V 1 I ^ Z t , 1 /. , 1 r !X I I I / /41) = r f 1 1 1 f / / / 36" , U / r t / / FOUND REBAR & CAP SOIL 1 I I lI t / f / / , O 36" BEGIN SPLIT BORING S=2 s BLA BERRIES I l , ,r!{ q IIt I RAIL FENCE 1 1 t W t ' 1 EFE ` I a r S.E. I-12M rr 1020 .E.116TH ST. PK NAIL N 1 N 184961.486 762.856 NE 10TH STREET/ E i312 EL 418.25 ANACORTES AVE. NE DETENTION POND 0Isna 20 40 60 SURVEYED WETLAND MAP Scale In Feet 1 FIGURE 3 I • WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT Wetland Functions.Wetland B provides low biological support due to limited habitat features,small size,and adjacent residential land uses.Despite its small size, the dense vegetation in Wetland B likely improves water quality that might be affected by flow from a possible septic overflow or gray line outlet located approximately 60 feet uphill to the east. Wetland B provides some water storage,but this function is limited by its small size.Its small size and isolation also limit the hydrologic support function. 5.4.2 Wetland C General Description.Occurring off site to the north,Wetland C is a narrow,linear wetland associated with an intermittent drainage identified as stream 0285A(Figure 9) on the May Creek Basin Lower Basin Conditions Map (Foster Wheeler et al.,1995).However,there is no sigrficant channel development in this reach.This wetland is not likely accessible to fish and does not provide habitat suitable for fish rearing or spawning. The portion of this wetland occurring within 100 feet of the subject property has a surveyed size of approximately 1,033 ft2.The wetland extends northward but was not delineated beyond 100 feet of the subject property.Data was collected from a sample plot in Wetland C (Appendix A).This wetland was not identified on the NWI map(Figure 4),King County Wetland Inventory(Figure 5),Renton Wetlands Inventory Map (Figure 6),or the King County soil survey(Figure 7).However,the May Creek Basin Water Features Map(Foster Wheeler et al.,1995) identifies Wetland 50 north of the subject property,forming the headwaters of a small tributary(0285A) to Honey Creek(Figures 8 and 9). The following is an excerpt from the May Creek Current and Future Conditions Report describing the habitat of Wetland 50 (Foster Wheeler et a1.,1995): Current Conditions:This 2.6-acre Class-2 wetland inventoried by the City of Renton is the headwater to a very small tributary(0285A) to Honey Creek.The wetland is predominantly forested with deciduous trees, including aspen(Populus tremuloides).A small portion has been converted to lawn.The wetland provides moderate to high levels of groundwater discharge,floodflow alteration,and wildlife habitat.In spite of these important functions,this wetland has been severely disturbed by filling and buffer removal.Residences appear to have been built in the wetland on fill,with cultivated backyards ending at the current wetland boundary.Cat and dog intrusion is intense,and considerable trash dumping has occurred. Future Conditions:This wetland occupies an important landscape position and provides significant beneficial functions.Because it is surrounded by residential development,this wetland will continue to be subjected to the same intensive disturbances it currently experiences,and will decline from ongoing vegetation removal,trash dumping,and the • like.The wetland could benefit from a community clean-up and education effort. Soils.Snyder et al.(1973)identified the soils as Alderwood gravelly sandy loam,which is not listed as a hydric soil in King County(NRCS,2000).Soils in Wetland C were difficult to SEA1E11598671WETLANDS DELINEATION REPORTIRENTON WETLAND_FINALDOC 13 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT observe because of the dense gravel layer located near the surface.Soils were assumed to be hydric due to indicators of standing and flowing surface water. Vegetation.The wetland is dominated by palustrine forested vegetation(PFO).The generally native,undisturbed vegetation in Wetland C is dominated by an overstory of Oregon ash(Fraxinus latifolia;FACW),black cottonwood(Populus balsamifera;FAC),and red alder(Alnus rubra;FAC);the understory is dominated by seedlings and saplings,suggesting that the hydrologic regime is being maintained.Understory vegetation occurring,but not dominant,indudes soft rush,dustered rose(Rosa pisocarpa;FAC),Himalayan blackberry (Rubus discolor;FACU),English ivy(Hedera helix;NL),and creeping buttercup (Ranunculus repens;FACW). Hydrology.The sources of water to Wetland C are primarily precipitation and shallow seasonal groundwater from the adjacent drainage area.No streams flow into Wetland C. Altliough actual inundation or saturated soils were not observed,hydrologic indicators present include evidence of surface scour,standing water(bare soil with stained,matted leaves),beer cans and a baking pan,which likely were carried into the wetland and deposited by water.The wetland appears to be intermittently flooded,but becomes dry in summer.Wetland C forms the headwaters for an unnamed stream that drains to Honey Creek.However,the northern end of the unnamed stream appears to have been culverted. Also,a large portion of Honey Creek downstream of the project site has been culverted. Wetland Category.Applying the City's rating(Table 2),Wetland C is considered Category 2,requiring a 50-foot buffer(Table 3).The basis of this rating is that Wetland C is hydrologically connected and is located at the headwaters of an intermittent watercourse. Wetland C would be regulated by both the COE and the City;therefore,construction in the wetland or its buffer would require apermit or an exemption. • Wetland Functions.Wetland C provides moderate biological support due to its structural diversity;however,this support is limited by disturbance from the adjacent residential land uses.The combination of shallow gradient,occasional depressions,and vegetation in Wetland C likely helps maintain water quality.Wetland C provides some water storage in. the depressions,but this function is limited by its narrow configuration.The hydrologic support function is also limited by its small size and intermittent character. 6.0 Wetland Impact Avoidance Any unavoidable impacts to Wetlands B and C related to the proposed stormwater detention pond would be determined during the detailed engineering design and would be mitigated according to applicable regulations.The consequences of pond construction in this area could be drawdown of Wetland C or a change in flow to the wetland.Mitigation for or prevention of these consequences will be examined. SEA1E.1159867\WETLANDS DELINEATION REPORTIRENTON WETIAND_FINALDOC 14 WEFLAND DELINEATION AND CLASSIFICATIONREPORTPFORO PROJECT THE T 1 1 NE 10TH STREET/ANACORTES AVENUE NE STORM WATER SYSTEM IMPROVEMENT FIGURE 4 .1 National Wetlands Inventory Wetland Delineation and Classification Report Ic . __ - 16, ,: -..- - .76,-, , 1J ,a,i,:s.--:.--_-,- ' • ..,..,-, ., i-----,-4-4-.4- s..--..„,„.......„,-"\ PP.-- --------...ch,, 4 n - - •-- ---_t -::-.72-,`, ' .' • -- ' /l' !1), VIINI 4 r- .. Ir 1 nw4,,- "•!.;*-- .‘-,‘..;-.- '-;' - , ,_, -, , _\ • 4 iie: to- .1;i4ior.,:tur. .„ - s --, ,•N,\, !-.., ::,g,'.7::::.;•. .-r,',‘-, :;,'.i':;,', /—c-L!-e-_‘-_-1 1 - 4, No\ \\ ..,,:.,,,,:•,„,...,.:.,z-,,,,,,,,.-,,:_. .7,..,,,,, 7•'• ' ' ' , "'' \N • .,-,..-:,. ::::-.,-,..'..,..:.----.:-J:,-:;,-,5----:, / s, • \\..., - ---_— \," 11/4%___ , ,,, ,-,:-.•,,,','-'--'4;‘,--1 re,,\-"%,,, ): : ;, '' ..?.=•• 1,--1,4 -4'01\ --4h 1.-----•---, • •..,,-4.-4. kAtvt ..,..,.., • ,,. - \,, r'''' '`"eike,‘\ Q / ___ _ ...i , - 44i di ---- -_-.. f 1 ‘ - ir 7-7C / - i ! i i•i 1 74; '7:'' ' ..-A \ : ,.,.) th,,i, i!, • ,o/r-/\---3"-E1-\\ \ - ------ ---. - -I" • T.:::.. 1 41 : 4 if ILIL. -- - -- .• .,. )---- .._ . . r••• • \Pt.. t---Nt+, . ., , "‘„ • "--..‘ b . ,,t,_ • -'.,." __ tr \ \IS 0 .v4 (k ___\ '''''''*-- --: ..,/**-°'* • . •...1:t‘ -.< . •4-4 i --\ A-.A ,'71• - . .. illi.b ... ,44 4 At,(tiii.t,',,, I.4°"Th.-''.- .-'\.,-..•..',:-ei","7:. .1k., •-• _ 4 . .4 ...:. M5BC.. • ' / -..' --;'.\'S\'\',.., ,.. 