HomeMy WebLinkAboutRES 4467CITYOFRENTON,WASHINGTONRESOLUTIONNO.4467ARESOLUTIONOFTHECITYOFRENTON,WASHINGTON,AMENDINGTHE2021/2022CITYOFRENTONFEESCHEDULE.WHEREAS,onNovember23,2009,theCounciladoptedOrdinanceNo.5509,whichremovedmanyfeesfromtheRentonMunicipalCodeandconsolidatedthemintothe2010CityofRentonFeeSchedulebrochure,whichhasbeensubsequentlyamended;andWHEREAS,onNovember9,2020,theCityCouncilpassedResolutionNo.4422,adoptinganamendedfeeschedulefor2021and2022;andWHEREAS,thefeeschedulefor2021and2022wassubsequentlyamendedbyResolutionNo.4433,ResolutionNo.4441,andResolutionNo.4453;andWHEREAS,itisnecessarytoapproveanamendedfeescheduletomakeperiodicupdatesaspartoftheCity’s2022CarryForwardand1tQuarterbudgetamendment;andWHEREAS,itisfurthernecessarytoapproveanamendedfeescheduleupdatingandremovingvariousfeesinSectionIV.AquaticFeesofthefeeschedule;andWHEREAS,itisfurthernecessarytoapproveanamendedfeescheduleupdatingbuildingfeesinSectionXII.DevelopmentFeesofthefeeschedule;andWHEREAS,itisfurthernecessarytoapproveanamendedfeeschedulesettingforthabuildingpermitsiteplan/zoningreviewandinspectionfee,andacivilconstructionpermitsiteplan/zoningreviewandinspectionfeeunderLandUseReviewFeesinSectionXII.DevelopmentFeesofthefeeschedule;and1
RESOLUTIONNO.4467WHEREAS,itisfurthernecessarytoapproveanamendedfeeschedulesettingforthwetweatherannualfeesandbuildingpermitengineeringreviewfeesunderPublicWorksFeesinSectionXII.DevelopmentFeesofthefeeschedule;NOW,THEREFORE,THECITYCOUNCILOFTHECITYOFRENTON,WASHINGTON,DORESOLVEASFOLLOWS:SECTIONI.Thefeescheduleisamendedandreplacedwiththe2021-2022CityofRentonFeeSchedulebrochure,whichisattachedheretoandadoptedbythisreference(“FeeSchedule”).AnupdatedcopyoftheFeeScheduleshallatalltimesbefiledwiththeCityClerkasrequiredbyOrdinanceNo.5509.SECTIONII.TheamendedFeeScheduleadoptedbySectionIofthisresolutionshallbeeffectiveuponpassageandapprovalofthisresolution,andthereafteractastheCityofRenton’sFeeScheduleforallfeesorchargesreferencedtherein.TheFeeScheduleshallremainineffectuntilamendedorotherwisereplacedbytheCityCouncil.IntheeventtheFeeScheduleisnotamendedpriortotheyear2023,thefeesspecifiedfortheyear2022shallcontinuetoapplyintoandbeyond2023untilamendedbytheCityCouncil.PASSEDBYTHECITYCOUNCILthis25thdayofApril,2022.iaso7A.Seth/ItYClerk2
RESOLUTIONNO.4467APPROVEDBYTHEMAYORthis25thdayofApril,2022.MayorApprovedastoform:ShaneMoloney,CityAttorneyRES-FINANCE:1906:3/31/223
City of Renton Fee Schedule
2021‐2022
Rev. May 2022
City of Renton Fee Schedule
2021‐2022
Table of Contents Page
SECTION I. MISCELLANEOUS FEES 1
SECTION II. MAPLEWOOD GOLF COURSE 2
SECTION III. City CENTER PARKING FEES 3
SECTION IV. AQUATIC FEES 3
SECTION V. CARCO THEATER (REPEALED) 3
SECTION VI. PARKS AND FACILITIES USE AND RENTAL 3
SECTION VII. COMMUNITY CENTER PASS CARD & FEES 4
SECTION VIII. AIRPORT CHARGES 5
SECTION IX. ANIMAL LICENSES FEES* ‐ RMC 5‐4‐25
SECTION X. BUSINESS LICENSES 5
SECTION XI. ADULT ENTERTAINMENT LICENSES 5
SECTION XII. DEVELOPMENT FEES 5
Building Fees:5
Land Use Review Fees:7
Public Works Fees: 8
Technology Surcharge Fee 12
Impact Fees: 12
Miscellaneous Fees: 13
SECTION XIII. FIRE DEPARMENT FIRE MARSHAL FEES (RFA) 13
City of Renton Fee Schedule
2021‐2022
SECTION I. MISCELLANEOUS FEES 2021 2022
1. Maps:
a. Zoning maps ‐ standard 11 x 17 $4 $4
b. Zoning maps ‐ large 24 x 36 $12 $12
c. Comprehensive Plan map ‐ standard 11 x 17 $4 $4
d. Comprehensive Plan map ‐ large 24 x 36 $12 $12
e. Precinct maps $5 $5
2. Plat:
a. First page $2 $2
b. Each additional page $1 $1
3. Photocopies:
a. Each 8.5" x 11" or 8.5" x 14"$0.15 $0.15
b. Each 11" x 17"$0.20 $0.20
c. Each 8.5" x 11" or 8.5" x 14" color $0.25 $0.25
4. Budget:
a. City's Budget $10 $10
b. N/C N/C
5. Audio or Video Recording Copies:
a.Audio recording, each copy $2 $2
b.Video recording, each copy $2 $2
6. Regulations and Plans:
a.Comprehensive Plan and Map $30 $30
b.Title IV, Development Regulations:
(i) Text and Zoning Map $110 $110
(ii) Text only $100 $100
c.Individual Chapters of Development Regulations $10 $10
d. Renton Municipal Code (two volumes)$400 $400
e.Code Supplements, per year:
(i) Titles I ‐ III and VI ‐ X $70 $70
(ii) Title IV $70 $70
7. Miscellaneous Services:
a.Certification and Notary Fees ‐ Clerk's Certification $10 $10
b.Notary Public Attestation or Acknowledgement or as $10 $10
otherwise provided for in RCW 42.28.090, per signature
c.Hold Harmless Agreements and other similar documents $20 $20
not otherwise provided for
d.Lamination of licenses, pictures $6 $6
e.Community Development Block Grants (CDBG) Loan Program:
(i) Application Fee $200 $200
(ii) Loan Origination Fee $150 or 0.25% of loan amount,
whichever is greater
$150 or 0.25% of loan amount,
whichever is greater
(iii) Closing Costs (including any legal fees)50% of total actual costs 50% of total actual costs
8. Miscellaneous Charges for Police Services:
a.Police Reports per page $0.15 $0.15
b.Record Checks (Written Response) $5 $5
c.Photographs ‐ Digital on CD $2 $2
d.Photographs ‐ black & white or color ‐ Cost of developing film Cost Cost
e.Fingerprint Cards $5 $5
(i) Each additional card $1 $1
9. Charges for Fire Documents:
a.Fire reports per page $0.15 $0.15
b.Fire investigative report on CD $2 $2
c.First copy ‐ black & white or color ‐ Cost of developing film Cost Cost
d.Additional copy ‐ black & white or color ‐ Cost of developing film Cost Cost
10. Computer Listings:
a.City of Renton new business list $10 $10
b.List of all business licenses $20 $20
c.Copies requested to be faxed, local number $3 $3
d.Copies requested to be faxed, long distance number
(i) One (1) ‐ five (5) pages $10 $10
(ii) Six (6) or more pages (ten (10) page limit)$20 $20
11. Utility Fee:
a.Special Request Water Meter Reading $30 $30
b.Utility New Account Setup $25 $25
c.Utility Billing Account Transfer (tenant billing form)$5 $5
d.Water utility outstanding balance search requested by $25 $25
fax, messenger, or letter
12. Schedule of Fines for False Alarms ‐ Security/Burglar: (effective February 1, 2019)
a.One‐time Registration Fee $25 $25
b.Annual Registration Renewal N/C N/C
c.First False Alarm in a registration year*N/C N/C
d.Second False Alarm in a registration year*$100 $100
e.Third or more False Alarm in a registration year*$250 $250
f.Late Payment Fee $25 $25
g.Unregistered Alarm System Fee $50 $50
*A registration year shall mean January 1 thru December 31 each year.
13. NSF Check Fees $25 $25
14. Veteran Park Tile: Three lines $75 $75
15. Electronic Records:
a.Photocopies or printed copies of electronic records, per page $0.15 $0.15
b.Scanning paper records, per page $0.10 $0.10
c.Electronic files or attachments uploaded for electronic delivery (email, cloud‐based data storage service, o $0.05 $0.05
other means of electronic delivery), for each four (4) files
City's Budget to other municipality or quasi‐municipal corporation or other nonprofit charitable or education organization
City of Renton Fee Schedule
2021‐2022
SECTION I. MISCELLANEOUS FEES (CONTINUED)2021 2022
15. Electronic Records (continued):
d.Transmission of records in an electronic format or for the use of agency equipment to send the records $0.10 $0.10
electronically, per gigabyte (GB)
16. Document Recording Fees:
a.Actual Costs Actual Costs
b.Miscellaneous charges associated with document recording, such as courier fees Actual Costs Actual Costs
17. Publication Fees:
Actual Costs Actual Costs
SECTION II. MAPLEWOOD GOLF COURSE 2021 2022
1.
a.Weekday:
(i) 18 Hole $39 $41
(ii) 9 Hole $29 $30
(iii) 18 Hole, Senior $30 $31
(iv) 9 Hole, Senior $22 $23
(v) 18 Hole, Junior $21 $25
(vi) 9 Hole, Junior $17 $19
b.Weekend:
(i) 18 Hole $46 $48
(ii) 9 Hole $29 $30
2. Club Rental*:
a.Regular $25 $30
b.Premium $50 $60
3. Golf Cart Fees*:
a.18 Hole $34 $36
b.18 Hole Single Rider $26 $28
c.9 Hole $22 $24
d.9 Hole Single Rider $16 $18
e.Trail Fee $15 $15
f.Half Cart, 18 Hole $18
g.Half Cart, 9 Hole $12
4. Driving Range Fees*:
a.Large Bucket $11 $12
b.Small Bucket $6 $9
c.Warm‐up Bucket $4 $6
5. Lesson Fees:
a.1/2 Hour Private $45 $55
b.1 Hour Private $65 $80
c.1/2 Hour Series Private $160 $200
d.1 Hour Series Private $240 $300
e.Group Series $100 $140
f.1/2 Hour Private, Junior $25 $35
g.Playing Lesson(3‐hole minimum/9‐hole maximum) per hole $15 $25
* Rates include Washington State Sales Tax (WSST)
SECTION III. City CENTER PARKING FEES 2021 2022
1. City Center Parking Garage Fees:
Parking rates for retail parking will be as follows:
a.Zero (0) ‐ two (2) hours N/C N/C
b.Two (2) ‐ four (4) hours $2 $2
c.Four (4) ‐ six (6) hours $4 $4
d.Six (6) ‐ (10) hours $6 $6
e. 10 hours or more $10 $10
f.Monthly pass‐holders, tax included $35 $35
SECTION IV. AQUATIC FEES 2021 2022
1. Admission for the Aquatic Center shall be as follows:
a.Regular Session:
(i) Infants ‐ under 1 year N/C N/C
(ii) Youth ‐ 1 to 4 years $6 6 $8
(iii) Ages 5 and up $11 11 $16
(iv) Lap swim ‐ water walking only $5 5 $7
b.Season Pass:
(i)Resident infants ‐ under 1 year N/C N/C
(ii)Non‐resident infants ‐ under 1 year N/C N/C
Note: Should Section I fees due total less than $4.00 and no other fee is due to the City at the same time, the department
administrator may authorize to waive the entire amount due at their discretion.
Green Fees*:
For purposes of this section, "weekend" shall mean Friday, Saturday, and Sunday. "Weekday" shall mean the remaining four days
of the week. "Junior" shall mean ages 17 and under, "Senior" shall mean ages 62 and over.
Off‐season and promotional rates determined by management; posted on website.
*The charges identified in RCW 42.56.120(3)(b) (and referenced above) may be combined to the extent that more than one type of
charge applies to copies produced in response to a particular request. The actual cost of any digital storage media or device provided
by the agency. Alternatively, the City may charge a flat fee of up to $2 for the entire request as long as the cost of uploading and
transmitting the electronic records is reasonably estimated to equal or exceed that amount. Only one $2 flat fee per request is
authorized for electronic records produced in installments. When records are provided electronically on a CD, DVD, thumb drive,
flash drive, or other electronic device, the requestor will be charged for the cost of the electronic storage device. The City may charge
an actual‐cost service charge for requests that require use of IT expertise to prepare data comilations or provide customized
electronic access services when not used by the City for other purposes. A cost estimate and explanation will be provided to the
requestor before incurring the costs.
Option to waive charges. The City may waive charges associated with fulfilling a request. The decision will be based on various
factors, including the volume and format of the responsive documents. The decision to assess fees for fulfilling a public records
request shall be made on a consistent and equitable basis, dependent primarily upon the amount of staff time required for copying,
scanning, shipping, uploading, and/or transmitting the records associated with fulfilling a request.
Certified copies. If the requestor is seeking a certified copy of a City record, an additional charge of $1.00 per each complete
document may be applied to cover the additional expense and time required for certification
The applicant shall pay all document recording fees charged by King county and all administrative fees charged by the title company for
processing. Payment in full shall by submitted to the City before documents are sent for recording
The applicant shall pay all Publication fees charged by publication outlet used by the City (The Seattle Times or equivalent). Payment
in full shall be made to the City prior to public hearing, permit approval or issuance, whichever comes first.
City of Renton Fee Schedule
2021‐2022
SECTION IV. AQUATIC FEES (CONTINUED)2021 2022
(iii)Resident ages 1 and up $60 $60
(iv)Non‐resident ages 1 and up $120 $120
c.Miscellaneous Rates:
(i)Resident regular session per person rate (group rates)*$12 $12
(ii)Non‐resident regular session per person rate $16 $16
(v) Locker Rental $0.25 $0.25
d. b.Canopy Rental Fees*: (includes canopy and admission for one leisure swim session)
(i) Henry Moses Party Tent #1
(10' x 20' for up to twenty‐five (25) guests on wave pool):
(1) Resident Rate, per session $450 450 $600
(2) Non‐resident Rate, per session $550 550 $700
(ii) Henry Moses Party Tent #2
(10' x 20' for up to twenty‐five (25) guests):
(1) Resident Rate $400 400 $500
(2) Non‐Resident Rate $500 500 $600
(iii) Henry Moses Party Tent #3
(10' x 10' for up to ten (10) guests):
(1) Resident Rate, per session $200 200 $250
(2) Non‐resident Rate, per session $240 240 $300
e. c.Resident Rate all inclusive*$1,800 1800 $3,800
f. d.Non‐resident Rate all inclusive*$2,300 2300 $4,800
*Sales tax not included in the rental fee
g. e.Swim Lesson Program: Fees and associated descriptions are published in the "What's Happening " Renton Activities Guide
h.End‐of‐year School Party Rentals:
(i)Renton School District
(1)001 ‐ 299 students $1,900 $1,900
(2)300 ‐ 399 students $2,250 $2,250
(3)400 ‐ 499 students $2,400 $2,400
(4)500 ‐ 599 students $2,550 $2,550
(ii)Other Schools and Districts
(1)001 ‐ 299 students $2,450 $2,450
(2)300 ‐ 399 students $2,850 $2,850
(3)400 ‐ 499 students $3,150 $3,150
(4)500 ‐ 599 students $3,360 $3,360
2. Boat Launch Rates:
a.Daily resident ‐ 7 days a week $10 10 $15
b.Daily Non‐resident ‐ 7 days a week $20 20 $25
c.Overnight resident ‐ 7 days a week $20 20 $25
d.Overnight Non‐resident ‐ 7 days a week $40 40 $45
e.Annual parking boat launch permit ‐ resident $60 60 $70
f.Annual parking boat launch permit ‐ non‐resident $120 120 $130
g.$50 $50
(i) $50 $75
(ii) $50 $90
SECTION V. CARCO THEATER (REPEALED)2021 2022
SECTION VI. PARKS AND FACILITIES USE AND RENTAL 2021 2022
1. Outlying Picnic Shelters (Cedar River Trail, Liberty Park, Phillip Arnold Park, Teasdale Park and Heritage Park) Maximum of 50 people:
a.Resident 10am‐7pm $140 140 $150
b.Non‐resident 10am‐7pm $280 280 $290
2. Gene Coulon Beach Park Shelters (South #1, South #2 and Creekside) Maximum of 75 people:
a.Resident 10am‐7pm $140 140 $150
b.Non‐resident 10am‐7pm $280 280 $290
e.South Shelters 1 & 2 Resident rate $300 300 $310
f.South Shelters 1 & 2 Non‐resident rate $600 600 $610
3. Gene Coulon Beach Park Shelters (North Shelter):
a.Resident 10am‐7pm $160 160 $200
b.Non‐resident 10am‐7pm $320 320 $360
4. Tennis, Basketball and Sand Volleyball court rate per hour (Tournament Play Only):
a.Tennis court $10 $10
(i) $10 $25
(ii) $10 $30
b.Park basketball court $10 $10
(i) $10 $25
(ii) $10 $30
c.Sand volleyball court $10 $10
(i) $10 $25
(ii) $10 $30
5.Catering and Event Rate (All city parks apply):
a.Resident half day $200 $200
b.Resident full day $350 $350
c.Non‐resident half day $400 $400
d.Non‐resident full day $700 $700
6.
a.Each $50 $50
7. 5.
a.Resident rate per hour $10 10 $25
b.Non‐resident rate per hour $25 25 $30
c.Special Event Permit Fee $85 $85
8. 6.Piazza Park Open Space Event Rental
a.Full day rental 10am ‐ 7pm $500 $500
Inflatable and big toy rate:
Note: Along with rental fee for the use of City facility for each inflatable or big toy, Applicant or Renter shall provide proof of insurance
naming the City of Renton as additional insured.