13°. '' ' .' iff..'''b'..4'''''''. -.' -.''s""--.* '4';':'•I.-....%--/...d i__-.-.41 1 I L a.\•'••-• 4011 \I i b 1 fia(NZ •FtglAC \•:.-.\ :-40.6-- ......-.... libmillIP, 4 IIIL--'-:----------:„......tt,, •••••;•1:111, .1=1... 1141(1 • . L Vt nelual4.'1. • -qv ipol ---.._-,..„ -..........;:- . \ *70_1 -, . ,,,,....„,.._..„1„:„,_ • .4, _1 -......„7„.... - --7 s N., LI 4 N' t-'-' ''''''S';';;'-':-.* ''I". * :1 -131,4 l',` ,-;•*?-.*--C-s-1:;*.tItc. iii ____ 1 ..L-* .,---:.-„1,---7 *.• ,..-----:-.°----- --. ..1g"" _P— [ '.\' '' -1‘ '','',--'7':•%;1-. '..!- --,?': .... „ ..-- ._ . :,,.. \ t' ,,a-' '1-,;,--.i.:,,,_---*-.:*::: !!-:.!-f " 1 -- li -• 1 ?EM • \\\1 ' - K\' V-:-V::''7":-,•;'....-`,',,,-,: •., ,, i6.. . __ .,13. .7.,:s1.-:\ 1.-. .... ...7.1,,f,:,.,:„,,:_i...„..v.r.„. .„. . .., &. • • p. - _k• 4'.- . ,,I",,.:. -•-•i, , ''',. 147-. '''''',,:- '. ;'47'PZ.:4"•.1:1• . •i 'liart4 ..' t'-i'.;'•131. • -- — ..:,;,-Isy•'tv.10.---"Ellg, 1 . -' .,I 7-,• Iglik._____., '-_-* ,•,---: ‘,-....s..—•-... 411#7:::""il f e . ;-. '. ..., --'• ' '-: - t-,* .-• 1411b- ..., Ai& ,. : ,, - . 01 _.,',- Ats,,,,:t.,‘•,, ...: 4°. ‘‘• • w 41 .,,%1Lt.:1 ... , . 4-,:-.-:7,164: WoloM 1 I — —•• •„...— , ... .. 1 _ ----4 —It , .•' • —:,',.--• :••—•:."'-.-., ' . : :4:4-- - --i ..,,, 1.• -. . • . • • ...,,,,71 . . — • . •-• ,,,,,. :- it„' 1 1 ,1 - •.: - ", 1 , *1, •• • . - SITE 15 SEA1EA 598671WETLANDS DELINEATION REPORWIENTON WETLAND_FINALDOC WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT FIGURE 5 King County Wetlands Inventory Wetland Delineation and Classification Report l 1 • -'f��' .4 �,� -t/ .7 1 .. . ` _ -., ,;,,. -. .� .- .:. 'it; air �®E � � nY._ : ..,... . '}. ' '' t;•w ,�: pa ��4 It1,%1 Ril,,,/ ' t :� \mot .,t?t p � i rp 1 Y"A Iii .. .. '..,.k ,' 1. •.11' -‘, , ..• .....,,N, . ....„ - • • • '�4...t •1l'•- "•f-_ t�!i16 J ' ~\I ,e0 • .::.��v' ,:,,,.-E.01.,N,\\:.„,...-,:.,:....,-.::,..„....:.: .,....s.:-_- _-,-..-.,,-...,,. ••,,,,,,,„. ...,—,,.... ._. A: •,.;1 ,,,, ,OtsCTvlikiii::A.,4%,%,--:,04-.1:7,::::r... ..LtiN:,,.:.:•....:E•.."-::::...-:.......i.:.' ......,....,..:.:::::::,.T.:::::.,......:.......i....,:-...!,\:::,..; itilitli;-;::.,,,z1.1.....11._.11;., ....,..:.:-„,:.......:-.:,,,,..:::.......,.......!..,,,, .:•1:, ...;-..,::::,-•.....•-•.*:,:•• : :••':.:.:•.":".•'':-:_.', 'V`; -"II- ijuz.e.,,I.r fp .z--._,..___,---1.1pow,, -..;.'f.'. .•.! •...- . --1- . -�A , .v-ci..� • • • ... -x' ,ASS .- - `fF�ffir •,-,i.g.<. .a 4 ,,rN. .::�'. �yp�V.!='''_ -- j' %r.. Air ri-a•6 gijAA��p�p--``l � `• ?•.-.' f. � 1, t � is »_ 979 7�a�—�. 1�6 litir L'�.����� , • 7 ^.�1"�I sa A. Fez y`- ' i- 1•- -. r,t •• • 3 a � .. o - a „ : I-� - a; ' -r Yg/ igtul a- ti _&•". ti — f �. )NZrat 7. :. ;VA.,-.1.:.,:.:-i4-:,,,-.,IiiiiitiNgtmlly lit -4‘...:47135.,:z5k_k• -..,!....,, .-•,N '. ••!.. f?r,•%.•:,._, i 11; on J r-,,: fi." t�� rip;o 'ciD. 8B: 0, •�1y,�- ` «.<.j. ' 1,%p`gifi-~` .,... ...,t, . ,' .4410,7: . ....: ..., 111V. *,,,. •••,, "...St4:1/4 c_ ' .. .-- ,--.--,-7ft.:'. - -•• ; • - . . s...,,,;--.-.,''':'140.411%' . ?,'"...,S.,\-:...; ' . . ''..,\ ad I• V-41k :I-:N'..• I• ,-..., . 11mallimitTrT-----••-•6R i p: i','.1 ',.:''1 .•' ' .r.... ...i.„ ,,,,.. . ...,.. "ir...._ _Num. 1 : . •. ' l'! `...:.--*...1-- k!,-,Litlaril( fi. .- ..1 ';.1 1111 . i;11 " ), ' -IgiffilarillaVirlIW 46 r .:\-1.'‘.. 11 .,=Y n' II r ' •tip• r r■■C` • � ■aaas T .j,,... `r- Wetlands Wetlands Duwamish f ' -,, ,..::::','.:• OpenWater• :•2::.�=is' iiiii ., Basin Boundaries y i14 - Sub basin Boundaries :c"1 r 13:; • SEA\E:\1698671WETLANDS DELINEATION REPORTIRENTON WETLAND_FINALDOC 16 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT FIGURE 6 Renton Wetlands Inventory Map Wetland Delineation and Classification Report • • __ Y `rd L Y MERCER }~"''-A"" �r2 x>- ISLAND AM / xa eoxaN • �=�,= -�=u . NEWCASTL' I Mnz:�N 0 r`~ M� _M y4 Iiiiiig COAL CREEK ' t3' :_.__ `y_'r_�'`}_ri• • IIi `y{� • A — I TRIRUTARISS 1 iv-`_`yrr l'„!_ Sy fp;xA Ate; h..;�f4.^- 13t' C�6' �1 �1j g=xAM DNA=MAC ` Ay I • z..-414--Wini-tkg550.2-.2-va %Ir• ` Ns= NV,- X 3eklN #0 2tr__. eta '� 11 • , 1 • ,---,,,,,s7.-t-Td. --.4.--E.,-.?:::;;:tfett::24§--,t . \\ gin$ nx e? �' } • 4,- illir % -1.1,- 114.12.,:l SITE • - / ��uu ". �t c ev IIEIh_ \p • -15 NTO 0 .�`••., . ! a1 `� 1 : s. .....ii.• * ' \ . ) • // \1 gam!°'' • we .!nu-� :4 I- � �xr, '"tom ® 46• 0 Nle. AO��_. Wetlands For Reference Only ;;,A \kt / . 0 5500 • 11000 1:66000 . Renton Municipal Code Roads • • '�� `` _. Wetlds J ' —' Streams Rivers 17 March 2000 .k sue--rr"'r Lakes ____,_ .City Boundary SEAT:\15986TWETLANDS DELINEATION REPORT\RENTON_WETLAND_FINALDOC 17 .-. . , NE 10TH STREET/ANACORTES AVENUE NE STORM W D DELINEATIONWAATENDRCSLAYSSTESIFIMCIAMTIPORONVREEMPEONTRT PF°ROBJTHECTE . .. • FIGURE 7 King County Soils Survey Wetland Delineation and Classification Report , . ---,4.:-...;-.5_,*..z.,,z.,-'izr..,:,•-•.,,,,7,-,. - -' . 1 .._. ..,....,,,, .,....,.,,,....ilz s....y.,,,, -,.1.± .....,,Ajfk7.4„..,.....v,..-..1-y:. ;., ,., ,:,•,-,1;„i!„.:: -,..-..-,,..-J • :::,.7........%.`,7•.. • . -..' r`":"-- 'lijigtiv5......,,,,,4 t.....,;!„.v......,4...i.y.,,,,,..,:. _ ,.- l'..,-..s."44.• .- .. - 1\11, pr.,, ' 1_4744&*`...6-", •,..7%.,'-.4•1-.1*- • . ••.:•.......7.nviy.•,..., • ..--$::.1,-.-e;$,..,,...vc, s.,...5..;..1.,,..7, -;_,.:... . ., •.., ..- .........._ .:. ., ,:' .A:.- .32.___v_____,A1174.,;.-.7%,-.:?,,:,:,--140:., '-c- fer.1)h ,-• - . ,: --.7fifr,.-1..-,-,Jxv.,,„,-, :.,a,,,,,-- , 1.A.,,,--.4.--,_,...Q.,--.4.,:-.-:,..-• -- --., ,...,....:,.:-•• 1 --7:c't,,,.''•,—T7.--; : ••-•.•1c,"•4.','.;•'44- -:,"•,:,. .,,....iti,...„._41-„, ft*, : .„.„...„A k7-•; =,•-.•'. t;'?•:'':',•tt,',-, -,11",t's•;:•-•-:•,.;.,•• • ' •- -.• -....., • .... .....•,• EvB !aS4'.'," i5.;•'-a,,,,tC...;:•-••••4tt.3,i'• PIT., . ..-...AF--. 4e.,%U,„,,.,311,,, ,„ •*/**ri.i...-!,',.4.,.4.2.V.•51,'.1$1.-,:1:-.‘, . ..:-:•.•.'•,;. •,:-3,-.•=r•.;,:".z.zz, ev.3••• t-,,it.:1•,,. ., _..-1,7••,:iTy...er-•:i,--.1.k.,:ifr," ,. I...•If.;,,4•••PiliZill,-..-,•.i.•,,,,?--wv,,,, ;:ttif-c„..,.,,,'., .-::::-• 14M,;"-: .'"4,-,.:•: _.-L_- _-.,-. ,-.,;;,----.÷.:57.--2-.K.,,,,:-,-, ------„,....--....--., .,-.5.--....-...-•,;,..,,,::-L.,-. .,.._... --,-;,:::„...- -...4,,,::,--- .-. --.•••it...7-- ----,-,..R--.../--....,-,:::.57--,.---.•:.:-...:-...-7_. .: • kf.,c....„...-,,,..„, .,,,,r., .:„......„ ., .,- ,......j: ..,..„-,,,,„:„..,„ _ .„___-.„,. ...,.,,,..._.....* .1-4g,-,-t • ik,'"------r"" Fi, • ,-,:g.,..A • t4.1'4:r47. .111Vir•?•:: :1--,.,_•r kli-= • it%r*-,...' ,' •:'''? ,,,ov-p,..,- . .•Nir,.. 'w111-' ,.::.":-:,...':, : ......;,-..-i-4-i:v :..,.,:•,:,„1,?,,,,,,,f,is- ,7:1..,...,,,„....!._.::.. ,.,...,.lijAirnis44.-..:4.6- ,-.1,,i.,,-.. ..z.,.;. -,:4i,,i..,.:,,,,,,-....!„.:.. ..,:,....,5,A.,-,,,t,:,. , . -, . ,..,:i%:::,;.!;-7".iii-iti-k;0;,-,..._ •:',,:,: -. •• -- mggtjir..z1:.,-::,'-:L:,- :',.:!4F.e.7,_•i-•Ikitw--:lwro,-.._il, ,,. ., .. ._.. _______,__,4.-;,..,,,,,,:,,,,....,-,..-.k... •I ..- - , ..,..,,,,.., - ..;.!,.......,,:. .•••,,„:_ , ,,.-•-,,,..••,,F.,,•- ••-•.:,,,,,. 7 talt:;.s.ci.;;V.,:' ' • - ,. I I ..7-74.p74,7.7...4:7-::. M.,•N;-.tz.,i-z7.;,, t1,.zittk. ,.,:_.!.,.. ___._ ..,..,...Rdc.. •••••\ -??.,,,,,,,;:.-- ., .„.. .., ,'Y::;•4,,-.;' ‘` '..____-...,_. . 5 . '''''''..-444-41VP* .5,..d _,.. ., , , :-*- VC' • :7-1:...t.,&:',.,., • '• •-- '' . • ....•• '. • ..... .... . .,_.. .. '''',... —1-1.0....;. _.... _._i''''''.''';t'11',': -f-- -----.....1.-4'1"'A', 1--Cr.l..:711'172.:., ,,-.. k --.L7'.''' ''...,..,'-'.. ./7***..,147-..V.,..3.....„'7•4:*41'•'. ' 44r.f.le,-:*"...':•• * 1111.ri,*-S., „.., . ...i.•I, -.. ..,, '•,' '''t "'' -I' licii-ra If..:-.:4„,-,.-....-.1 . . . 17417,-r--..,...#-,-,,,,,,,,.-ft..,,,y,.-,,,„.--...• .:..... ...,,,A.,..,.....,7 7'' . 1 , . . . AkF.Al. ' \4k -- 1..,,,',1...,*.sAn-Z-ct•.'j.7,,,,-ti. it '-',70tir;,,4.-,t,,,...•,,Nc.72,4:?., -. r--, i,-...,,,,-,,.,::,•:,:-. .. .. ... .-).>, •, -.,... -..-ir.::-.. ,:,... .4-,,,: ,„--6:•.. ..,•-•V-i4.'"•••••••,'-',44.7.:L.••,4-'''s '7'4, •••7" 42., r.c.s.„;., ..,...„. t...01 ..t" •••'''••-•"..,".`'.'-'•-1,'• \-i"...