Open Space Area in the Parks (Cascade, Teasdale, Phillip Arnold, Cedar River, Earlington, Gene Coulon, Glencoe, Kennydale Lions,
Sunset, and Riverview Parks):
*Group Rates: Group rates offer guaranteed admission for the group. In order to qualify for a group rate, the group must consist of ten
(10) or more persons, and the session must be scheduled in advance. Please note that the number of groups may be limited each day.
Staff has the authority to offer discounted daily rates for partial sessions or Renton‐only events.
Fishing Tournaments at Coulon Beach (additional rental fee if using the Pavilion area for weigh in and or electricity at the current renta
rate) per event
Non‐resident rate
Resident rate
Non‐resident rate
Resident rate
Non‐resident rate
Resident rate
Non‐resident rate
Resident rate
City of Renton Fee Schedule
2021‐2022
SECTION VI. PARKS AND FACILITIES USE AND RENTAL (CONTINUED)2021 2022
9. 7.Photo Shoots per hour:
a.Commercial Film and Photo Shoots per hour $300 $300
10. 8Electrical Spider Box rental:
a. Electrical spider box rental per box, per event, with special event approval $100 $100
11. 9Athletic Field Rental, Lights and Prep Fees:
a.Sports field rental per hour ‐ resident $25 25 $30
b.Sports field rental per hour ‐ non‐resident $30 30 $36
c.Renton Area Youth Sports Agencies, per hour $6 6 $8
d.Field prep for softball/baseball ‐ resident per occurrence $30 30 $35
e.Field prep for soccer ‐ resident per occurrence $45 45 $50
f.Custom Field prep ‐ resident per occurrence $100 $100
g.Field prep for softball/baseball ‐ non‐resident per occurrence $35 35 $40
h.Field prep for soccer ‐ non‐resident per occurrence $50 50 $55
i.Custom Field prep ‐ non‐resident per occurrence $100 $100
j.Field lights all sports ‐ resident per hour $25 25 $30
k.Field lights all sports ‐ non‐resident per hour $30 30 $36
12. 1Banquet & Classroom Rental ‐ Community Center & Senior Activity Center:
a.Friday evening 5 hour minimum ‐ resident $650 650 $750
b.Weekend Rates 10 hour minimum ‐ resident $1,300 1300 $1,500
c.Extra hours ‐ per hour ‐ resident $130 130 $150
d.Friday 5 hour minimum ‐ non‐resident $750 750 $900
e.Weekend Rates 10 hour minimum ‐ non‐resident $1,500 1500 $1,800
f.Extra hours ‐ per hour ‐ non‐resident $150 150 $180
g.Kitchen charge ‐ per hour $100 $100
h.Banquet Room ‐ Mon ‐ Fri ‐ daytime ‐ resident/hr 3 hour min $85 85 $100
i.Banquet Room ‐ Mon ‐ Fri ‐ daytime ‐ non‐resident/hr 3 hour min $90 90 $120
j.Damage deposit $550 $550
k.Contract violation fee ‐ per hour ‐ resident $200 200 $300
l.Contract violation fee ‐ per hour ‐ non‐resident $200 $360
l. m.Cancellation Fee ‐ Less than 90 days $550 $550
13. 1Classroom and Gymnasium Rental ‐ Renton Community Center:
a.Resident single gym athletic ‐ per hour $45 45 $50
b.Non‐resident single gym athletic ‐ per hour $50 50 $60
c.Resident double gym athletic ‐ per hour $90 90 $100
d.Non‐resident double gym athletic ‐ per hour $100 100 $120
e.Resident single gym non‐athletic $550 550 $1,000
f.Non‐resident single gym non‐athletic $675 675 $1,200
g.Resident double gym non‐athletic $1,100 1100 $2,000
h.Non‐resident double gym non‐athletic $1,350 1350 $2,400
i.Carpet fee single gym ‐ resident & non‐resident $325 $325
j.Carpet fee double gym ‐ resident & non‐resident $650 $650
k.Classroom resident $35 35 $40
l.Classroom Non‐resident $40 40 $48
14.Birthday Party Packages:
a.Party package ‐ resident $65 $65
b.Party package ‐ non‐resident $75 $75
15. 1Facility Rental ‐ Neighborhood Center:
a.Meeting room ‐ resident $35 35 $40
b.Gymnasium ‐ resident $35 35 $40
c.Meeting room ‐ non‐resident $40 40 $48
d.Gymnasium ‐ non‐resident $40 40 $48
16. 1Farmer's Market
a.10x10 Lot $40 $40
b.Half Lot $20 $20
c.Application fee $30 $30
d.Electrical fee $5 $5
17.Reader Board
a.One day/day of event $110 $110
b.Two weeks prior to event $275 $275
SECTION VII. COMMUNITY CENTER PASS CARD & FEES 2021 2022
Fees and associated descriptions are published and available in the "Let's Go Renton" Recreation Guide.
SECTION VIII. AIRPORT CHARGES 2021 2022
1.Airport Fuel Flow Charge: per gallon $0.08 $0.08
2.JetA Fuel Flow Charge: per gallon $0.10 $0.10
3.Transient airplane parking daily $8 $8
4.Hangar wait list, one time fee $100 $100
5.Tie‐down wait list, one time fee $25 $25
6.Lost gate card fee per occurrence $50 $50
7.T‐Hangar, Non‐Refundable Move‐in Fee $250 $250
8.Penalty for violation of Minimum Standards/Airport Rules & Regulations (each occurrence $500 $500
9.Penalty for Movement Area Incursions (each occurrence), assessed to sponsor/tenant $500 $500
SECTION IX. ANIMAL LICENSES FEES* ‐ RMC 5‐4‐2 2021 2022
1.Altered Animal Annual License $30 $30
2.Unaltered Animal Annual License $50 $50
3.Economically Qualified Resident Special Lifetime License $0 $0
4.Duplicate Tag $10 $10
5.Late Charge $30 $30
SECTION X. BUSINESS LICENSES 2021 2022
1. General Business License:
a.Registration Fee $150 $150
b.Appeal of Business License Decision $250 $250
2. Penalties:
a.The penalty to reinstate an expired business license $50 $50
b.The penalty for failure to obtain a business license $250 $250
c.
5%‐15%5%‐15%
*Please note, impounded animals are subject to license fees, microchipping costs, and other out‐of‐pocket costs as specified in RMC 6‐
6‐2.
Failure to pay the license fee within one day after the day on which it is due and payable pursuant to subsection C7 of Chapter 5 of
the RMC shall render the business enterprise subject to a penalty of (5%) of the amount of the license fee for the first month of the
City of Renton Fee Schedule
2021‐2022
SECTION XI. ADULT ENTERTAINMENT LICENSES 2021 2022
1. Every person applying for a adult entertainment license shall pay the applicable nonrefundable application fee:
a.Adult Entertainment Business License $750 $750
b.Entertainer $75 $75
c.Manager $75 $75
d.License Replacement $10 $10
2. Penalties:
a.Civil Penalty, per violation $1,000 $1,000
SECTION XII. DEVELOPMENT FEES 2021 2022
1. Building Fees:
a.Building and Demolition Permit Fees:1
(i) Base Fee/Valuation $1.00 to $500.00 $34 $34 $37
(ii) Valuation $501.00 to $2,000.00 $34 + $3.83 x each $100 value $34 + $3.83 $37 + $4.21 x each
$100 value
(iii) Valuation $2001.00 to 25,000.00 $88.75 + $17.59 x each $1,000
value
$88.75 + $17.59 $97.63 +
$19.35 x each $1,000 value
(iv) Valuation $25,001.00 to $50,000.00 $493.26 + $12.60 x each
$1,000 value
$493.26 + $12.60 $542.59 +
$13.86 x each $1,000 value
(v) Valuation $50,001.00 to $100,000.00 $808.26 + $8.77 x each $1,000
value
$808.26 + $8.77 $889.09 +
$9.65 x each $1,000 value
(vi) Valuation $100,001.00 to $500,000.00 $1,225.76 + $7.04 x each
$1,000 value
$1,225.76 + $7.04 $1,348.34 +
$7.74 x each $1,000 value
(vii) Valuation $500,001.00 to $1,000,000.00 $4,039.76 + $5.93 x each
$1,000 value
$4,039.76 + $5.93 $4,443.74 +
$6.52 x each $1,000 value
(viii) Valuation $1,000,001.00 and up $7,006.01 + $4.57 x each
$1,000 value
$7,006.01 + $4.57 $7,706.61 +
$5.03 x each $1,000 value
b.Combination Building Permit Fees*1
(i) Plumbing up to 3,000 sq ft $256 256 $282
(ii) Plumbing over 3,000 sq ft $282 282 $310
(iii) Mechanical up to 3,000 sq ft $205 205 $226
(iv) Mechanical over 3,000 sq ft $231 231 254
(v) Electrical up to 3,000 sq ft $231 231 $254
(vi) Electrical over 3,000 sq ft $282 282 $310
* Combination Building Permit fees are required for each new single family residential structure
c.Building Plan Check Fee1
(i) Initial Building Plan Check Fee*65% of permit fee 65% of permit fee
(ii) Additional Building Plan Check Fee 50% of initial plan Check Fee 50% of initial plan Check Fee
d.State Building Code Fee:
(i) Non‐residential projects:$25 $25
(ii) Residential projects:$6.50 $6.50
(1) Each additional unit after first unit:$2 $2
e Electrical Permit Fees:
(i) Residential Fees ‐ Single ‐Family and Duplex
(1) New Service ‐ Single Family and Duplex1
(a) Up to 200 AMP $217 217 $239
(b) Over 200 AMP $231 231 $254
(2) Service Changes/New Circuits ‐ Single Family and Duplex:
(a) Change up to 200 AMP $169 169 $186
(b) Change over 200 AMP $179 179 $197
(c) Any new circuits added to above price is per each up to a maximum of $80.00 $88 $21 21 $23
(d) Minimum fee for remodel/addition of new circuits without a service charge $169 169 $186
(e) Cooling system circuit for new or replaced appliance $75 75 $83
(ii) Multi‐Family, Commercial and Industrial Fees:
(1) Value of work:
$1.00 to $500.00 $66 66 $73
$500.01 to $1,000.00 $49 + 3.5% of
value
$49 $53.90 + 3.5% of
value
$1,000.01 to 5,000.00 $86.10 + 3.05% of value $86.10 $94.71 + 3.05% of value
$5,000.01 to $50,000.00 $245.70 + 1.8% of value $245.70 $270.27 + 1.8% of
value
$50,000.01 to $250,000.00 $1,183.35 + 1.05% of value $1,183.35 $1,301.69 + 1.05%
of value
$250,000.01 to $1,000,000.00 $3,939.60 + 0.85% of value $3,939.60 $4,333.56 + 0.85%
of value
$1,000,000.01 and up $12,759.60 + 0.47% of value $12,759.60 $14,035.56 +
0.47% of value
(iii) Temporary Electrical Services $169 169 $186
(iv) Miscellaneous Electrical Fees
(1) Job Trailers $169 169 $186
(2) Signs per each $169 169 $186
(3) Mobile Homes $169 169 $186
(4)50% of commercial fees
Minimum $169
50% of commercial fees
Minimum $169 $186
5%‐15%
* Building Plan Check Fee is in addition to the building permit fees, demolition permit fees, and combination building permit fees.
The plan check fee is equal to 65% of the building permit fee, or the demolition permit fee, or the combination building permit
fee. Includes three (3) review cycles.
Low Voltage Work (e.g., alarm systems; thermostats; computer, data, or phone lines; fiber optics, cable
television, etc.)
5%‐15%delinquency and an additional penalty of (5%) for each succeeding month of delinquency, but not exceeding a total penalty of (15%)
of the amount of such license fee.
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
1. Building Fees (continued):
f.House Moving* ‐ minimum per hour Inspection Fee:$154 $154 $169
g.Inspection Fee For Condominium Conversions $154 on 1st unit / $21 each
add'l unit
$154 $169 on 1st unit /
$21 $23 each add'l unit
h.Manufactured/Mobile Home Installation Fees*:
(i) Within a manufactured home park $154 $154 $169
(ii) Outside of a manufactured home park Building Permit Fees Building Permit Fees
i.Mechanical Permit Fees:1
(i) Residential ‐ Mechanical Permit base fee plus itemized fees below:$53 53 $58
(1)$21 21 $23
(2) Boiler or Compressor $21 21 $23
(3)$21 21 $23
(4) Ventilation/exhaust fan $21 21 $23
(5) Fuel Gas Piping (each gas piping system up to 6 outlets)$21 21 $23
(ii) Commercial or Multi‐Family ‐ Mechanical Permit base fee plus itemized fees below $77 77 $85
(1)$36 36 $40
(2) Boiler or Compressor $77 77 $85
(3) Refrigeration System $77 77 $85
(4)$77 77 $85
(5) Incinerator: Installation or relocation of each $103 103 $113
(6)$36 36 $40
(7) Fuel Gas Piping (each gas piping system up to 6 outlets)$36 36 $40
j.Plumbing Permit Fees:1
(i) Residential ‐ Plumbing Permit base fee plus itemized fees below:$53 53 $58
(1)$10 10 $11
(2) Water Service: For meter to house $10 10 $11
(3) Per fixture for repair or alteration of drainage or vent piping $10 10 $11
(4) Per drain for rainwater systems $10 10 $11
(5) Per lawn sprinkler system, includes backflow prevention $10 10 $11
(6) Per vacuum breaker or backflow protection device on tanks, vats, etc.$10 10 $11
(7) Per interceptor for industrial waste pretreatment $10 10 $11
(8) Fuel Gas Piping: (each gas piping system up to 6 outlets)$21 21 $23
(ii) Commercial or Multi‐Family: Plumbing Permit base fee plus itemized fees below $77 77 $85
(1)Per plumbing fixture (e.g., sink, shower, toilet, dishwasher, tub, etc.) or set of fixtures on one trap $15 15 $17
(2) Water Service: For meter to building $15 15 $17
(3) Per fixture for repair or alteration of drainage or vent piping $15 15 $17
(4) Per drain for rainwater systems $15 15 $17
(5) Per lawn sprinkler system, includes backflow prevention $15 15 $17
(6) Per vacuum breaker or backflow protection device on tanks, vats, etc.$15 15 $17
(7) Per interceptor for industrial waste pretreatment $15 15 $17
(8) Fuel Gas Piping: (each gas piping system up to 6 outlets)$26 26 $29
(9) Medical Gas Piping: (each gas piping system up to 6 outlets)$77 77 $85
k.Sign Permit Fees:
(i) Permanent Signs:
(1) Roof, projecting, awning, canopy, marquee, and wall signs $256 256 $282
(2) Freestanding ground and pole signs $256 256 $282
(ii) Temporary and Portable Signs:
(1) Real Estate Directional Signs, pursuant to RMC 4‐4‐100J2, permit valid for a 12‐months period $77 77 $85
(2) Grand Opening Event Signs, pursuant to RMC 4‐4‐100J6d(i) $77 77 $85
(3) Event Signs, pursuant to RMC 4‐4‐100J6d(ii) and (iii) per sign, per promotion $51 51 $56
(4)$128 128 $141
(5) Commercial Property Real Estate Banner each sign permit is valid for 12 months $77 77 $85
(6) Decorative Flags fee is per entrance and valid until flag(s) are removed $77 77 $85
l.Miscellaneous Fees:
(i) Inspection Fees:
(1) Minimum Housing Inspection $128 128 $141
(2) WABO ‐ Adult Family Home; Misc building inspection $128 128 $141
(3) Reinspection Fee; Misc building inspection $128 128 $141
(ii) Plan Review Fees:
(1) Electrical, Plumbing, or Mechanical Permits (percentage of permit fee)40% 40%
(2) Additional Plan Review Fees: Over three review cycles (percentage of plan review fee)50% 50%
(3) Miscellaneous Plan Review: hourly fee.$128/hr $128/hr $141/hr
(iii)2 X Permit Fee 2 X Permit Fee
2. Land Use Review Fees:
a.General Land Use Review:
(i) Additional Animals Permit $50 $50
(ii) Address Change $105 $105
(iii) Annexation:
(1) Less than 10 acres $5,250 $5,250
(2) 10 acres or more $5,250 $5,250
(iv) Appeal of:
(1) Hearing Examiner's Decision $500 $500
Per plumbing fixture (e.g., sink, shower, toilet, dishwasher, tub, etc.) or set of fixtures on one trap
A‐Frame Signs, pursuant to RMC 4‐4‐100J5 Charge is for the first sign, all subsequent signs are $50.00
Work commencing before permit Issuance: Where work for which the permit is required is started prior to obtaining
the permit, a special investigation fee in an amount equal to twice the permit fee shall be charged. The special
investigation fee shall be paid in addition to the required permit fees.
1 Per Res. 4422, fees for an Accessory Dwelling Unit (ADU) will be waived as of the adoption date of Res. 4422, through December 31, 2022.
* Includes plan review and inspection fees for the foundation (electrical, plumbing, mechanical, sewer and water connection fees
are in addition to the below amounts).
Heating system (furnace, heat pump, suspended heater, fireplace, wood stove, etc.). A/C system (air
conditioner, chiller or Air Handling Unit (VAV) including ducts and vents)
Appliance or piece of equipment regulated by this code but not classed in other appliance categories, or for
which no other fee is listed in this code
Heating system (furnace, heat pump, suspended heater, fireplace, wood stove, etc.). A/C system (air
conditioner, chiller or Air Handling Unit (VAV) including ducts and vents)
Commercial Hood: Installation of each served by a mechanical exhaust, including the ducts for such hood each
Appliance or piece of equipment regulated by this code but not classed in other appliance categories, or for
which no other fee is listed in this code
Exemption: Residential telephone communication systems, thermostats, security systems, and cable television installations are
exempt from fees
*This covers only the Building Section inspection of the structure prior to move. There is a separate additional fee charged by the
Public Works Department to cover the actual house move permit. A building permit is also required in order to site the structure
on the new site.