• 1 -----.'' '''• \ 1:iy -''‘''''' ''.;--I.1 - n.,47, '''. '''-':w-•-••••i :.•:tA.0.;,..,.. .;..,'. A . -,..;...,,,,,,, .,;;;‘,. ,... \ ,: *11A-II...., -. ::7:-:..-- '..,' ;!.t'°:: ''''''•:1,.., :,,,,,..k,...:.,,,:,:...:::.:;.-7:,,&,,,,i,4„,....,,._ . .,.:.,.j..\ : ,..,„,,,, .,„...4-... :..... ..-s.:,•,:.,...T.,,A, ,_ ,:.„...___,,,___,... ..-:?„. •:,;4::..,,.. • ,74...,,,,.- -..,.0•00..,w,,.,.. . vs.i.j7....;,,72„;:: ,-. ,:::..:,,•;.::.‘.1- -.,A.,,,,.,.., . ., g--'..:•!,."7'...-81.4'-'•.;41 •:4 v.!... ,.,„ ',47.•11..• .....'::. . k'''.%......1.,..•.-.,':'...::: ':„.;\., . --.1.. i -: - -.f...,f4.: - ?...1.;..4:4;,,Y.-%71-: - '''' •• ''.X.1,. . .1.'... , , . '...._ --'''.-- -••-imita .,;'i,.....'..,-.1 TIN ,._., ,er,,_ .. ..,,;,„...,,,,i„.-4.-.-t-..7.- ;.!14-e.-. •-3. . .,:::,,,,_., - - 4,..4%.,.-Aw.:2... ..,r. :'47-. '" . .. ' '- '' - 4 ,' ,-...... --, ''''.: •'-. ' l',. ••••• W..:,. . 1 --1- -r,,,r '',.. ' ;:.-.1g-''' -••,•--,------.1::—• • - •• ....-i 7 ,.1.4 ,i.,,• IV'. %.''Orl .*: .• ''' ;:***7.`:-*'***"..."'',:f.';:' '.... : ''sk. °,"..7.-'.*:" .* ..t'taff, ±,.'e%., '''';iir;'' '''j.' egret-IP.i.:A&.•,.',.„,^ '‘.1V' • . .V.. *4**'''• .,•C;`‘-,''77r4.7 ..rr,,:-..2-:+'.`..N„NA';',. .-. .,• . •4 .1.7",i4:::ri r***•?^•4`''.. .;*-:,..:*.,... 7:1;. •Selv i r ' ''''•.Y *-14-:' ''''''''''''' ti ... 4.. *t4it ...../...°?,..r:/..V'''..:7',.$,,*-771 ir17,:f,'.4 ' ••CL' C*4••,.• 'A-. ,..'.•..,,:;',... '"4:1--'4t,..1.........;,.....: li',:•ii,Til 1,...':..„:.v..,1,k..,4„:•,',.: . ..g:.' ,„:".:,,,,,,L..„..,16,, 1 „i„„vi.,.... ,,,....,..,,,,.....„,;,;:,tr,....,,-,..cr......:,:e---,;,:„;,e.1)„ "..f..%;‘,0';,-!::, s',4:1,1":-......:";:,..--,.:,..,;.:tt,:::;,7-44,.:,:•,.,,Z,.'•,,'„; '0; ,12:-_,,*.•.,,:44 ':i :', • . 's:.. ,•:..1',.'fk.,, -‘)I_:i.-6,4,..\...1;:,<,e.oa::,.:1 ,:-.:•:,..0.__ 1...,.;•311,\:;i1=:. ,,,, .:,.1!r1 p..r.....v.t..0:w.,.:;•:•-•;.i.,7.,:i7.- -T.„ t-ii,. '5,•#4.''t, i'.-':--.0'• IP_I Aolfq, 1 . •,,...;:':'-'.-.!_k;1 -,-...,•;.,..-,--41!„.ti-d-A.-- ;....?-141 --,,:s. V, liN,,.OW I":•;:te...4.-...i'.'. .-...2.j.32_4i .4i. .. ir:. a ,,,,,,, .. .., . . 1 ,,,c11:4 wiiii ., ,--,:.r-- li: ;: '':.i' :T.t.--: ':,--1-‘•a:" ..i' .MM'n • 1.'. 4,C Si.' ..4,4 y 'lir'' '':'"' -11,-Fie;l'A‘ci,S ..,--:'••••:::: ' 9.v,,...:,,L'<-, ••4.`.... 4.4,, • •4 4•X• ..4 . ,,.. 1 :. ..v3".''.1:4!' St-f.1:;,",' LAM IV,IIr.11 k,._ - „:--.., . tO.,..:.;.. ..,..f.!-.., - .,.., .v:.,,,.11,. .).4.. • -,„,_. .. if ; ... . .,' .- ..•.. .t%,,1-.11.-1,.!-I'''.-10R,,,--- -iu ‘...a. '''''"'..:.,z,'&'):°:::' ........i.••::. ...•it.c:;•-k.".'-'.:::;'-'7)415,'-'.:M•••, - • . - ••:?--:-t--"'-''''-,' - g ,,,l',•0 '-':'-'''''',No--'.:? 'c-- -.-paiyel. ..'sil2v3, A IF-1.:".:••-•:„. 1;,;:e,* '',,4-1',,N:',z•••..Zi _,.:- -:r!, •..,sr.. „-,.i:....' •.... ...-.:".,:. ..,- ,P .• .IP•.,. .,1 .: -,• . .-ir .. •-,,- , i.- , t..":r-::4....,....'.is'1,- .,-:•.;•45..",•:,0-fe'-'.7.- - '- •' . - -..-,trAte.cr.',..: -.•,-.; /01,Y-ezt.„4.P"'4"4•4 0=.3e2-. ....,. '...• ...:• .' • ,. .4.. - .,-:..',4. ---111c5MIZM .-•i>.: '74,411,477r•%'.‘W 147'- ; yillIi. -- .,•. ,..-,.. .4..„--.-..,, -,.•1 .......-•,•.,.::,.'_ :... ,_1 . __- .7--,-.-.7.1 ...44,Z. f.qnP,,1,4k .4 •..6 4-.! • • 5;,...14'.4,1 itia ' '.''''-.4id mL____"-'-11.-''' 1%,, ,i,, r---1•••,: ....: .• 0/0,4„1-. .4...,.,:-.-4•...4p7.;i. - . . . .. . .:1,,,,--4,=-:, •:. . ..-. r.!:::,,11 mow=.1 •t„,.. IVI - ---• 1....,mr-01)Itt I, .A.:.:Xiv:--57:.-7,.,f44,-.' . .:•: - •F, 1 frei›, i2,24,,,k,.' - In,„„. ...-- i• -. 1 .t;_,..:t4,4%,if:_.!...•-•:'-'-e . . • :1E4---.e-.A .,-:4-„'0:3: BM .._ ...,.. 1,.?,• .,•.-:‘,..-,:i win •• • , ..o.- -,-,..5".. ,it,,ivr • . se^ • 1 tig r4-5 TIT !'' -:^ - 4-:. ::'-t5I1:7':- 'X . . •ria :•...e''15,,Zg::',',;-: --.. -.. :-.. • Avol,,,A,,-;'`i-'1.14,11'i t - * ),,t :•- -'.)- ' t.i:i ' . ..‘. ---41''-'4- !.,...-- 1.. .• 't:414 • '' !'7'.''''..-- ;..,%•Ct'..i.- 3^,-.' t;•;, t 4 . .*.1 hv • 6 • .. ......7, _ .i ....i1,2, ...,,,..pit,,,n,„., 1 0 .; ,,,,,,),i.z.tvzme..,•• . 1,..... A.••••: .., ' "."..-;.--":,-41.!..•'if.-:,-, ' .--11;qi4V-. •.?.. kr _sf._:,,,,,,r-,, •06 : --f,,,g,3isit..- ;:;.....z ••:.'.N Ar":.':: :2-4-C.' IIW.•1 ,...' , ""illr;°"/.•:' ' , l'r.,..T... V„..,,,„„„efrg..11i.1 ':r , .4 r. ....e ,,,,*,.,,kW.7.7...7.:,,.,• . t-f.t7.,,*; ,wgik 2;..., ;:p.: *_.. .•• ••• ,:;...4". .9.-A. .,•;:' .....,, -.. .6,14.141i • .,-:.":.''P:. ,i---.,,i-A, 1.:.A--.-,..:,- ,---.i-s-.. -."-•,....0,.--1,,,,A4-14-, i.,'• '0.1,410,,r-x----sra. .-,a.* '.. • \i.:q,..!.,,...„.:_!,,?..;.,...x.,-., • 1,0.,-.1,...4:,..-.4.-5',.<_. •-.• .0,..„.0,,,„:.ETNI A'1"i-..;(,...:''!:!. 1.;'.1.4°.,r1 ''. i ,i, .44:; •, :..,.,-.; ., .„.k -. .A,,t_t!',-., ;Li.«..-EirZikV1.?'-4:,-..-'44 tiliffl ir:;-...c,'.,...,iw.4-a 1-:.-. ...,.....:,--.:-.„ekz!-:,:.,..,., . .r. --11.-m:t•44 :•.w.c::-....:'..*'-'50"'1,---ti,i1Th 1; c.---.10.;-e4,•&„,. ,--igo--..ilia,,i.,,,n-77-:- ..,-4,-_,,, •,•:::: i...:i..,3,.. .-4,&147-t4%..7;:s.e...--„:„.-1,-{,:, ,,,,.:.fe.....,, --.--,,_0.m.;;... ,-,:, ..,,„:-...-.,,.: - .,,j, :.,t.R. ' ,.if- ,,.::„ .._;:‘,7-WeA30.71›.5.,[:.•:?.5311.P.c.'.!i -.''. ' '-',..:4.,#,..::...": .1.4iti:;g.A1,:-VP-45',:j 'Fi' "el. .2-7- ..-VT'1 1 1. ::',.. ... .,..'-'44.'!"'',..,,,,,...''' „-.-11 .1.•Tilt , ft,.;14-:,?...,e_r.2?,,,,..4.,....3.-;...:40.4.4;v1,,,..,:,1 ..,,,.-.;/:.„,-.,i,.1,17„.;TA_ ...4-‘4,..4.11.;:'..,,,,.0.3:::14.;:;-.. r_.-.L..L.-- . r E...•;I) 'l',:,4 ;.=...IntlE e i CI d d-N.07-e;i4 ALL11140- 1 i 1 b; 1'''••"IV.r!':'.,'''''31...114',4-Zn.'-'AC >.-,,,,V.,i.S;17-•.-,.,:-•,:: ' :: LT-. 'Vc.k-Is..,51.-. .;*-;.`i.r.,< 7190: • ... t,,,:e. ,,,,-,.,,,,,-Qat,-,,,,t-'77.,,,,, i-'3L__,..'174%.:741!"-t4,4'..,,'k il'..;:.',..,.i.:"'41.';'1-' 7 '1 -i:\''..n•'''.‘'J-i,:=.-' I.-2-t-ft`'',P-WSAak.•1.4•. I c''' .4 ,,kV 01114 17,1,...__7 , :':1,7-;-`,'''7,7.7-',,7-7-7,-P:'," •ci'r.'!, I"it.,vv. pf ,.0. 4•.;.•.:,..„,,r,..,4 -----,K.4...:`,-)14.._ op t„, ,A.....,':q`z,,-..., .,,,,.... „,.-.., t..1.., .. , "I '-'1"i);;Iii!i-ni...'.., '1,‘,.,..1.1,- 4„,- ..- .,,..s...-f..., 'ft , k,,,.,. - ..,2. ,-„ ,..: __• ,-v.,,,,...p-., •...,.. ...-:- ••4•.,r,,,••••;.,„4-, w• 2,-,g. 0 .,, 1 . r 1: eNs.4cU V,';`,;..!' '---,tZVA.":-..7,>._.re4 2C; ,-1`...7:7 ,..,.,,--; -!.e.,:-..,i'ii ,CAI:,1',37,,1 :-'':'t".1.,'"-,,,1-•C-1,,41 '9,-"•j`''t.K44-7 ,,;...,'-,Ps.','.4Nr. .-:''';'''.. 1 C•IAke.•,-.•,•-*5, :i!,,•,,.• •.''41.7----! :.''''':l'; '-'t.T.11.''' :".,N,,..i...t_•41,i'iz..),.. •!!)Aliti,...-•,-,::-,,,,,,,-,- -,-,.3„ -..-,,E;.,,,__,,,,, -•,,A•g*..,....AA ,i„..,:,4. . 1 _..., ,...,• 112,. -1e.r.•, .'!,..:* 4.:..? rt.'t-... ---',..- --PI- -., ta • 7: I\'''s ., ':c.'-'-'k..,i§ ,e'll.r MI •iT, 4-•3;1:1',-,:••I . ...,f-4-1-. 1----:-..,,N.-:'iii-0(13-1.•,.' i.. - ',..--,A 1•••••••'''':: - •• •••'''..-'--' 1 • Al i,. :wiirif.:v:it...L..IN last L.:ile:. "1....'' i- .;,i,-4:O'i• •'•-- - '.-,." . ..,-• ,, , ,..„.,,r,: m.; ,.,•••ii-th.,.Alfit.;.,..1.,-•-•. / r--' , . "-- ,- -,E4_,---,:-..i•-i-4!•• 4 v.:FP:7:.tti• 1,:',4-- '*4....r;kfiT.,;11.1f, 7.K7,,,K -....-•...-,-'7--'(1 .;1";.W.7-.74f.1.,.••- : T.:17' -•.- 1141, '.,-':•.'",;1*":42.0.?..`,44-,A ..;•W'T:IY,? ,;_:;-tEl, [115.2:z‘Z,L; e:.--,--.1'-'- .;i-t:-•=4:- .,:c%'-'COsi..'..1,'14;.-4..::-.. **i•.42:7,4;.'11.$:: : 04171710-1.Th4 .-,4 •':;.:;-:4-,4!;,:,:',.;:it s';''%':,-.-'4"..;:',1-‘.it. ,..n:z•-....s..g.N...„- „ ..--:-.. 4.f.T.irt4:::1::: -. :-/":.t.:..,:.'•:.t.:14;',,,F.',....•:4,, :2P:>z4-:--7-7.- •-,,,.:,'•••••'::-0,1P:' . •1';'.1,:''''U.ft• '7-`t.--.......:'t .' ..;,.;;•;1:::'g:',:`:;•X;:--.(1V.'•.,,,-,.*A. !..''..r%•.,;.',:=,,:rz!, 4...,:.,:: ig.V.,,,:i ..L...('-17.' ;.-:•"::,: :`,,- '-... ,..;4:;'`_1 ''''' ::1f7.1..t1:;;1::::.ti.fa'',1. ii 4....t.; P,...-4 r!•.•'.....-,[.1„,..:,•,.:z:;::,;kr.-! -.!,.‘-'..,- ..t7,1',.':-.11-°!.:;4-":7:(-'::4•*',4*". ;1%; ',I% ';1‘.'.,:.r4..f.„:.,..:-...•! - •f-.1•.‘--Ths,,,iei,,,r,„?•,:-....4-.4..f,..,4-,-,-,;:- ..... '..,„,:-:,:',/..`:'•.:::z.'-,C r,:t.--,--..-,----;1!;:.,,,„-, t.•-• .:,...z--..-z,:::,;,-.T.,: •....,..._.i, ...1,t1,:-.:.;;::":ii . ,.e44. $7..7 74,,Irjr-.•-,-;:73.-..,,,,tizz,;.:::;,*,,•;.F.y.;-:',,-...-z..('!•'.:"--, —_=-1.,.:,,I.•,iL ..G.;..