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
2. Land Use Review Fees: (continued)
(2) Administrative Decision $500 $500
(3) Environmental Decision $500 $500
(v) Binding Site Plan (total fee for both preliminary and final phases)$5,280 $5,280
(vi) Building Permit ‐ Site Plan/Zoning Review and Inspection Fee 5% of Building Permit Fee
(vii) Civil Construction Permit ‐ Site Plan/Zoning Review and Inspection Fee4 0.5% of Construction Cost
(vi) (viii)Code Text Amendment N/C N/C
(vii) (ix)Comprehensive Plan Map or Text Amendment (each)$5,250 $5,250
(viii) (x)Conditional Use Permit:
(1) HEX $3,300 $3,300
(2) Administrative $1,600 $1,600
(3) Revision (minor, administrative) 50% of Application Fee 50% of Application Fee
(4) Revision (major)Application Fee Application Fee
(ix) (xi)Critical Areas Exemption N/C N/C
(x) (xii)Critical Areas Permit $1,250 $1,250
(xi) (xiii)100% of 100% of
contract cost contract cost
(xii) (xiv)Development Agreement $10,000 $10,000
(xiii) (xv)100% of cost 100% of cost
(xiv) (xvi)Environmental Checklist Review $1,600 $1,600
(xv) (xvii)Environmental (SEPA) Addendum $1,600 $1,600
(xvi) (xviii)Fence Permit (special)$160 $160
(xvii) (xix)Grading and Filling Permit (Hearing Examiner)$5,410 $5,410
(xviii) (xx)Landscape Review Fee $160 $160
(xix) (xxi)Legal Lot Segregation N/C N/C
(xx) (xxii)Lot Consolidation $510 $510
(xxi) (xxiii)Lot Line Adjustment $1,090 $1,090
(xxii) (xxiv)Manufactured/Mobile Home Park:
(1) Tentative $1,090 $1,090
(2) Preliminary $3,250 $3,250
(3) Final $1,600 $1,600
(xxiii) (xxv)Open Space Classification Request $155 $155
(xxiv) (xxvi)Plats:
(1) Preliminary Short Plat $5,410 $5,410
(2) Final Short Plat $2,705 $2,705
(3) Preliminary Plat $10,830 $10,830
(4) Final Plat $5,410 $5,410
(5) Minor Plat Amendment 50% of Application Fee 50% of Application Fee
(6) Major Plat Amendment Application Fee Application Fee
(xxv) (xxvii)Planned Urban Development:
(1) Preliminary Plan $5,410 $5,410
(2) Final Plan $2,700 $2,700
(xxvi) (xxviii)Reasonable Use Exception:
(a) In conjunction with land use permit $510 $510
(b) Stand alone $1,540 $1,540
(xxvii) (xxix)Public Arts Exemption N/C N/C
(xxviii) (xxx)Rezone $5,250 $5,250
(xxix) (xxxi)Routine Vegetation Management Permit without Critical Areas $105 $105
(xxx) (xxxii)Shoreline‐Related Permits:
(1) Shoreline Permit Exemption N/C N/C
(2) Substantial Development Permit $2,700 $2,700
(3) Conditional Use Permit $3,250 $3,250
(4) Variance $3,250 $3,250
(xxxi) (xxxiii)Site Development Plan (Site Plan or Master Plan
which includes design review fee for projects subject to RMC 4‐3‐100)
(1) Hearing Examiner Review $3,800 $3,800
(2) Administrative Review $2,700 $2,700
(3) Modification (minor, administrative)
50% of current site
plan review fee
50% of current site
plan review fee
(4)Application Application
Fees Fees
(xxxii) (xxxiv)Small Cell Permit, per site3 $510 $510
(xxxiii) (xxxv)Special Permit (Hearing Examiner) $2,700 $2,700
(xxxiv) (xxxvi)Street Naming (Honorary)
(1) Application $250 $250
(2) Installation $250 $250
(xxxv) (xxxvii)Temporary Use Permits:
(1) Tier 1 $105 $105
(2) Tier 2 $205 $205
(xxxvi) (xxxviii)Variance (per each variance requested) Administrative or Hearing Examiner $1,330 $1,330
(xxxvii) (xxxix)Waiver or Modification of Code Requirements cost is per request $260 $260
(xxxviii) (xxxx)Zoning Compliance Letter $480 $480
b.Miscellaneous Fees:
(i) Permit review staff overtime (applies only if permit review is requested by the applicant to be performed $175/hr 175/hr
on Saturdays, Sundays, observed City of Renton holidays, and non‐holiday Monday‐Fridays outside of the
hours of city staff regular work schedule)
c.
Modification (major) required new application and repayment of fee required
Exception for Projects Vested in the County: For those projects that have vested to a land use permit under the development
regulations of King County, the King County Land Use Review Fee Schedule shall apply, and is hereby adopted by reference. A copy of
that fee schedule has been filed with the City Clerk and is available at the City Clerk’s office for public review.
1Per RMC 4‐3‐050F7, the City may charge and collect fees from any applicant to cover costs incurred by the City in review of plans, studies, monitoring reports and other documents related to evaluation
of impacts to or hazards from critical areas and subsequent code‐required monitoring.
2When the City is the lead agency for a proposal requiring an Environmental Impact Statement (EIS) and the Environmental Review Committee (ERC) determines that the EIS shall be prepared, the City
may charge and collect a reasonable fee from any applicant to cover costs incurred by the City in preparing the EIS. The ERC shall advise the applicant(s) of the projected costs for the EIS prior to actual
preparation; the applicant shall post bond or otherwise ensure payment of such costs. The ERC may determine that the City will contract directly with a consultant for preparation of an EIS, or a portion of
the EIS, and may bill such costs and expenses directly to the applicant. Such consultants shall be selected by mutual agreement of the City and applicant after a call for proposals. If a proposal is modified
so that an EIS is no longer required,the ERC shall refund any fees collected under this subsection which remain after incurred costs are paid.The City may collect a reasonable fee from an applicant to
Critical Areas Review Fee: for those projects that propose impacts to critical areas and will be billed at the cost of
contract biologist’s review.1
Environmental Impact Statement Cost include the coordination, review and appeal. Draft and Final2
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
3. Public Works Fees:
a.Franchise Application Fee1 $5,000 $5,000
b.Franchise Permit Fees: 1,2
(i) (1) Small work, including trenching less than 60 linear feet or installation of 6 or less utility poles $600 $600
$600 $600
(3) Other public agencies constructing utilities within City right‐of‐way $600 $600
(ii)Small Cell Master Lease Agreement including Site License Addendum, Small Cell Only and Small Cell Permits
(1) Master Lease Agreement Administrative Costs, $100 per staff hour Actual cost Actual cost
(2) Pole Reservation, per pole $120 $120
(3) Administrative Fee, $100 per staff hour and/or cost of materials $760 deposit +$760 deposit +
time and materials time and materials
(i)
(a) Tier 1, Daily peak kWh <20 $715.38 $715.38
(b) Tier 2, Daily peak kWh 21 ‐ 40 $1,430.76 $1,430.76
(c) Tier 3, Daily peak kWh 41 ‐ 60 $2,146.14 $2,146.14
(d) Tier 4, Daily peak kWh 61 ‐ 80 $2,861.51 $2,861.51
(e) Tier 5, Daily peak kWh >81 $3,576.89 $3,576.89
(ii)Actual cost Actual cost
(5)$270.00 $270.00
(6) All other fees, $100 per staff hour and/or cost of materials3 Actual cost Actual cost
(iii)
(1)$10.00 $10.00
(2)$20.00 $20.00
(3)$30.00 $30.00
1Bond required pursuant to RMC 9‐10‐5
c.Latecomers' Agreement Application Fees:
(i) Processing fee1 (Nonrefundable)
(1) If amount covered by latecomers’ is $50,000 or less $1,000 $1,000
(2) If amount covered by latecomers' is between $50,000 and $200,000 $2,000 $2,000
(3) If amount covered by latecomers' is greater than $200,000 $4,000 $4,000
(ii) Latecomers' Agreement – Administration and collection fee
(1) if amount covered by latecomers' is $50,000 or less 15% of total 15% of total
(2) If amount covered by latecomers' is between $50,000 and $200,000 10% of total 10% of total
(3) If amount covered by latecomers' is greater than $200,000 5% of total 5% of total
(iii) Segregation processing fee, if applicable $750 $750
d.System Development Charge Tables:
(i) Water and Wastewater System Development Charges:
(1) 5/8 x 3/4 inch and 1 inch:
(a) Water service fee3 $4,450 $4,500
(b) Fire service fee 1,2 $594 $601
(c) Wastewater fee3 $3,450 $3,500
(2) 1‐1/2 inch:
(a) Water service fee3 $22,250 $22,500
(b) Fire service fee 1,2 $2,971 $3,005
(c) Wastewater fee3 $17,250 $17,500
(3) 2 inch:
(a) Water service fee3 $35,600 $36,000
(b) Fire service fee 1,2 $4,754 $4,807
(c) Wastewater fee3 $27,600 $28,000
(4) 3 inch:
(a) Water service fee3 $71,200 $72,000
(b) Fire service fee 1,2 $9,508 $9,615
(c) Wastewater fee3 $55,200 $56,000
(5) 4 inch:
(a) Water service fee3 $111,250 $112,500
(b) Fire service fee 1,2 $14,856 $15,023
(c) Wastewater fee3 $86,250 $87,500
(6) 6 inch:
(a) Water service fee3 $222,500 $225,000
(b) Fire service fee 1,2 $29,712 $30,046
(c) Wastewater fee3 $172,500 $175,000
(7) 8 inch:
(a) Water service fee3 $356,000 $360,000
(b) Fire service fee 1,2 $47,539 $48,073
(c) Wastewater fee3 $276,000 $280,000
(ii) Storm Water System Development Charges:
(1) New single family residence (including mobile/manufactured homes)3 $2,000 $2,100
Conduit Lease Rates per Lineal Foot (annual fee):
Tier 1, conduit in existing planter strips
Tier 2, conduit outside of planter strips excluding signalized intersection crossings, bridges and train tracks
Tier 3, conduit within signalized intersection crossings, bridges and train tracks
2The City may decide to contract with a consultant to perform plan reviews and inspections and may bill such costs and expenses directly to the applicant.
1The administration and collection fee is deducted from each individual latecomer fee payment and the balance forwarded to the holder of the latecomer’s agreement pursuant to RMC 9‐5, Tender
of Fee.
3Standard after hour and overtime fees apply.
If a franchise agreement does not specify the fee amount, the generic fee, as identified in the following table, shall be collected:
(2) All other work, permit fee plus $60 $150 per hour of inspection applied during regular inspection hours, overtime
inspection rates apply thereafter
(4) Public Reimbursement (any costs incurred by the City on behalf of the permit applicant for installation or
operation of site equipment)
Electrical service (annual fee)
All other reimbursement
Site License Addendum Rent
so that an EIS is no longer required, the ERC shall refund any fees collected under this subsection which remain after incurred costs are paid. The City may collect a reasonable fee from an applicant to
cover the cost of meeting the public notice requirements of this Title relating to the applicant’s proposal. The City shall not collect a fee for performing its duties as a consulted agency. The City may
charge any person for copies of any document prepared under this Title, and for mailing the document, in a manner provided by chapter 42.17 RCW.
3Prior to issuance of a small cell permit, the applicant shall pay the actual administrative expenses incurred by the City that are directly related to the City's review of the application, including plan
inspection, and approval, as authorized by RCW 35.21.860(1)(b), as may be amended.
1The fixed application fee established herein is intended to cover the City’s internal administrative costs in processing and administering the franchise. In addition to the fixed application fee, the
City may require applicants to either directly pay or reimburse the City for external costs reasonably incurred to process the application and/or administer the franchise agreement. The City may
require applicants to deposit funds in advance to cover legal and/or other professional services fees as they are incurred.
4Construction costs as defined in the following Subsection g of Subsection 3, Public Works Fees; and Section XIII.
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
3 Public Works Fees: (continued)
(2)
(3)$0.800 $0.840
per sq foot per sq foot
e.Administrative Fees for SDC Segregation Request1 $750 + administrative costs $750 + administrative costs
f.
(i) Water Construction Permit Fees:
(1) Water meter tests for 3/4” to 2" meter1 $50 $50
(a) Water meter tests on meters 2" or larger $60 deposit + time and
materials
$60 deposit + time and
materials
(b) Open and close fire hydrants for fire flow tests conducted by others. Time and materials Time and materials
(c) Water service disconnection (cut at main)$275 $275
(d) Meter resets $95 $95
(e) Repair of damage to service $250 $250
(f) Water main connections $560 $560
(g) Water main cut and cap $1,025 $1,025
(h) Water quality/inspection/purity tests $80 $80
(i) Specialty water tests (lead, copper, etc) Cost of test + $70 processing
fee
Cost of test + $70 processing
fee
(j) Water turn ons/offs after hours $185 $185
(k) Installation of isolation valve. $2,000 deposit + time and
materials
$2,000 deposit + time and
materials
(l)$250 + $0.15 $250 + $0.15
per lineal per lineal
foot foot
(m) Miscellaneous water installation fees. Time and materials Time and materials
(n) Service size reductions $50 $50
(o) Installation fees for ring and cover castings $200 $200
(2) Water meter installation fees – City installed:2
(a) 3/4” meter installed by City within City limits. Installation of stub service and meter setter only.$2,875 $2,875
(i) 3/4" meter drop in only $400 $400
(b) 3/4” meter installed by City outside City limits. Installation of stub service and meter setter only.$2,935 $2,935
(i) 3/4" meter drop in only $400 $400
(c) 1” meter installed by the City. Installation of stub service and meter setter only.$2,875 $2,875
(i) 1" meter drop in only $460 $460
(d) 1‐1/2" meter installed by the City. Installation of stub service and meter setter only.$4,605 $4,605
(i) 1‐1/2” meter drop in only $750 $750
(e) 2” meter installed by the City. Installation of stub service and meter setter only.$4,735 $4,735
(i) 2" meter drop in only $950 $950
(3)$220 $220
(4) Hydrant Meter fees:1
(a) Hydrant meter permit fee $50 $50
(b) Deposits:
(i) 3/4” meter and backflow prevention assembly.$500 $500
(ii) 3” meter and backflow prevention assembly.$2,000 $2,000
(iii) Deposit processing charge, nonrefundable.$25 $25
(c) Meter rental (begins on day of pickup):
(i) 3/4” meter and backflow prevention assembly. Per month.$50 $50
(ii) 3” meter and backflow prevention assembly. Per month.$250 $250
(ii) Wastewater and Surface Water Construction Permit Fees:1
(1) Residential:
(a) Wastewater permit fee $375 $375
(b) Surface water permit fee $375 $375
(2) Commercial:
(a) Wastewater permit fee $375 $375
(b) Surface water permit fee $375 $375
(3) Industrial:
(a) Wastewater permit fee $375 $375
(b) Surface water permit fee $375 $375
(4) Repair of any of the above
(a) Wastewater permit fee $375 $375
(b) Surface water permit fee $375 $375
(5) Cut and cap/Demolition permit:
(a) Wastewater permit fee $375 $375
(b) Surface water permit fee $375 $375
(6)$375 $375
(7)$375 $375
plus King County plus King County
sewer rate sewer rate
on discharged on discharged
amount amount
(iii) Right‐of‐way Permit Fees:
Work in right‐of‐way – construction permit: Utility and street/sidewalk improvements, excluding utilities from other
public agencies which shall be considered under a franchise permit. A bond is required, as stipulated in RMC 9‐10‐5,
Street Excavation Bond.
New water line chlorination fee. Fee plus $0.15 per lineal foot for any footage after
the first two hundred fifty (250) lineal feet
Water meter processing fees – Applicant installed: For meters larger than 2”, the applicant must provide materials
and installs.1
Reinspection for Wastewater or Surface Water Permits
Ground water discharge (temporary connection to wastewater system for discharge of contaminated ground
water over 50,000 gallons) Rate plus billed for current Renton and King County sewer rate on discharged
amount (meter provided by property owner)
All other uses charge per square foot of new impervious surface, but not less than $2,000 (2021) or $2,100
(2022)
1 Based upon the size of the fire service (NOT detector bypass meter)
2 Unless a separate fire service is provided, the system development charge(s) shall be based upon the size of the meter installed and a separate fire service fee will not be charged.
3Per Res. 4422, utility system development charges (hookup fees) for an Accessory Dwelling Unit (ADU) will be reduced by 50% as of the adoption date of Res. 4422, through December 31, 2022.
1The applicant shall pay the City’s administrative costs for the preparation, processing and recording of the partial payment of the fee(s). If the same segregation is used for more than one utility’s
special assessment district, and/or latecomer’s charge, then only one administrative fee is collected.
Public Works Construction Permit Fees:
Addition to existing single family residence greater than 500 square feet (including mobile/manufactured
homes) Fee not to exceed $2,000 (2021) or $2,100 (2022)
$0.800 per sq foot $0.840 per sq foot
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
3. Public Works Fees: (continued)
(1) Single family residence $325 $325
(2) All other uses, excluding those listed $625 $625
(3) Wastewater or storm water service $375 $375
(4) King County ROW Permits/Inspections:
(a) Service Installation Only $1,025 $1,025
(b) Utility Extension per 100' of Length (Min 200' Length)$1,025 $1,025
(5)
(iv)$525 $525
(v)
(1) Standard locate $500 $500
(2) Large project locate $1,000 $1,000
g.
(i)
(1) $150,000.00 or less 6% of cost 6% of cost
(2) Over $150,000.00 but less than $300,000.00. $9,000 + 5% over $150,000 $9,000 + 5% over $150,000
(3) $300,000.00 and over. $16,500 + 4% over $300,000 $16,500 + 4% over $300,000
(ii)Standard or minor drainage adjustment review $550 $550
(iii)Wet weather (annual fee)$3,000
h. Grade and Fill License Fees: Fees shall be based on the highest tier triggered.