-:-......-,„.--_, ..:-.-....,. t....3..,.4..y.:...m.4. 1-, .1r 44,.. ..„;,' * ,10..4,..t.,,,,.1,'.t;,,,e-7,..,,,.:;....,..,- I-- - ;...:?..15", %.„.-A.;.:,\ ..t.:::4;4„....,'1 F Oid,",),.k,'--•'•-•,-` ":• ,,:),-Ji_r ksi • 1:,•:'..'-.Ct..;),-;:.;.....;;:.:1:7'1..., :'''t-..:::'1.4-••••••:1''''4;4::144--::"'.,-e: !'..''..•'','-1',.......?,'.?-;:;TV;:l-17.j ''' 1":..41..‘,.:-.-i-,...•'..••••-:,1-',L'L.fr...;',#'`..-. . .,..1. .1..'W.,.,,...T...,-.A., :71,.,A::',',,,_ 1 '14.,,',,,F;;•:::-..;.,,4,._:...1,••,.1••• ,c,tr,-...__•!___.,,,,,,..-. ....„ , ,,,,,,,..f..,,,...„.....5.s . ...., , .. .. .. . , fi.-1-1,,.,L...r......,.., .f,,,..VA sir• L:, otf.K: i .f. ,,;:17-!:',.---1 i ! .411i'...=: \ .....f..,', 111P, ,::::•,::k:_q(fiW;.4::.Alk:tt::'....!,:i.::.,75:,, .',7-Y-4',':0 ?)'''‘illi. ''',-7. "`%.'' t•lc-4V li.--. -,:,r-,;,. "-,,,,,--,,,t9.1o.-o:,?.....;:-.!.',-,,..,-..,•2:q.=.1...,,,,i,:;4:,..,;:-4,-,• tt,.... •,,,,,,,,?,..,2zit..,..,,,...--....,,,.:: •,..• -.., .&_ -• .-..,-,.-!..„7.:....v.„,,,,,a.4,-, . 1 4....,;.: ...,-.i.. . '.4.1.. .;.i.fi:....-..'44,11k.::-.•- ' ,.:.!r'...';:i•:,"...4.4 I '1,-..-,. ....4 1--4-4--...N,,44,7;117..713.F4-77.mi v-i,-;•.,...„,z;51.:,..,,.... ..,:_p-,,••..:.-v--....-..,:,;-,-_, ••,..A „.7,,,,-,1 , r....s•• :,'••. .-::• ^i-rFli.. . •k.. --.•;;;tt•`-t-!4;%,,, VL.,,,j'/C \l'i-C-..- ',A.;:....:e'' FI:r",i';Y•''.:1•,".:.*:'32,4•.••,*,`;•,. .,::??:lc:' 1;''',q5:, :,i-T.i'A.- 1 ' :• .2..;.E,'",-:...-;t,..2.,'.. - ',‘''V'i,7;:i':'"....k....,,l'.1.;i14.'- ..is'''‘''... .7.•;;'.',...f.-,,;.E:ii I - 1.. i-Aff•••••I't..- *.zz•tLT:.'1 ,--. :7-..-::.75,',.F..1•24?. .f..r.-:.-...-r:-...:17:-.! *-',..'...4„...._...,-.1 .„.--c--", ,,,,„''''' ,,,..,,,,e;i:y,.-,- •.i'...F"f 3.:fif.-....:;-:!.__ cr.----..,n2:• .-, .---- --- . ''''' - .-- ,-I.-..,..-'..L...'zt k,.",-.-1.--, • i.,----1'...:•[...:;,:al ' ' ,S,-:',-.`,..---.-:--....j.':.'"-'i-;::::',.-.'---'_. •':'4.; ,','.,-.:',1 N.,::-,,.4, .......6. •-•'-' - ;,. ...•. - 7---.-..E.r '1, , -.' - . , • SEATA159867\WETLANDS DEUNEATION REPORTIFIENTON WETLAND_FINALDOC 18 ' . • . WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT FIGURE 8 Water Features,May Creek Basin (Foster Wheeler et aL,1995) Wetland Delineation and 0 Classification Report -.:> .`:...;.,v 7: -... / i ,- i ./ .n 1 / '' 1 r Map 1 '; : Water Features 0101 ..'y 1 (.,r 4 ,. .F 1oc r` "` °�`' E.- „ May Creek Basin Li / 4` ..I I,1,„16a,e Ave SE ler �p,` ��y r 029 6 iip o //°," p1° - $ i ° ^/ a 1 o- 1 14 I o 5ii, i • e A e'.' , I . 1 ery ,_ �. �� a �6�d �. ^ .___ I - 1 m 1� I/)j �6` n +1 --j d 0\ IASA Ave SE (rr! ^ ogee \ ,es „¢ Z — •. 1 C „ N. --(-7I O 1 j 07.0- , r -1 „° O—_ �� I 1 Cs." OW' .m .+ olee /1 17 nd Ave SE • 02 .rc p --., / v •- . . i 1 e e T .0 ys��- I J \ 3 01 j i I 1'-. 0284A^ -E L_�1 E 0 Z _ - -_j �� o E Z _�1-- A.1 ..1 Z Co „ r— R „ 02e'f °C O d —. �'w I i._lone. ,..a�E+�.,/ O O Q .,•`,-'+"•',.* :,`t._ � • ,yea Nr- • m E p CI-. eoj 'O O O • ••&• fa4e•110.:K n4,‘rv___ - • — -. .. '�;` ice` '44 \ .;.:. 1 )41.1 '.L 1 SEA1E11598671WETLANDS DELINEATION REPORTIRENTON_WETLAND_FINALDOC ' " 19 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT FIGURE 9 Lower Basin Conditions,May Creek Basin (Foster Wheeler et aL,1995) - Wet and Delineation and Classification Report Map 14 Lower Basin Conditions 1„,::-�t . May Creek Basin � ca Lake :ram-,'• ;, ,�N1 a\ Washirista'��.,a` f47 ; �O m % - 87 0 o� * Luke 4 -iit I ;1sa- I `' O Barra 1' I= �1.� / LS ..:f ,,,.t.;-.41,/ ,,,-N-, _ - 9. -A.,-...,:-, iii$' 1:0 ',. c' ":- ••r•rr- jt '',';',1.;,..,"" ,f 50 i. IIIIIIVArw t'..,V,r.s. Q- -.- - -2., V \ ^::thy - i LS lir ^ 0,051 , gA Jr p / 9 \O jrrS.E? Z N O R T'rv'r'ir O ♦♦ o �K? F ,~ 0 .�. m ,p- /. �'���"�`2Ei'.c4 SE r,Q .��_.,, .10q ,,.p O' aY I I -'A_'^ r v,•1 F tea •`,: \o °Z `'1'��ry-''9ti u. Y /\��' • `IC `'r' ; V a l yi`.ysc R c y , • ,....A , N- 1 s J- % -. Basin Boundary p • m •✓ - , • i-• Subarea Boundary ♦ m p 149 x �— Stream 81 Stream Number ♦ ---- •� 900 -•- r.� Lake M� A In S (m = Wetland m o I .. Concentrated Spawning Area I> ♦ o I ,i( I Problem Area C 19 • O : :ce !lf ♦ t�:J OC I1 +xK Stream Habitat Problem IV ' Flooding Problem _ I SITE ro V Water Quality Problem -1 i Erosion Problem) 0 y, 1 Mile - 1 li) Sediment Deposition Problem t 1 1 SEA\E:11598671WETLANDS DEUNEATION REPORi1RENTON_WETIAND FINALDOC 20 WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT 7.0 References CH2M HILL.2001.Final NE 10th Street/Anacortes Court NE Stormwater System Improvement Project,Geotechnical Data Report. Prepared for City of Renton,Renton,WA.May 2001. City of Renton.2000.Critical Areas Ordinance,Ordinance No.4835.Renton,WA.Adopted: March 27,2000;Effective:April 30,2000. Cowardin,LM,Carter V,Golet TC,LaRoe ET. 1979.Classification of wetlands and deepwater habitats of the United States.U.S.Fish and Wildlife,FWS/OBS-78/31. - Department of the Army Environmental Laboratory. 1987. Corps of Engineers Wetlands Delineation Manual.Technical Report Y-87-1,U.S.Army Engineer Waterways Experiment Station,Wetlands Research Program,Vicksburg,MS. King County. 1990.Sensitive Areas Map Folio.King County,Seattle,WA.December 1990. Foster Wheeler,King County,and City of Renton. 1995.May Creek Current and Future Conditions Report.Foster Wheeler Environmental Corp.,King County Department of Public Works,and City of Renton Building/Planning/Public Works Department. August 1995. Reed PB Jr. 1988.National List of Plant Species That Occur in Wetlands:Northwest(Region 9). U.S.Fish and Wildlife Service,Biological Report 88(26.9).. Natural Resource Conservation Service.2000.Hydric Soils List,King County Area, (Washington.U.S.Department of Agriculture,Natural Resources Conservation Service, WA[11/13/2000].Downloaded from:http://www.wa.nrcs.usda.gov/FOTG/ SECTION2/hydric_soil_interpretations.htm. Snyder DE,Gale PS,Pringle RF. 1973.Soil Survey of King County Area,Washington.United States Department of Agriculture Soil Conservation Service,in cooperation with Washington Agricultural Experiment Station. U.S.Fish and Wildlife Service. 1995.Revised National List of Plant Species that Occur in Wetlands:Northwest(Region 9).Downloaded file(region9.txt)from National Wetlands Inventory Ecology Section[http://www.nwi.fws.gov/Ecology.html].Last updated 7 August 1995. U.S.Army Corps of Engineers.2000a.Special Public Notice.Final regional conditions,401 Water quality certification conditions,coastal zone management consistency responses, for nationwide permits for the Seattle District Corps of Engineers for the State of Washington.U.S.Army Corps of Engineers,Seattle District,Regulatory Branch,Seattle, WA.Published:June 16,2000;Effective:June 7,2000. U.SJ Army Corps of Engineers.2000b.Special Public Notice.Corps of Engineers regulatory program and the Endangered Species Act.U.S.Army Corps of Engineers,Seattle District,Regulatory Branch,Seattle,WA.Published:April 11,2000. Washington State Department of Ecology. 1997. Washington State Wetlands Identification and Delineation Manual.Publication No.96-94.Olympia,WA. SEA\E11598671WETLANDS DELINEATION REPORi1RENTON_WERAND_FINALDOC 21 • • • , . • -- • APPENDIX A Field Data Forms WETLAND DEUNEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT Appendix A: Field Data Forms Sample Plot ID Wetland Upland SP-01 ✓ SP-02 ✓ (Wetland B) SP-03 ✓ SP-04 ✓ SP-05 ✓ (Wetland C) • II SEA/E\159867\WETLANDS DELINEATION REPORTWENTON_WETLAND FINALDOC A-2 . WETLAND DETERMINATION SAMPLE PLOT DATA FORM CNHICL DATE/WEATHER: e,'f Ob , Sid Ai NI 1 SAMPLE PLOT NUMBER: SP- 01 PROJECT: rE JJ ►1/41E I"0` ' T. .s70R-+tiW IROZ. ❑WETLAND /�(UPLAND PLOT(check one).