Grade and Fill Quantity
New or Replaced Hard
Surface
Tier
< 50 cy < 2,000 sf 0
50 cy ‐ 499 cy 2,000 sf ‐ 4,999 sf 1
500 cy ‐ 4,999 cy 5,000 sf ‐ < 1 ac 2
5,000 cy ‐ 49,999 cy 1 ac ‐ < 2.5 ac 3
50,000 cy ‐ 99,999 cy 2.5 ac ‐ < 5 ac 4
100,000 cy and larger 5 ac and larger 5
(i) Review/Intake Fee:
(1) Tier 0 (no permit required)N/A N/A
(2) Tier 1 $466 $466
(3) Tier 2 $621 $621
(4) Tier 3 $932 $932
(5) Tier 4 $1,242 $1,242
(6) Tier 5 $1,553 $1,553
(ii) Inspection/Issuance Fee:
(1) Tier 0 (no permit required)N/A N/A
(2) Tier 1 $444 $444
(3) Tier 2 $887 $887
(4) Tier 3 $1,183 $1,183
(5) Tier 4 $2,366 $2,366
(6) Tier 5 $3,550 $3,550
(iii) Solid Waste Fills:1.5 x plan 1.5 x plan
check fee check fee
(iv) Annual Licenses of Solid Waste Fills: 1.5 x plan 1.5 x plan
check fee check fee
i.
(i) Filing fee $250 $250
(ii) Processing fee $250 $250
j.
(i) Single family and two family uses3, fee assessed annually plus leasehold excise tax1 if applicable $10.00 + LET1 $10.00 + LET1
(ii)0.5% x Value2 + LET1 0.5% x Value2 + LET1
(iii)0.5% x Value2 + LET1 0.5% x Value2 + LET1
The plan check fee for solid waste fills shall be one and one‐half (1‐1/2) times the plan checking fees listed above.
The fee for a grading license authorizing additional work to that under a valid license shall be the difference between
the fee paid for the original license and the fee shown for the entire project.
The fee for annual licenses for solid waste fills shall be one and one‐half (1‐1/2) times the plan checking fees listed
above. The fee for a grading license authorizing additional work to that under a valid license shall be the difference
between the fee paid for the original license and the fee shown for the entire project. Any unused fee may be
carried forward to the next year. If any work is done before the license is issued, the grading license fee shall be
doubled.
Release of easement fees: The imposition, collection, payment and other specifics concerning this charge are detailed in chapter 9‐1
RMC, Easements.
Revocable Right‐of‐way Permit Fees:
All uses without public benefit fee is a per month charge assessed annually based on property value2 of land to be
utilized, plus leasehold excise tax1, if applicable.
Uses with public benefit fee is a per year of assessed value of land adjoining the property, plus leasehold excise tax1,
if applicable. In no case less than $10.00.
< 7,000 sf
7,000 sf ‐ < 3/4 acre
3/4 ac ‐ < 1 ac
1 ac ‐ < 2.5 ac
2.5 ac ‐ < 5 ac
5 ac and larger
Public works Civil construction permit plan review and inspection fees1,3: All developers, municipal or quasi‐municipal entities, or
utility corporations or companies, except those specifically exempted, shall pay fees under this Section. Exempted entities include
City‐franchised cable TV, cable modem, natural gas, telecommunications, and electrical power. The fee will be based upon
percentages of the estimated cost of improvements using the following formula.
Street and utility plan review and inspection fees; estimated construction cost2: The applicant must submit separate,
itemized cost estimates for each item of improvement subject to the approval by the Public Works Plan Review
Section.
1Includes three (3) review cycles. Additional reviews will be charged $1,500 each.
2Construction cost shall be based on the City's bond quantity worksheet and shall include all project related improvements outside of the building envelopes, including, but not limited to, all costs
required to construct the following: paved parking lots, private sidewalks or walkways; private and public storm water management facilities; temporary erosion and sedimentation control facilities;
water quality facilities; public and private streets; public and private sanitary sewers; public water main improvements; required off‐site street, bike and pedestrian improvements; street lighting
improvements; required landscaping and street tree improvements; and site grading and mobilization costs.
3If deemed necessary by the City in its sole discretion, the City will contract with one or more consultants to provide plan reviews and/or inspections with the related costs and expenses payable by
the applicant.
Cleared or Disturbed
Area
Exception: No permit fee shall be charged for individual homeowners for work in street rights‐of‐way for street
tree or parking strip irrigation systems or work associated with City of Renton capital improvement projects or
City funded projects. No permit fee shall be charged for moving pods or moving trucks in the right‐of‐way
provided that they are in the right‐of‐way for no more than three (3) days. No permit fee shall be charged for
use of the right‐of‐way in the CD zone, provided ground disturbing activity is not proposed.
Street light system fee, per new connection to power system
Utility Locate Refresh Fee (Fee is due each time excavator calls in for locate refresh during 45‐day locate ticket)
1Per Res. 4422, fees for an Accessory Dwelling Unit (ADU) will be waived as of the adoption date of Res. 4422, through December 31, 2022.
2Per Res. 4422, water meter installation fees for an Accessory Dwelling Unit (ADU) will be reduced by 50% as of the adoption date of Res. 4422, through December 31, 2022
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
3. Public Works Fees: (continued)
(iv) Insurance Required:
(v) Exception for Public Agencies:
2Right‐of‐way value shall be based on the assessed value of the land adjoining the property as established by the King County Assessor
3Except those single family and two family uses that utilize right of way along the waterfront. They shall be considered uses without public benefit.
k.
(i) Filing fee $500 $500
(ii)
Appraised Value of Vacated right‐of‐way:
(1) Less than $25,000 $750 $750
(2) $25,000 to $75,000 $1,250 $1,250
(3) Over $75,000 $2,000 $2,000
l.
(i)
(ii)
(iii)
m.Water or Sewer ‐ Redevelopment:
(i) Fee(s) based upon meter(s) proposed for final project minus fee(s) based upon meter existing on site
n.Building Permit ‐ Engineering Review 5% of Building Permit Fee
n. o.Miscellaneous Fees:
(i) Re‐inspection Fee $128 $128
(ii) Plan Revision following Permit Issuance:
(1)$250 $250
(2)$1,500 $1,500
(iii) Street Frontage Improvements Fee‐In‐Lieu:
(1) Street with existing storm drainage main line $113/LF $113/LF
(2) Street with existing conveyance ditch $128/LF $128/LF
(3) Exception: No fee‐in‐lieu shall be charged for accessory dwelling units
(iv)$125/hr $125/hr $175/hr
(v)$175/hr $175/hr
(vi)Actual cost Actual cost
4. Technology Surcharge Fee
5.0% 5.0%
5. Impact Fees:
a. School Impact Fees:
(i) Issaquah School District
(1) Single Family Fee $18,213 $20,291
(2) Multi Family, Duplex, & Accessory Dwelling Fee (ADU)$12,043 $8,353
(ii) Kent School District
(1) Single Family Fee $5,692.85 $5,818.09
(2) Multi Family, Duplex, & Accessory Dwelling Fee (ADU)$2,404.63 $2,457.53
(iii) Renton School District1
(1) Single Family Fee $7,681 $2,659
(2) Multi Family, Duplex, & Accessory Dwelling Fee (ADU)$4,989 $4,737
(iv) School Impact Fee Administration 5% x School Impact Fee 5% x School Impact Fee
b. Transportation Impact Fees:1
(i) Light Industrial, per sq foot $9.50 $9.50
(ii)Apartment, per dwelling & Accessory Dwelling Unit (ADU)$6,717.10 $6,717.10
(iii) Church, per sq foot $5.36 $5.36
(iv)Coffee/Donut Shop, no drive up, per sq foot $221.09 $221.09
(v)Coffee/Donut Shop, with drive up, per sq foot $232.24 $232.24
(vi) Condominium & Duplexes per dwelling $5,645.22 $5,645.22
(vii)Convenience market ‐ 24 hour, per sq foot $221.81 $221.81
(viii)Daycare, per sq foot $48.88 $48.88
(ix)Drinking Place, per sq foot $61.53 $61.53
(x)Drive‐in bank, per sq foot $139.77 $139.77
Public Works Reimbursement (any work performed by City forces or under City contract on behalf of a permit
applicant to repair damage to the City infrastructure caused by the permit applicant or contractor under its control,
or any and all roadway or right‐of‐way cleanup efforts performed by City forces or under City contract that resulted
from the work performed by the permit applicant or contractors under its control
An additional technology surcharge shall be required for all fees included in the following Subsections of Section XII, Development Fees, of
the City of Renton Fee Schedule Brochure: Subsection 1, Building Fees; Subsection 2, Land Use Review Fees, except for appeals, critical
areas review fee, and direct EIS costs; Subsections b, e, f, g and h, and n of subsection 3, Public Works Fees; and Section XIII, Fire
Department Fire Marshall Fees
Major (Results in a change of greater than 10% of the cost of construction based on the City's bond quantity
worksheet.)
After hours inspection (applies to inspections performed on Saturdays, Sundays, observed City of Renton holidays,
and non‐holiday Monday‐Fridays outside the hours of 7:00am to 3:30pm)
Permit review staff overtime (applies only if permit review is requested by the applicant to be performed on
Saturdays, Sundays, observed City of Renton holidays, and non‐holiday Monday‐Fridays outside of the hours of city
staff regular work schedule)
30% of system development
charge
30% of system development
charge
Water Fee; Annual fee equal to thirty percent (30%) of the current system development charge applicable to the size
of the temporary water meter(s).1
30% of system development
charge
30% of system development
charge
Wastewater Fee; Annual fee equal to thirty percent (30%) of the current system development charge applicable to
the size of the temporary domestic water meter(s).1
1Fee shall be paid annually (non‐prorated), and shall be nonrefundable, nontransferable (from one portion of the property to another) and shall not constitute a credit to the system development
charge due at the time of permanent use of the utility system. The application for temporary connection shall consist of a detailed plan and a boundary line of the proposed development service
area for use in the fee determination.
Credit for existing water or sewer service: Any parcel that currently has water and or sewer service is eligible for a prorated system
development charge.
Minor (Results in a change 10% or less than the cost of construction based on the City's bond quantity
worksheet. Excludes minor adjustments that are approved by the City to be shown on record drawings.)
Processing and completion fee, payable upon Council approval of the vacation and upon administrative
determination of appraised value of vacated right‐of‐way.
Temporary connections to a City utility system may be granted for a one‐time, temporary, short‐term use of a portion of the
property for a period not to exceed three (3) consecutive years:
Storm Water Fee; Fee equal to thirty percent (30%) of the current system development charge applicable to that
portion of the property.1
Public Liability and property damage insurance is also required pursuant to RMC 9‐2‐5B, Minimum Permit
Requirements for Excess Right‐of‐Way Use.
a no‐fee permit may be issued only when the applicant is a public agency and when the proposed use of the right‐of
way provides a direct service to the public (e.g., Metro applications for right‐of‐way for bus shelters).
1There is hereby levied and shall be collected a leasehold excise tax on that act or privilege of occupying or using public owned real or personal property through a leasehold interest at the rate
established by the State of Washington
Street and Alley vacation Fees: The imposition, collection, payment and other specifics concerning this charge are detailed in chapter
9‐14 RMC, Vacations.
30% of system development
charge
30% of system development
charge
City of Renton Fee Schedule
2021‐2022
SECTION XII. DEVELOPMENT FEES (CONTINUED)2021 2022
5. Impact Fees: (continued)
(xi)Fast food, no drive‐up, per sq foot $141.85 $141.85
(xii) Fast food, with drive‐up, per sq foot $180.72 $180.72
(xiii)Gas station with convenience store, per pump $65,313.08 $65,313.08
(xiv)Gas station, per pump $87,322.30 $87,322.30
(xv) General office, per sq foot $14.58 $14.58
(xvi)Health/fitness club, per sq foot $36.02 $36.02
(xvii) Hospital, per sq foot $7.79 $7.79
(xviii)Hotel, per room $4,287.51 $4,287.51
(xix) Manufacturing, per sq foot $7.15 $7.15
(xx)Marina, per boat berth $2,286.67 $2,286.67
(xxi) Medical office, per sq foot $32.94 $32.94
(xxii) Mini‐warehouse, per sq foot $2.57 $2.57
(xxiii)Mobile home, per dwelling $6,431.27 $6,431.27
(xxiv) Motel, per room $3,930.22 $3,930.22
(xxv)Movie theater, per seat $643.13 $643.13
(xxvi)Nursing home, per bed $1,786.46 $1,786.46
(xxvii) Restaurant: sit‐down, per sq foot $60.95 $60.95
(xxviii)Senior housing ‐ attached detached, per dwelling $2,929.80 $2,929.80
(xxix) Shopping center, per sq foot $26.58 $26.58
(xxx)Single family house, per dwelling $10,861.69 $10,861.69
(xxxi) Supermarket, per sq foot $65.81 $65.81
(xxxii) Net New PM Peak Hour Person Vehicle Trip (Proposed ‐ Existing), per PM Peak Hour Person Vehicle Trip $7,145.85 $7,145.85
c.Park Impact Fees:1
(i) Single family $2,914.99 $2,914.99
(ii) Multi‐family: 2 units, Duplexes, & Accessory Swelling Unit (ADU)$2,366.28 $2,366.28
(iii) Multi‐family: 3 or 4 units $2,251.97 $2,251.97
(iv) Multi‐family: 5 or more units $1,977.62 $1,977.62
(v) Mobile home $2,069.07 $2,069.07
d.Fire Impact Fees1:
(i) Residential ‐ single family (detached dwellings & duplexes), per dwelling unit $829.77 $829.77
(ii) Residential ‐ multi family & Accessory Dwelling Unit (ADU), per dwelling unit $964.53 $964.53
(iii) Hotel/motel/resort, per sq foot $1.29 $1.29
(iv) Medical care hook $3.92 $3.92
(v) Office, per sq foot $0.26 $0.26
(vi) Medical/dental office, per sq foot $1.99 $1.99
(vii) Retail, per sq foot $1.25 $1.25
(viii) Leisure facilities, per sq foot $2.36 $2.36
(ix) Restaurant/lounge, per sq foot $5.92 $5.92
(x) Industrial/manufacturing, per sq foot $0.15 $0.15
(xi) Church, per sq foot $0.56 $0.56
(xii) Education, per sq foot $0.72 $0.72
(xiii) Special public facilities, per sq foot $4.48 $4.48
*(i)‐(ii) is per unit
*(iii)‐(xiii) is per square foot
e.Independent Fee Calculation Review (or unless otherwise established by School District or Renton Regional Fire Authority $500 $500
f.Impact Fee Deferral Administration:
(i) Each Lot, Single Family Dwelling, or Condominium $85 $85
(ii) Each Multi‐family Building $85 $85
6. Miscellaneous Fees
a.Multifamily Tax Exemption Application $1,000.00 $1,000.00
b.Tree Fee in lieu (per diameter inch measured at 4.5 feet above grade)$225.00 $225.00
SECTION XIII. FIRE DEPARMENT FIRE MARSHAL FEES (RFA)2021 2022
a.Fire plan review and inspection fees:
(i) $0 to $249.99 $35 $35
(ii) $250.00 to $999.99 $35 + 2%
of the cost
$35 + 2%
of the cost
(iii) $1,000.00 to $4,999.99 $60 + 2%
of the cost
$60 + 2%
of the cost
(iv) $5,000.00 to $49,999.99 $175 + 1.5%
of the cost
$175 + 1.5%
of the cost
(v) $50,000.00 to $99,999.99 $400 + 1.2%
of the cost
$400 + 1.2%
of the cost
(vi) $100,000.00 and above $900 + .75%
of the cost
$900 + .75%
of the cost
(vii)$125 $125
(viii)
(ix)
(x) Preventable Fire alarm fee:
(1) First, second, and third preventable alarms N/C N/C
(2) Fourth and fifth preventable alarms in a calendar year, fee is per each alarm $75 $75
(3)$150 $150
(xi) Late Payment Penalty $35 $35
b.Fire Permit type:
(i)$100 $125
(ii) Permits for Mobile food facilities that have passed a fire and life safety inspection in another jurisdiction that $50 $75
has reciprocity with Renton RFA
(iii) Hazardous materials and HPM facilities yearly $175 $200
(iv) Construction permit: 20% of plan review fee ‐ Min.
$52
20% of plan review fee ‐ Min.
$52
Sixth preventable alarm and successive preventable alarms in a calendar year, fee is per each alarm.
Operational fire code permit (issued in accordance with Section 105.6 of the IFC) fee is yearly (includes items such as
fire special events, covered stages, mobile food facilities, hot works, etc.)
Third Re‐Inspection/Pre‐Citation Follow‐Up Inspection when re‐inspections are required beyond the first and second
re‐inspections
$250 $250
1 Per Res. 4422, fees for an Accessory Dwelling Unit (ADU) will be waived as of the adoption date of Res. 4422, through December 31, 2022.
Construction Re‐inspection. Fee is per hour with a 2 hour minimum. The minimum may be assessed if the requested
inspection does not meet the approval of the inspector.
Violation/Second Re‐Inspection after 30‐day period (whenever 30 days or more have passed since Fire Department
notification of a violation, which required a first re‐inspection, and such violation has not been remedied or granted
an extension)
$150 $150
City of Renton Fee Schedule
2021‐2022
SECTION XIII. FIRE DEPARMENT FIRE MARSHAL FEES (RFA) (CONTINUED)2021 2022
(v) Replacement for lost permit, per each $35 ‐
(vi)
(vii) Underground tank removal permit (commercial) See Fire plan review and
construction permit fees
See Fire plan review and
construction permit fees
(viii) Underground tank removal or abandonment‐in‐ place permit (residential)$84 $109
(ix)$125 $125
(x) NSF check fees $25 $25
(xi)3% 3%
Other requested inspection when not required by the fire code. Fee is per hour with a minimum 1 hr when
approved by the Fire Marshal, such as home daycares
RFA technology surcharge fee applied to Fire Department Fire Marshal Fees, subsection a. (i, ii, iii, iv, v, vi) and
subsection b. (iii)
Hazardous production materials permit (for businesses storing, handling, or using hazardous production materials as
regulated in the fire code) permit is yearly
$175 $200