` LEGAL DESCRIPTION: SEz=1. t o i `�Z3AI1 P-OS t CREW: 11 • G�`f "-T - LOCATION: 5 LA/ 6( 03 2. -(a.AnQ B COUNTY: /N(a ❑Transect? or Wetland Boundary? If boundary, 5 feetXUPSLOPE/❑DOWNSLOPE.from boundary line. Do normal conditions exist? YES/❑NO (check one). If NO,explain I Has vegetation,soils,and/or hydrology been significantly disturbed? OYES/ NO (check one) If YES,circle which ones and explain MST ctN1 L'1 ) $u i ,q 7 ote ' mil 7- f— S i iN= f -b a r�� c c.c L--1. • s' - '.'' : - - : VEGETATION • . SPECIES(,#=dom.if>20%)STRATA*COVER STATUS SPECIES(#=dom.if>20%)STRATA* COVER STATUS * Ael t os,h s +? u's I H 18 0 %I tt�`tt�L I I %I -D$1,'-t q r u s c 1 (4 11 0 %I I I %I Ktitlasv la.0 la+S 1 v 1 z0 %IFi9Gv+- I I ' %I 1 I I %I_ _-- I I %I I I %1 I I %I (*T=tree,S=shrub;H=herb,V=vine) Percent of dominant species that are OBL,FACW,or FAC: I O0 % Cowardin Habitat Type(s): HYDROPHYTIC VEGETATION CRITERION MET?)XYES ❑NO Rationale/Comments: r- Q 7-14-40 Ssd 7. i)610 i/4 Romer S P .--/"ES ApE OB L i Fyi-GW e)( Fi4-C. . SOIL'S - Mapped Series: A l c w o f �,(. On hydric soil list? t'NO/OYES Match mapped series?❑NO *YES DEPTH COLOR TEXTURE* MOTTLES Hydric Indicators:(check if present) (indicate depth) 0- ID to`(IL 3 12. 90.R El Histosol or histic epipedon l©-!4 I OY le. 4/q J - e . _ 0 Gleying 0 Sufidic odor I 0 Aquic moisture regime (*si=silt,c=clay,s=sand,g=gravelly,m=mucky) 0 Mg or Fe concretions Abundance:❑Few[<2%1,0Common[2-20%1,❑Many[>20%] ❑ Low chroma matrix(=1) Size:❑Fine[<5mrn],❑Medium[5-15mm],❑Coarse[>15mm] Mottle Contrast:❑Faint,❑Dist[1-2units],❑Prom.[>2units] 0 Matrix Chroma(=2)&mottles NO Hydric Soil indicators observed. HYDRIC SOILS CRITERIO MET?0 YES Rationale/Comments: -NO 1Y bR-1 i. itN0 i,. I N bi c+w(i S b A s* e 5 ' ffi b M eta J 4^A- .HYDROLOGY Depth of inundation: '-" Depth to saturation: — e NO Hydrologic indicators. ❑ Oxidized rhizospheres ❑ Saturation in upper 12" Rationale/Comments:;;.. 0 Water marks on 0 Stained leaves ❑ Drift wood ❑ Surface-scoured areas ❑ Suspended sediments ❑ Sediment deposits WETLAND HYDROLOGY CRITERION MET?OYES 0 NO Rationale/Comments: No Hy b e-O L D G 1 G, /, -Di s A-To 2 S. JURISDICTIONAL WETLAND DETERMINATION AND RATIONALE WETLAND?❑YES i NO COE Manual applied(circle)3. 987 •r 01989 Boundary,Criteria(circle applicable): OVegetation,Osoils,❑hydrology,0 topography,❑(other) break(s). I ''// Rationale/Comments: S O 1 t- rt S .f. y b R-O L 0 6 7 C.1e-4 T -i A N b i ton'. SEWOFORM3.0 A1 00 1 i WETLAND DETERMINATION SAMPLE PLOT DATA FORM CrifalHILL i DATE/WEATHER: g�, 0 d 5.,AI a`I T' SAMPLE PLOT NUMBER: SP 0 Z PROJECT: Q�1'T j NU 10`N` Sr. SME-Ot O- 1(23 i,)K1WETLAND / ['UPLAND PLOT(check o_ne) LEGAL DESCRIPTION: 5 estir. 10� T2.5 NI (2.D S E CREW: l�' t�-i LOCATION: CEVIV-- 0(` "�`-s,GE W eTt_474)/3 EFl-c`S ,r ) COUNTY: ,v DTransect? or Wetland Boundary? If boundary, 1 0 feet DUPSLOPE/NDOWNSLOPE from boundary line. Do normal con itions exist? YES/DNO(check one). If NO,explain Has vegetation,soils,and/or hydrology been significantly disturbed?DYES/)NO(check one) If YES,circle which ones and explain NOT 12-E 6N M,.I, 3 0 T A-'- ()Js rf M E 4E s sir •tiMO B� i r-[-6i,2t- , ' VEGETATION - SPECIES(#=dom.if>20%)STRATA*COVER STATUS SPECIES(#=dom.if>20%)STRATA* COVER STATUS + C—tx 019t -fv, I 1•f- I 80 %I o31-- �bvs 4a.c•►l.ic CS I V I lS %I cJf �urcus sus I If' I ld %IT ii-v"-" Pic -ei;v5 I H I T %I F4ct^/ ,Sewn la 4't race- I S I Lc %I rat, V <o5`fi 5 o i S I 11 0 %I Fitt- . &it, ►o b. rriin oi-vff1/4. i bt- I ?" %I tit- I I %I G1rs't) VtI an-GI 4 15 %I Frieu I 1 %I (*.T=tree,S shrub,H=herb,V=vine)Percent of dominant species that are OBL,FACW,or FAC: /e o% Cowardin Habitat Type(s): i)h C HYDROPHYTIC VEGETATION CRITERION MET?(YES J'NO Rationale%Comments: VIOR.E sp-ftwQ S° '/,' of I)O►vn i Nsr `i ocZ+ '/S 041. i FA-C.lnli 02 P { . -SOILS . . Mapped Series: Al(:(PA-WO0oil s)Q On hydric soil list? tZ O/❑YES Match mapped series?=tNO/❑YES DEPTH COLOR TEE* MOTTLES Hydric Indicators:(check if.present) (indicate depth) 0-h.. /01/- V/ g S41 — 0 Histosol or histic epipedon 12. - lit r0 Y R 2/2.. 5 s>.8 . !d y A 3//6 ❑ Gleying ❑ Sufidic odor i ❑ Aquic moisture regime (*si_silt, -clay,sand,g=gravelly,m=mucky) 0 Mg or Fe concretions IAbundance: w[<2%],❑Common[2 20%],❑Many[>20%] Size: ine[<5mm],13Medium[5-15mm],❑Coarse[>15mm] Matrix Chroma(=2)&mottles Mottle Contrast:❑Faint,❑Dist.[1-2units],,]$`Prom[>2units] 0 Low chroma matrix(=1) ❑ NO Hydric Soil indicators observed. HYDRIC SOILS CRITERION MET?'YES 0 NO Rationale%Comments: -M PrTitA'k .Gt 3()4 = 2_ W i 4 ,vto ,HYDROLOGY Depth of inundation: — Depth to saturation: 0 NO Hydrologic indicators. ❑ Oxidized rhizospheres 0 Saturation in upper 12" Rationale/Comments: ❑ Water marks on 0 Stained leaves O Drift wood 0 Surface-scoured areas ❑ Suspended sediments 0 Sediment deposits I-0C a WETLAND HYDROLOGY CRITERION MET? YES 0 NO ig� � r Rationale/Comments: 4cS.rvi t'`D R/ISM on) Sol t. S �l 1 rd', � }e 7O s g. ��/� JURISDICTIONAL WETLAND DETERMINATION AND RATIONALE WETLAND?T YES 0 NO COE Manual applied(circl- - 987 'r 01989 Boundary,Criteria(circle applicable):PifVegetation,J oils,Ohydrology,❑ topography,❑(other) break(s). Rationale/Comments: A-t-t- 3 Ceti'f��-"4 Mel—. • - sEWOATFo1M300c il WETLAND DETERMINATION SAMPLE PLOT DATA FORM Oaf HILL DATE/WEATHER: 87Y00 SAMPLE PLOT NUMBER:SP-' 03 PROJECT: R To'-' Nc /O1 ' 5T. SW) uJii {Z ❑WETLAND /OUPLAND PLOT(check one) LEGAL DESCRIPTION: S Cr /rO /Tl3,J/ 2 05 E. CREW: CAI t E.r LOCATION: NV' Cor n of S COUNTY: lG/,JG OTransect? or ❑Wetland Boundary? If boundary, .r. feet❑UPSLOPE/❑DOWNSLOPE from boundary line. Do normal conditions exist?/ .YES/❑NO(check one). If NO,explain Has vegettion,soils,and/or hydrology been significantly disturbed?❑YES/FrNO(chechone) If YES,circle which ones and explain VEGETATION SPECIES(# ..m.if>20%)STRATA*cOVER STATUS SPECIES(#=dom.if>20%)STRATA* COVER STATUS j 4 Wc.cis '' sys I 1+ 140 %I � I I E.p r (ok ib 1 : rn i ce-✓ I 4 —I 10 %I NL • I I %I * poi .. ncays t-ee. I 141- 18o %I rArAv I I %I .ple,bvs 14ciL.3a.1s 1 V I 30 %I Clico+ I I %I cfr Flegc• 167t. I T 140 %I 1-✓ I I %I (*TTtree,S=shrub,H=herb,V=vine) Percent of dominant species that are OBL,FACW,or FAC: 4 S % Cowardin Habitat Type(s): -- HYDROPHYTIC VEGETATION CRITERION MET? YES 0 NO Rationale/Comments: Wt-0 e-E. `FJ 5 O 1, a F Dow/i"NTS iwa c 6 A L/ Fitt wi 6,/2 i SOILS r nhi peci ..e'ries• A-I d.c...i,.1 J ad t On i-y dric soil list? d0/ �:�S +'t r ES r �� � Matchniapped series? ONO/ DEPTH COLOR TE * MOTTLES Hydric Indicators:(check if present) (indicate depth) l 0 0-/ 19 JO� / S i,Q ❑ Histoisol or histic epipedon Y / s` ❑ Gleying 0 Sufidic odor ❑ Aquic moisture regime (*si=silt,c=clay,s=sand,g=gravelly,m=mucky)_ ❑ Mg or Fe concretions Abundance:❑Few[<2%],13Common[2-20%],❑Many[>20%] ❑ Low chroma matrix(=1) Size:❑Fine[ m ❑<5m], Medium[5-15mm],❑Coarse[>15mm] Mottle Contrast:❑Faint,❑Dist[1-2units],❑Prom[>2units] 0 Matrix Chroma(=2)&mottles JNO Hydric Soil indicators observed. HYDRIC SOILS CRITERION MET?❑YES ;VO Rationale/Comments: N 0. t�yeo 12I C. f 3 t 1. it/DI G/4-M P S o l f&V-1/6.1) -- 47 6,4 c/1.2 D,ti 04 HYDROLOGY Depth of inundation: Depth to saturation: — ► NO Hydrologic indicators. O Oxidizes.rhizospheres ❑ Saturation in upper 12" Rationale/Comments: O Water marks on 0 Stained leaves ❑ Drift wood ❑ Surface-scoured areas ❑ Suspended sediments 0 Sediment deposits WETLAND HYDROLOGY CRITERION MET?DYES ) NO Rationale/Comments: NO ll y D P-o L0 61 c- bib,C.I--' b/Z S. JURISDICTIONAL WETLAND,DETERMINATION AND RATIONALE WETLAND?0 YES ►= NO COE Manual applied(circle). ►98 or.❑1989 Boundary Criteria(circle applicable):OVegetation,❑soils,❑hydrology,0 topography,❑(other) break(s). Rationale/Comments: 56/'S - l y1)PL O(, y ,►J'T M rr. SEA/DATFORM3.DOC 1 WETLAND DETERMINATION SAMPLE PLOT DATA FORM OKMHlll DATE/WEATHER: S 1/4/0D SAMPLE PLOT NUMBER SP- 0¢ PROJECT: PEl-rbr /de tOS 5T• 6713/2-**µ141112 OWETLAND /UPLAND PLOT(check one) LEGAL DESCRIPTION: 6- T. 10/TZ;.iv, (Z OSZ. CREW: kl F'Li-V--T- LOCATION: --El.00' S- br- ju vi CAy j.,0,, i`'- t- COUNTY: /,t/C ,Transect? or .❑Wetland Boundary? If boundary, feet❑UPSLOPE/❑DOWNSLOPE from boundary line. Do normal conditions exispYES/❑NO(check one). If NO,explain Has Mgith soils,and/or hydrology been significantly disturbed? ES/ ONO(check.one) If YES,circle which ones and explain VEL C7T41-�0/� A-f'PE- Ia<s CFO Y— /4- sty J L 4 t L4 VEGETATION • '--- PECIES(#='dom.if>20%)ST TA*COVER STATUS SPECIES(#=dom.if>20%)STRATA* COVER STATUS l 144cu!/ar r , 1 15 %I -w I I %1 # i,t - .ci(4 c I 12-0 %I.F W - . 1 1 %I f Q) C -c 1 1 12O %1 L✓ 1 I %I it f/S 'I. .t;i ,a. i,s 1 I 2,5 %I 9C- I 1 %I _ 1 I I %I I I %I (*T=tree,S=shrub,H=herb,V=vine) �— Percent of dominant species that are OBL,FACW,or FAC: 7 r % Cowardin Habitat Type(s): HYDROPHYTIC VEGETATION CRITERION�ET? S 0 NO Rationale/Comments: M 0 Trgei 5O !, ' �.D ati .ho q-N'T SPA,E5 A2-t 62,Lf 0_ OL . :a } SOILS v _, ,4Iappec.series,. ' -wD o aP 1 ss / On hydric soil list? is NO/❑?L Match mapped series?❑NO/, ;;' a. DEPTH' COLOR TEXTi7RE* MOTTLES 'Hydric indicators:(check if present) (indicate depth) 0- 1 Z. /0 Y A- 2/I iS.:-( '''"1-- CIHistosol or histic epipedon L ' /¢I /0`fa. 3/7- 5 ' ❑ Gleying 0 Sufidic odor I• 0 Aquic moisture regime (*si=silt,c=clay,s=sand,g=gravelly,m=mucky). 0 Mg or Fe concretions Abundance:OFew[<2%],DCommon[2-20%],DMany[>20%] ❑ Low chroma matrix(=1) Size:❑Fine[<5mm],DMedium[5-15mm],DCoarse[>15mm] Mottle Contrast:OFaint,❑Dist.[1-2units],❑Prom.[>2units] El Matrix Chroma(=2)&mottles jNO Hydric Soil indicators observed. HYDRIC SOILS CRITERION MET?0 YES 0 NO GM Ovr 2. 8"4 Rationale/Comments: NO 14- b ,c PI/... it,t t GA-TDAS 6 &re* ✓tD . ' do /u 0 1 -c`3 • HYDROLOGY Depth of inundation: Depth to saturation: ig,NO Hydrologic indicators. ❑ Oxidized rhizospheres 0 Saturation in upper 12" Rationale/Comments: ❑ Water marks on 0 Stained leaves 0 Drift wood 0 Surface-scoured areas ❑ Suspended sediments ❑ Sediment deposits f WETLAND'HYDROLOGY CRITERION MET?OYES 0 NO Rationale/Comments: FJ 0 t)Rail-o&,G l P D,c.A- ° -S d BSEA RFD , JURISDICTIONAL WETLAND.:DETERMINATION AND RATIONALE WETLAND?❑YES ►_' NO COE Manual applied(circle.. =1987 ,r 01989 Boundary Criteria(circle applicable): ❑Vegetation,❑soils,Ohydrology,0 topography,❑(other) break(s). Rationale/Comments: Sd!LS + I-,DR-0 L a 6/ C/Z-, r1 v2-/ A 14,tr. ,4 Cr, SEAfDAWORM3.00c WE ,17.}pG WETLAND DETERMINATION SAMPLE PLOT DATA FORM ClaIHI11 • DATE/WEATHER: I1 a/o o SAMPLE PLOT NUMBER:SP- OS- PROJECT: € � - IV E 1 D'r'Z' S%. Pit aii-i l2 IeWETLAND / ❑UPLAN PLOT(check one) LEGAL DESCRIPTIOiv: SEz�T ! T Z3 n/ l a c E CREW: II, £N L& /T W LOCATION: 0f 1 r V Al-. N -Ti1 o-k -f.,Ai Err-E °Dew:� /,.) t -t1 'J f)-6C !!!! COUNTY:_ K/N ❑Transect? or (Wetland Boundary? If boundary, C feet❑UPSLOPE/gOWNSLOPE from boundary line. Do normal conditions exist? yES/ONO (check one). If NO,explain Has e etah�n soils and/o ydrology b n significantly disturbed? YES/ D'NO (check one) If YES,circle whines and e ain Ev i d- c.,,_ o l c( i(• re 51 a{o.,t oil GI:.Q 4714 s 7C-„ .�r\ wf re-ltzt.,I,r J IA/ o 1 1 1 VEGETATION SPECIES(#=dom.if>20%)STRATA*COVER S7ATUS SPECIES(#=dom.if>20%)STRATA* COVER STATUS J of v►.c c tvf 1 j-} 1 10 %I ,-�'b- IA.) RA, pc d}scalar 1 V 1 5 %I C() 'IFfraxNkuS lay'. IT+ S I —%I i i Gi tjG, ivy 1-7-1 T %I AP-- # 'Pop i v S -hats: ^ 1 Tfi s 1 20 %1 F5-L ALE►.,,k w r iIS i-e- r i--I I T %I �4 w' . # Al.,ils Irtllra IT I 2fl %I F . I I %I ,0 sex )s3cam.P I S 15 %I frz•- - I 1 %I (*T=tree,Shrub,H=herb,V=vine) - �� Percent of dominant species that are OBL,FACW,or FAC: I 0O 4)/0Cowardin Habitat Type(s): G HYDROPHYTIC VEGETATION CRITERION MET?$YES 0 NO Ali,' c �� Rationale/Comments: M R-c= "rh,�a 5 0 'l. a F D d M/NAI4' - k2t oeL FA-C.1/4 02 Fi9-C, SOILS . • Mapped Series: I&woo d . ' On hydric soil list? Zi O/❑YES Match mapped series?❑NO/❑YES DEPTH COLOR TE b •E* MOTTLES Hydric Indicators:(check if present) (indicate depth) 0- 3 l042 4/2. R 0 Histosol or histic epipedon 3 + I PLifusa.2 iw fil.( 0 Gleying 1 ❑ Sufidic odor • 1 ❑ Aquic moisture regime (*si=Silt,c=clay,sand,g=gravellly,m=mucky) 0 Mg or Fe concretions Abundance.13Few[<2%],❑Common[2-20%],❑Many[>20%] ❑ Low chroma matrix(=1) Size:❑Fine[<5mm],❑Medium[5-15mm],❑Coarse[>15mm] 0 Matrix Chroma(=2)&mottles Mottle Contrast:❑Faint,❑Dist[1 2units],❑Prom.[>2units] I ❑ NO Hydric Soil indicators observed. HYDRIC SOILS CRITERION MET?KYES 0 NO Rationale/Comments: ASSY 41 El $A S+) 0.4 Ho R--fl[. /,No i<AI-7 (LS • . • . - .HYDROLOGY Depth of inundation: Nz+ a bsp:i 4-ed Depth to saturation: ' ' abS-e/V 0 NO Hydrologic indicators. i 0 Oxidized rhizospheres 0 Saturation in upper 12" Rationale/Comments: ;Ei,Water marks on $ ❑ Stained leaves 14 Drift wood Surface-scoured areas - ❑ Suspended sediments ents 0 Sediment/ deposits til 8v n-I- pa-.., I C.a„r, 4lid V,o Le_ 4 s-%c t'I,��j (.,, yf.-c WETLAND HYDROLOGY CRITERION MET? YES ❑ O / Rationale/Comments: JURISDICTIONAL WETLAND DETERMINATION AND RATIONALE WETLAND?',►: YES 0 NO COE Manual applied(circl•)0►'= 987. u r❑1989 i Boundary Criteria(circle applicable): S`Vegetation• ,❑soils, ydrology, topography,❑(other) break(s). Rationale/Comments: A 3 C.R-1 r 1 ,} f1 .ice — - -----1-- • TN SEA/DATFORM3.DOC ----------t • - • _ _ N . - , 11 '1 Y::' y. J: ,tom, ,/.. ./. - c, •'_ .5. 1 �. . 7L r - - `,ma , •, . � I ' ..,., . /::-' -r;' .• \ \'1i : -�:.:; I ; ') ; ,_- l :'is �L : ;. -l:r : - ' 'r r _ • ci ,.i `�r ter, -�. 'a..;-�,.,;ti', • .�. - jam' '�: ,i-. i( ..:.. ..:...-.gin k : • ice,. ) "''�-, , `�^(Y,, "-- 'qj - 1 -fi>r�, - V e f:, J y _ '.1 )- � ter' <,;_'''' tP ;' .F:,. T- _- ` -_.fir _f:'.�• '�• �_"• :,r'<` � � t,\"_` �>�' - �i'� t: ;', -,i.: .t-:.\.:. '{' 1 .I,•:, '' yk': I? -1. 1. ;icy .. _ • J' :�: ��j, _�,,.'. l' _'r::' r. - irk. �., .}s.-r:if: 1" ;f -:tip _ ,�Y� L` y1e, -f• `•lam, � �d y - 1 'A T �, ��= do-'" (L:°::Pik :.�. '( , 1" a� J. - , .i.h... =',: �. :} .vow .>,t '•-''i '.' .:/.- .r. ....---,f �n,,..c,: I. // :<4:"-. .1 �. ��y• ^.i' - .L', E}<� :'\s f-!"`'7.. /'.:� a.. tl�� -`:s _ •+`,r-- yln- -.T .:Y7:.rC t vS.. +:-':5�"''... '•�C _. ';;: Y".t ' „t..z -.!._ ,�. `J.+��', {. . :7-_, '`f`tea• , '�• - :-..- ` - -;5:-, `;ci� _ ;=���:'�,.;::. r. .,., ,. .ri•, _ •�. r. lam\". J. r ; 7'�'. ,:.fir. -v? -'::" �'•`:;.•; - ti�i v'L<„ .:YY J<.:�',-5,Y •.r�iY r\�:. .-I,,..4, - TY;:<i,)l I "...`u., �r'. •� : Y;r•'' ,l. s'V:� T. -gip •'�C"': :,Y. :..A`'"'. ).. .�5•�+.:-`i+ .z�-',S y� u, .-,eK� A3yt'� fr:F :'1,i- a.:! l'. .0 ':' 6 ,i .F 1. �� ✓\' �'na ••?•:•:rid. :'Y�A.: r,,^'::>•-� �'" lu ..r:7...b,[[�� 'i r .�_•, "•-�"__ ".r^.y::r. ,� yig-: '. �i'4�:'-;„�� "r('" �., � ,.'*�.=.v. ,/ ' ".4':`: ,`' 9}./-f�`1 .1:. v<r�t''�•.(r•5 !",`,y.a '�•.' _'.:']-" y,.� '.�: � - „l-.l�./ i S>ai" �' .;.v,.r. _-\.- .rt.,- ;�:- - --..--?"'�t.':'t7�..;,�i . n1,.. Ci�.t..:- �, f ['i:�`,�"::.'tiG� �.i =J-. FI✓::=`I .h.,. -J::'.�:': S. .,:,t..•.,-. +T,c ,a,..,:`Y"-;5 ':.7.:''i . !;; SiY, \,. -.ti;d.<C„{/ :Yl-r:. y :,): ✓.+`5•r `,.„ r:: }} ' ,i.-v ,,� �•�-_:., ,.`+r=.,•r�} ,.t;�" -,r�.,r:� :§ �; ,1''S.t;l:,�.:�`.�i\:' �ir. - '.f ., ti,, .�T, ,'•i-:�k. :�. ''S''tr�;4S.<'�C. ,s✓�;�';,`' .. er ryn. r<•. .,r.,ysVz4�u,a i5;-' %``'`-,�'_ `-`:3•, v.- . ti3<: •'>r... M, _ ,.T,'`.., „fr a�' t . ,, r.,;1',. t t:y .si.,, `J':�',: -4 ,.�� :aj�Y+:-:�u-y� Y.T.. V .S'] ' y '- �'b':=• _p� ,r�'`� !..�'_ "l,-.:. "-: �x �� ..F;'� .+u „f '''E:,h, <# _.,. t- sv3''�":� :.�i Y.;��w" :,.4•'ti`:��: .;1 F� 'i`:;.�:�-y-n; ±r - ,y -��nl??:;�,�y� .�,.t, ' _r �•"i:x•r =�x'ripc�'r;".. 1�d,' k •'x:z 'z, ..'�,_, ,�;-.:{-'•!':�: -_., ;tc. ._Z. �.•.,rf^;?�� v-a^, "�'i'.-:"�"•' as r'4'r,Z`,`.�V,• t. xii:; `,.-ii:.r',. %�<'�;- S _';',W` i{ " 'ik: +'4` i°,,••,i4;... :ram.,., ,S, a,-= ��`15re . ,:-;�:,+'_ .,Ati may >�z4 ,„.,:,s.7a. : • /.,A:r '.:,'." ';. _,; „ r•'.:''�;�,.1• DPP .-� ' : �`i+. %- -r;lf+•,-� },ti�,. +..< -�'. t" i- ..'i:- '4'�, -at•:_� _ > '�•- :i K.,.r,•G3.1- �.G-�... a'�•' •x_J:'h,F;.a'q.:s=_;4r %s+ 3,(r:.,;',•,:v� .,i.•,.<fw `'1:�;z��•:.{,,, r:�-.� .!„r ;Il: 4:,.��, �r :z'':, ��•'�:"r;lx'�.;�f-'.�..;;;�.•_:y,.T- ...-rt+:.r'v.. . :,, ,,.,,- "a,.: 4 .,.f y;- _;:£r h-T� }�.�.•• ..-A-?.., -'-,•i.+'.„' :t'. t..'',, w:< Sf.- '„ y. ,,>•, .r, .,.3:. ..-. 't� f C .! u `tl r�'W:. ,,,.+- ram:' {;��. \�ti.,..,�•.ry.•' f 'f' �^.,. v. ,c,'.� •,� ';h, .(:,';y,.>:,;1'.')),z>�sI`•;111 ._i°r�+.t' ,?a'R% fir,.J.4;.,. �Y:`•'A; :ri+ ), lei,, .Z. `ii7•z':,,,, "'4,'a •� ;6.-' mJ' '�s`t'.,• .•,. ,e ,, 1:' ' v;;.r�., %'...e �,'7 i.,y.{ e',!,'�"A.. '3'',. .... e'<7.t�.,\,.. f ?4 r[.+-. ..- �../ ,v:.,„", . r5{ _.s,-: ..;•",,,•>M1 i? y'.• �' ��l'y. -����•F..Y�' ?\ �-.r:[:r�:b��p.. .�.7': Ji �f... '1i1•'J�,• . :T- ;�C=. "'��`• '%r: �•~?`!:', v ',��,-�.t.,,;��� .1 f.V�. - .-�•'.�,-,�•. f 17" ,'-,' 'i$: �'��:�^�,.•, .�Sf. d�',n:c..,� t' s•tjr:c• =e„ A:.�.',r•t ,:,: �„+\. .r.'''t;f.. rv;�� , xY .,1'•�'4.:,;:"-G* ;,�:^,�'�:'-:: FX "�? .<x1-'... .;tn�7�..--n..{ .,�t t �. •,•w'�{�' ?t<?, .V•," /t. '-`t.,•'1.Y• `e�e•«hr 'rsr•Ir�:P,,..-'- 4,�:;,�';�,W_i4: :\�P' i��r.. - _ " ";,•," sl' ..r as' "-^�,�_ �r ,,,,,,,, •- 'r•'^r„,,,�, ;,{,.- o,r:,T,Y� nJg :;,', w,, !y,,., ;�` � , .r;.:., '::z:'"':•�,;., :.:r,.., d-;•,„. ,?„,,, 5„„ .i `.: - ..;1`y4'::r+1'i't4' ,.,7.e:" :<} ;ae d� i53T.. .sb\a2��,,.iFr.., ", r �,•�, .r<'�, a{y: r .Ytr.�r.+:'a%..,-_a rd. .rt=,.,.o'... .gy: . <eS<(�: -t,/ �.',v, - ',d<. ,...:\Y "<- -.V, ` r1.+ _ ;t;✓/ .:.:V';` < ,�`,'v. ,i'w'�.,. r 4' � , e t= + "�i,,,,4-.'J('' 'it.i: 1 ..." s:" t., t„..,,%,,,,,,,Y '�J ::.Y;, o�<.;{j ,'%,-f•,:1 ,!+ ,Y`�:'., rl lY•�:�•�•i•R�\: S':.,a`,'�'u.s�ry +.�.�7,'t?.'.4r3 '`S� >< ,. rv••.ti r., •i-�,'- ;•, ,�``.:'.. _ 7^ :,:,.,�,- _:. =: "r,-. "a.< ':., ;. :+'$ �"-Th,^;' S:s-� _.r: .. •f=-. �.--1",\•''.:• .ti`�. .ti. ,\ '�'r .�f 1",1%''i. {�..�y.`5�°."' ,•:c��i��iC`;?:.�'. �,���a.. r•:. �,4'l'_ r:�;.T�i'�:: .... r'i:}}. .c. t5 l'i' - tb ',1 --- ".�:,!„4.,41., .{' ,.,rit• l''C' ..`pI,� ::�- .... "`>.'•'=.,, '<<. ,,h�: " _=T,',' -/,.-C^re :y` ,.i'u _ �..(.•` ,�: ..:-?V i• :4'¢,•l:, ff� r;n .�.>••1=T..-�• �,1. -:,}�e 1Y',' `::;<.:�.. ,y<. .r,�, 3;y�..'n7�'->:�,�.�.`,� rf` �'_•.. .�.,,: :,�F 5� .f�::'�r� .4 ,':'' .,. '.- r t„ k,?. :,-1-•' 0•,.(yr \, i .-.=5,r:.,.a r,.:i..i.11•''. \\ ' .. . :wtC,•''li' ":j- .f.`"i.**i>.v-�.,,' ;811 ' a-_, s`i_i.. -`S,'•.L ;:�-, � •;r\y�"�l:r �� �`•.._, ,9,, •.�#.,�_�`";•�: ry', ,,��,. 'rs�, ';?rY�,l,. '�: i.n;.�.r.'•f,ti?',4' 11�,,,� Vfi :�`-+��a''<:" 'z: z u'. a=c�;�` -v, >Y�, >:� .4"^ -�,..rr� ,.:rv. .,,, >.+r,, . ,.i;,.:y=��-t'3-; :a,. '� ;,,:`S�'•�, Y.,.,"h .Fn,�:W •F! y '"•..(• kt< �\<'\"-„ >_,t•• ..V ]` vi-'r'+`• FA '"', .:4",' 4 1...., /-,- :-. ))0-' }., t �-- _ x�• -��rY���i' �"\," f t ..�•''�•:Y.��y� j'�{.p: �Y.t� ��<•^�? �'�-.c..•:. 1 '{r:`;3'r�<i'ij, zt:V`7e,ir,�:;,5< ; okn"x.,, :�;-- :'�f`.i- ';i�'x.,r;i.: X 7 �%lrR�` :.\; -�.:'� :1 .,Y,.. .`t-4.�^'I :,a �). .t.A,a�fJ rti,,r- 4,6.,.„3 1;+ _,:'t-.. -7rc,)li:,1,', .,._,Zn,rl,,?1 "�•': ", ,f-t•.,%7.i. _ :j, .?:Y. , -.',.----?.t ,.'d<'''-i-:1/4. ' ' i ..F,;',e u..Y-_": '�~?1 <L,. +r 1p.IZ «•, "`t-^_:f-r!•"d..xd..ei,.0�' :?.3•.;•k•i-r.=`a�,':of- 1 p ,,W:.,,,a:"`:;; �� r.„''i,!+,,:,. 'z:f S'::i. '"'i.�' k,5 `,N'�•?•c,.: '-<�:: .i.Y,., �•;•, ,•y..,Ayd'3_3 , ,,�':` ti+s.�T,r-�--`'<. - .✓ i. •<r� �¢`si;�.'%Ft-ei:.....•t�`1:�° �i.J�'�:Y,.+i: .1:.,, '` :?='�� �-.. .7'�•,�x_' ': - :'�'�•1''u��;p.a: +. ,Cx:.=.f, .�. '*i .� _ .(�:t':. .;•=" ,r:�'•: - - :??4.-,i,•'k• .-. -•'•.�.•'Y,=' :a �'•,: �,,����f fir .ti=;�--=s;,�r ^• r• . a'y.'•w,,�r�siy„.t .+e' ,.����•` `� ;����•^'��i. ..:< ^�,:":`Y='•:�J`�n�r-•� a�'�,'?=t, ."�'k�� ,f�::'l•,.• 4,)f :.\, `•Ez'�',;^'�',•1_i �- ..e. .�.;•s ., ' iC; k; N,\i.. .•(k.' ,, .M„ „� 'u;CN'�;c3:"Z' „1, ,;i_ -u.X.:;y, ,,.. .<: ;:.. i!. '' 1,1�' ' —.�,./Y-�v .>l,� .,r:i.`.c :`:'`'*'�„f .+' ;e.•. r j.- L�,4.,. Vic:. r; rry?'4+f,,t,'yr ,1.,;'-„f._1' +c' ,:y�r'.ir. "'� '•;-b,. '�''. 5:'�.Gt' - .n.�:rar s. '�Yn t ',J"�.•F`` ,j ��Yf-:.a'Y:�T.i v !-. ��.�; ;)�/�.�1��. ��C4.�h�a, ,.r�'::•�.�tTr' �c'1�J�":y:��cT.T.-:,.T�., "r�i n.�;a o%_�'.;�n; 3f'': •'4.�L�•;'�: � , y S r'a4, d'R:: `.. r �. .I'Z ., r -qy,.-r'+-' "-0. :41' , k•, 5-1, <' .);;.,c, [t d.:.. ,r �r "r �: '•�'r.� ,." c: �• ;�F54' ,,-.��'�•. <��;= r�:r,; ., ..,Jf is i k.;�v.. �r%�:"F' �,•", � / •=,,'S,`,�:7;',, '%'�„ - _ fi:,. ,„a:�JS�Y'Z:•r. .ti. v. --L1, T '-+ . fa,._ 3l� h, n1 l.: J'4>j,`.\<4.).,p.:.A? 1: y_M } Y,• .ta.,, -J �/K•�r,i ':;:�..f�i''J/�T:.•rs"i. 'Er•`r.. -t• sp%1: ;,. v�`S jt!� sv... ,;', ,.�R' ;�kl -Sf'� �7;:-�; .�-;;,-��:'�-;,'z,,�:}.:2;''-"t?.�'1r)>�_�r•%a.`_ ' ,447'.''-';;, -=ll,'4r-x:.' 64•i:_ - `'"';-f .. i '� ,. : .<�r ,7r h. yxCs �. >::'$ .ly 17`: a': �`cd ••((��-r �5" :1-. `�;.�-=�r�l. ..�.• ,�• � �/� ..�•:1`,°�"i��°�L.;., �f,t;•;, .-x. :n�T:_:ul_;� .�. '�,:� ' �,, � 4 ,.E-Fa i '.1' - ,T:: i I .rh4P.I, .fir.. r'• -T� '+< _ �' •' �,• F,1 :: • (�J'•I'Vr.{.•- L•'`:'/L-.jr�'p,•\Y' -•i'''� , {'- 1 {{ -,!`%. eil: .:^5, ..,^,,y.�... 4.�_:: -AS„ .,�.)�.^- _ Au. .,T 1.'�'. .\� .tr`.,`.. �Vc :'•�'?��`a^ •+.: '<;-r ;��- ..�' ` :�.�.. \. 7+1�ra•�.'� ,.4'�.'�.•' :.:--.:-�°':q,..j•y .r.:, y-�N�,� ' ,''�;f'v,,F,.,`Cei : r. �•,.. ,£ �= 4 ,{,.+i'3' �../' .Y- '>f" : -s, �'"�T'',.':'.;�`±sv•:-:/.-. ,� �y,r S�,r'i;::.;:�;; % .:r?;'��yv s'. ?, }l,.�,<:�?-:=1. %�cz�'•:y:'�(,'a r, ...�- "17:'..',..r:,`l::.r.,t�: .� :.��'..'�:';i;r- ..�':,:?;�:t;Y�s... lr - I..,,,.,.;, .� ✓� ,---t` ::1f-� `'"- - -- , ,_ ..al. �`.i .{- •k`4�'�Y'.a �-± ..�,,',7'.t=:..�.'.\C l:r"f,;. . �.'�''':<�._•. .,,,SL'/.t,^^:':.-:.,,vucc<a�\ WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT Appendix B: U. S. Corps of Engineers Nationwide Permit 43 (Adapted from U. S. Army Corps of Engineers, 2000a) 43. Stormwater Management Facilities. Discharges of dredged or fill material into nontidal waters of the United States,excluding nontidal wetlands adjacent to tidal waters, for the construction and maintenance of stormwater management facilities,including activities for the excavation of stormwater ponds/facilities,detention basins,and retention basks;the installation and maintenance of water control structures,outfall structures and emergency spillways;and the maintenance dredging of existing stormwater management ponds/facilities and detention and retention basins,provided the activity meets all of the following criteria: a. The discharge for the construction of new stormwater management facilities does not cause the loss of greater than one-half acre of nontidal waters of the United States, excluding nontidal wetlands adjacent to tidal waters; b. The discharge does not cause the loss of greater than 300 linear feet of stream bed; c. The discharge of dredged or fill material for the construction of new stormwater management facilities in perennial streams is not authorized; d. For discharges or excavation for the construction of new stormwater management facilities or for the maintenance of existing stormwater management facilities causing the loss of greater than one-tenth acre of nontidal waters,excluding nontidal wetlands adjacent to tidal waters,the permittee notifies the District Engineer in accordance with General Condition 13.In addition,the notification must include: (1) A maintenance plan.The maintenance plan should be in accordance with State and local requirements,if any such requirements exist; (2) For discharges in special aquatic sites,including wetlands and submerged aquatic vegetation,the notification must include a delineation of affected areas;and (3) A compensatory mitigation proposal that offsets the loss of waters of the United States.Maintenance in constructed areas will not require mitigation provided such maintenance is accomplished in designated maintenance areas and not within compensatory mitigation areas (i.e.,district engineers may designate nonmaintenance areas,normally at the downstream end of the stormwater management facility,in existing stormwater management facilities).(No mitigation will be required for activities which are exempt from Section 404 permit requirements); e. The permittee must avoid and minimize-discharges into waters of the United States at the project site to the maximum extent practicable,and the notification must include a written statement to the District Engineer detailing compliance with this condition(i.e., why the discharge must occur in waters of the United States and why additional minimization cannot be achieved); SEAIE11598671WERANDS DELINEATION REPORTIRENTON_WETLAND FINALDOC B-2 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT f. The stormwater management facility must comply with General Condition 21 and be designed using best management practices(BMPs)and watershed protection techniques.Examples may include forebays(deeper areas at the upstream end of the stormwater management facility that would be maintained through excavation), vegetated buffers,and siting considerations to minimize adverse effects to aquatic resources.Another example of a BMP would be bioengineering methods incorporated into the facility design to benefit water quality and minimize adverse effects to aquatic resources from storm flows,especially downstream of the facility,that provide,to the maximum extent practicable,for long term aquatic resource protection and enhancement; g. Maintenance excavation will be in accordance with an approved maintenance plan and will not exceed the original contours of the facility as approved and constructed;and h. The discharge is part of a single and complete project. (Section 404) Notification Requirement:Yes.Notification required for impacts greater than 1/10 th of an acre,work proposed in intermittent or ephemeral streams,and permanent above-grade fills above the headwaters and within the flood fringe of the 100-year floodplain.See Regional conditions below and National General Conditions 13—Notification and 26(b)(1)—Fills Within 100-Year Floodplains,for specific requirements. NOTE:Also review information in Migratory Bird section above(page 21). Regional Conditions 1. In addition to being restricted from use in tidal waters of the United States(defined in 33 CFR Part 328.4(b)),this NWP is not authorized for use in the nontidal waters of the United States listed below.An individual permit application must be submitted for any proposed work in these designated areas: a) Wetlands adjacent to lower perennial riverine systems(see Note below);or b) Coastal dunal wetland systems along the coast of Washington except for within the city of Long Beach provided the project is consistent with the approved"City of Long Beach Dune Management Report";or c) Lakes,playa lakes,prairie potholes,vernal pools,kettles,and camas prairie wetlands or within 100 feet of any such system;or d) In"Protected High-Functioning Wetlands"as identified in the Skagit WIN Phase III: Wetland Management Plan for the Port of Skagit County dated 1 August 1997. NOTE:Adjacent is as defined in 33 CFR Part 328.3(c).In the riverine systems,a line is drawn perpendicular to the river at the break between lower and upper perennial river systems. This NWP can be used in those wetlands upstream of this line only.These systems are - defined in the Appendix of the Public Notice. 2. The permittee must notify the District Engineer in accordance with the General Condition 13 for any proposed work located in intermittent or ephemeral streams. SENE31598671WETLANDS DELINEATION REPORi1RENTON WETLAND FINALDOC B-3 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT NOTE:Compensatory mitigation will be allowed within the stormwater management facility when: (1) the hydrology is persistent and permanently vegetated wetlands will develop,i.e. the hydrology is not flashy;and(2)sinuous edges,islands,vegetation class and open water interspersion are incorporated into the design;and (3)water quality treatment is incorporated outside of the compensatory mitigation area. EPA,State, Puyallup Tribe,and Chehalis Tribe 401 Certification-Denied without prejudice. An individual 401 Certification is required for all Section 404 activities. CZM Consistency Response-Denied without prejudice.An individual CZM Consistency Response must beobtained from the State for projects located in counties within the coastal zone.Consistency with CZM cannot be determined until any necessary consultation required under ESA is completed.The State's CZM review will start upon completion of ESA requirements. SEAIE11598671WETLANDS DELINEATION REPORIIRENTONWETLAND FINALDOC ' B-4 APPENDIX C Photographs WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT PHOTO 1 Looking north at Sample Plot SP-02 in Wetland B. r • i '�' `. ilitillikT"'"'" .. - r ,P ,, ;•�S+•.'AC ...- . ••c a ` % ,•mot: • - i..r*.,,.''• �•,,.•.> Y~, S ,J.,�. +{ -.v '. 7 (10)14 44 ar, , .+fit n t : - .- ✓ * - ' tl a4',.1 ^ a-.,.u • e• � . • K _ .r•-• . ir ._ 4 • , f . 4 4*• r" Afit• • jri.- ..J-r - 0/` +r: s f c, . i• a .� m r.. , $( 0'1' • t ti 'O; f • ,- , ',✓• i. ✓.' f - „,, r i,. .•44 , • t f•j'•! `• .fi • PHOTO 2 Looking west at Wetland B. Note bentgrass and soft rush in foreground. /Alt.4 t 4 • 3" `rr - . 01 r a i•y ,, . , A F • . , . yr µ., . SEAE:\159867\WETLANDS DELINEATION REPORT\RENTON_WETLAND_APPENDIX C_FINAL.DOC C-2 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 1 oTH STREET!ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT PHOTO 3 In northwestern property corner looking north at SP-03. . ,a • I% # t t i ,.. .AfilikV0110 keir.:40V it, 7.: • •\~ ,.. •1'C T Y 'yam' , -,i firI r!for -• - -r�r F i !�.` , . -4r - ' -rit:: ' ' %lois' ' .. ,Oat/4 './/'• _,,T"..' •-:• , 1,''. ‘.-.., • RYA.. r r +.r _ it .`.• 1. ,;_•,..., -.. , -- • •.'- • • : ..q. .- Al:A.'•' " ..''':i-_?-„; ' '. •4."...-- , 4, •,'•4 ei 3' 7-- J1 ',� ► IP _ya t. ' -°", v, . . •-tlk • ‘ -"Av.i'--;- .;,:. • ,..1 , ' - 4: , , i ' r.. it_... .ry PHOTO 4 Looking south at SP-04. Fence at right is the western boundary of the Vuong property. .. s w tea r .,. jilt`• - -- • - w "' ,ems.. - yam;,,,,. Av. 1 � 3 . r a+, 1 ` / 4 ' fir.•'.- ..�., SEA\E:\1598671WETLANDS DELINEATION REPORTRENTON WETLAND APPENDIX C_FINAL DOC C-3 WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET/ANACORTES AVENUE NE STORM WATER SYSTEM IMPROVEMENT PROJECT PHOTO 5 Looking at wetland C extending northward off site from the northeast corner of the Vuong property. Notice debris and ground is bare from flowing and/or standing water during the early growing season. .... . - • • . -,* 4 • .1. . ; .. • . • ., • ' , . .•. • g 41- ' • ' t• *. " 4 " .•• / • .; ,. ...." / ':. * • .. .0 4 • . . „ti4 ' •41 '".. 4 '•. ..+1,..• • . ... •. .1 , 2 4. ‘'',, i . • 4 . , ,.,. 2 , f 1 ‘• , fe: . • • .. • ... $ , .} . c• , -_ . -,. , .•i ..;,.. re\ ' .1....... - ........,..,,.. „ : , • .. ,, ., . ' ••• ',. ;/ , r .. • le ' I . . I . •. .1 ' st. . .'h . ' *- , . .i . 4 s'lliolr•''' ' .•', e,‘ (... , , .., , ,,... ' 1 ' ....•-1* -.1.0PSe' .• , ; .-:,54.., • . ;-.2,._ . • k *4k , • ' , t. . 1 •i - ,, • .... ...„„ • ...- , , .... • **. 41.;,A . • -... - -... e •__, 100„,w, , . , .• - • A:c...4 iiret*"'- •',. tii4 2 l', er mere'.‘ .,. A .44 , 4.,..}.,.•A..,, . . ...4114.1111,_ ____.; • •,:". _,...."' • • l!'''- •., • ri, .4.4kg.-ik ...,t . tir sil .alici.1 --,t . °.01r. #•,b,i0Vd, ;0,1, . .,,.;. 47 ,...:4- ,4 lw. .0,:..,,, .,,,,; '. ; ,.. t. - ....., 't. '.4,' ..'• '`•.:-..', m, • .., • -, -,,„. ,„!, ; ; co. •- .. 4,e• ., :,t4404. -te 1 : -,A7t,,,.4011%--;;Akto-lk,;."--4, ,,--•‘.\‘ ! '.t.i.‘,1 ,,,,,,,,,.,, _ - . ••• ..... .=, ,.- 0,•,..• •••,- .„,.. , .--,..--, • ••,. •••• ,r,,,t__::;_,,. - - ,..„...-. - .-.. : ..-- -.4, , .5„ - ,I. - ,n. '•. --,4': "lb---41•11"7:--V„.04. ' ,- -- ,•-•stiiir it, t. 4- , • '---1-----: --- . -.1.„..:: ' - .- * -t.,% • ‘, ._. ,,, .....-7a. ......:........... ...„1/4 • ..• . •••• ii,„.,,.... .., 1...' f• ' f -* c 22 - .V.-.2.. _ .- sit4A:ts, . . ilo. . , . ' ..' . ,7`. ..4.44". ..`.1 • ' .ri '.7 : _ i' ; • 4.. . ' 41. • ''''' # '' .• . .\ ... % ' J:ht ''..• '4. L I • ' 1i A•, 44 ,..... .Pr,- . 1 . p SEA\E\1598671WETLANDS DELINEATION REPORTkRENTON_WETLAND_APPENDIX C_FINAL.DOC • • WETLAND DELINEATION AND CLASSIFICATION REPORT FOR THE NE 10TH STREET!ANACORTES AVENUE NE STORMWATER SYSTEM IMPROVEMENT PROJECT PHOTO 6 Ariel view of property '.. .-11-•., . ,„iir: ,.. , .........„... . . v,... .4: , „at,. . ..W. , ripe,• t - . ff . P • • N4... - :'7,1 . 'iiiF 1. S „ ' , was I` an .1 : ... 'et rS x+ i .$,-, �.rl !. .' , L. 6) PT * b. . ti•. " .. 1 oct • i d , • �, �` *rArk'` ;• IIItiiir 2 ''r t �: r�S♦�� •N4 i c z `ti t ': i '1 # ;+ -'."t+' ' ,l p..•..z..i•p., • ). 4i ,', " :;. ,; :-i• ; ... ,.. ,- • 4 • •., ,i , ' it* .1+'�!�y. ti • r - +r" w - ,.TPA • ,,.. • '• . :�.. . SitetiR+ e0 .,, it « a taw. SEAIE:It598677WETLANDS DELINEATION REPORT\RENTON_WETLAND_APPENDIX C_FINAL-DOC C-5